F336837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 224 | 166 | 224 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300026142|Ga0207698_10054857|Ga0207698_100548572 |
| Length | 368 |
| Sequence | MSDAPRIVVLAGDGIGPEIVAAARQVLDALGEFSYDERLMGGCSIDEHGTALTDEVLDACKGADAVLLGAVGGPKWDTTNPDDPRPEQGLLGLRKGMGLYANLRPVRPSPALVGASPLREERIAGTDLLVVRELTGGIYFGDSGRDGDVAHDTCEYSVEEIDRIARTAFDAAQRRAASGRKPKVTSVDKANVLETSRLWREVVGNVAADYGDVELEHLLVDNAAMQLVSRPADFDVVLAENLFGDILSDEAAMLTGSLGMLPSASLGAEGAPGLFEPVHGSAPDIAGQGVANPLATFLSAAMMLRHGLGRGDDAARIEAAVDAVLERGLRTPDLAAGTVIEPPTSGEPMTQTAVGTQEMTAAVLEELG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 166 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0 |
| Rhizoplane | 13.39 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002767 | 3300001977 | Bacteria | 2764 |
| 2 | JGI24748J21848_1001538 | 3300002074 | Bacteria | 2561 |
| 3 | JGI24034J26672_10000204 | 3300002239 | Bacteria | 7946 |
| 4 | JGI24742J22300_10011402 | 3300002244 | Bacteria | 1475 |
| 5 | Ga0070658_10032887 | 3300005327 | Bacteria | 4171 |
| 6 | Ga0070683_100021686 | 3300005329 | Bacteria | 5735 |
| 7 | Ga0070683_100066933 | 3300005329 | Bacteria | 3346 |
| 8 | Ga0070677_10000468 | 3300005333 | Bacteria | 13840 |
| 9 | Ga0070682_100001488 | 3300005337 | Bacteria | 13140 |
| 10 | Ga0068868_100001000 | 3300005338 | Bacteria | 19303 |
| 11 | Ga0070689_100064455 | 3300005340 | Bacteria | 2852 |
| 12 | Ga0070691_10000362 | 3300005341 | Bacteria | 16367 |
| 13 | Ga0070661_100000035 | 3300005344 | Bacteria | 111363 |
| 14 | Ga0070675_100000377 | 3300005354 | Bacteria | 30146 |
| 15 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 16 | Ga0070673_100003827 | 3300005364 | Bacteria | 9441 |
| 17 | Ga0070688_100000696 | 3300005365 | Bacteria | 16651 |
| 18 | Ga0070688_100019656 | 3300005365 | Bacteria | 3916 |
| 19 | Ga0070667_100128799 | 3300005367 | Bacteria | 2208 |
| 20 | Ga0070714_100252572 | 3300005435 | Bacteria | 1631 |
| 21 | Ga0070713_100000380 | 3300005436 | Bacteria | 28361 |
| 22 | Ga0070678_100004874 | 3300005456 | Bacteria | 7669 |
| 23 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 24 | Ga0068867_100025896 | 3300005459 | Bacteria | 4208 |
| 25 | Ga0070685_10000174 | 3300005466 | Bacteria | 42617 |
| 26 | Ga0070685_10001054 | 3300005466 | Bacteria | 14805 |
| 27 | Ga0070684_100025302 | 3300005535 | Bacteria | 4988 |
| 28 | Ga0068853_100053698 | 3300005539 | Bacteria | 3470 |
| 29 | Ga0070672_100000006 | 3300005543 | Bacteria | 117060 |
| 30 | Ga0070686_100069032 | 3300005544 | Bacteria | 2307 |
| 31 | Ga0070665_100021450 | 3300005548 | Bacteria | 6496 |
| 32 | Ga0070665_100162424 | 3300005548 | Bacteria | 2236 |
| 33 | Ga0068854_100001557 | 3300005578 | Bacteria | 13919 |
| 34 | Ga0068856_100001768 | 3300005614 | Bacteria | 22576 |
| 35 | Ga0068852_100001531 | 3300005616 | Bacteria | 15680 |
| 36 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 37 | Ga0068851_10000945 | 3300005834 | Bacteria | 12571 |
| 38 | Ga0068851_10014455 | 3300005834 | Bacteria | 3748 |
| 39 | Ga0068863_100005037 | 3300005841 | Bacteria | 13029 |
| 40 | Ga0068863_100013867 | 3300005841 | Bacteria | 7770 |
| 41 | Ga0068860_100006216 | 3300005843 | Bacteria | 12009 |
| 42 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 43 | Ga0070712_100004960 | 3300006175 | Bacteria | 8231 |
| 44 | Ga0075433_10000244 | 3300006852 | Bacteria | 31446 |
| 45 | Ga0068865_100000293 | 3300006881 | Bacteria | 27538 |
| 46 | Ga0105245_10000116 | 3300009098 | Bacteria | 77303 |
| 47 | Ga0105245_10025332 | 3300009098 | Bacteria | 5217 |
| 48 | Ga0105247_10001919 | 3300009101 | Bacteria | 14503 |
| 49 | Ga0105243_10024929 | 3300009148 | Bacteria | 4566 |
| 50 | Ga0105248_10001622 | 3300009177 | Bacteria | 24979 |
| 51 | Ga0105249_10000070 | 3300009553 | Bacteria | 147277 |
| 52 | Ga0157371_10006801 | 3300013102 | Bacteria | 9348 |
| 53 | Ga0157369_10000078 | 3300013105 | Bacteria | 135173 |
| 54 | Ga0157378_10140739 | 3300013297 | Bacteria | 2240 |
| 55 | Ga0157372_10005056 | 3300013307 | Bacteria | 14012 |
| 56 | Ga0157375_10052588 | 3300013308 | Bacteria | 4005 |
| 57 | Ga0157380_10000445 | 3300014326 | Bacteria | 25326 |
| 58 | Ga0157379_10070388 | 3300014968 | Bacteria | 3129 |
| 59 | Ga0157379_10089273 | 3300014968 | Bacteria | 2765 |
| 60 | Ga0206354_11518046 | 3300020081 | Bacteria | 1703 |
| 61 | Ga0207656_10000514 | 3300025321 | Bacteria | 12807 |
| 62 | Ga0207682_10000140 | 3300025893 | Bacteria | 32624 |
| 63 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 64 | Ga0207642_10045537 | 3300025899 | Bacteria | 1948 |
| 65 | Ga0207710_10000243 | 3300025900 | Bacteria | 46286 |
| 66 | Ga0207680_10020160 | 3300025903 | Bacteria | 3582 |
| 67 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 68 | Ga0207705_10057982 | 3300025909 | Bacteria | 2794 |
| 69 | Ga0207693_10006084 | 3300025915 | Bacteria | 9995 |
| 70 | Ga0207649_10000028 | 3300025920 | Bacteria | 161482 |
| 71 | Ga0207650_10012491 | 3300025925 | Bacteria | 5862 |
| 72 | Ga0207659_10000246 | 3300025926 | Bacteria | 32971 |
| 73 | Ga0207687_10000031 | 3300025927 | Bacteria | 150246 |
| 74 | Ga0207687_10002310 | 3300025927 | Bacteria | 12979 |
| 75 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 76 | Ga0207664_10036755 | 3300025929 | Bacteria | 3786 |
| 77 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 78 | Ga0207686_10000199 | 3300025934 | Bacteria | 46373 |
| 79 | Ga0207686_10003593 | 3300025934 | Bacteria | 8311 |
| 80 | Ga0207709_10005829 | 3300025935 | Bacteria | 6962 |
| 81 | Ga0207709_10021776 | 3300025935 | Bacteria | 3630 |
| 82 | Ga0207670_10047538 | 3300025936 | Bacteria | 2859 |
| 83 | Ga0207670_10152169 | 3300025936 | Bacteria | 1718 |
| 84 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 85 | Ga0207669_10000131 | 3300025937 | Bacteria | 37319 |
| 86 | Ga0207704_10000103 | 3300025938 | Bacteria | 47628 |
| 87 | Ga0207665_10048958 | 3300025939 | Bacteria | 2839 |
| 88 | Ga0207691_10000025 | 3300025940 | Bacteria | 129424 |
| 89 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 90 | Ga0207661_10000739 | 3300025944 | Bacteria | 21204 |
| 91 | Ga0207661_10002534 | 3300025944 | Bacteria | 12567 |
| 92 | Ga0207661_10024496 | 3300025944 | Bacteria | 4575 |
| 93 | Ga0207651_10000406 | 3300025960 | Bacteria | 18224 |
| 94 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 95 | Ga0207640_10000686 | 3300025981 | Bacteria | 19687 |
| 96 | Ga0207658_10028584 | 3300025986 | Bacteria | 3927 |
| 97 | Ga0207658_10368022 | 3300025986 | Bacteria | 1256 |
| 98 | Ga0207677_10001183 | 3300026023 | Bacteria | 14189 |
| 99 | Ga0207639_10034583 | 3300026041 | Bacteria | 3736 |
| 100 | Ga0207678_10337525 | 3300026067 | Bacteria | 1298 |
| 101 | Ga0207702_10000242 | 3300026078 | Bacteria | 63808 |
| 102 | Ga0207702_10005503 | 3300026078 | Bacteria | 11081 |
| 103 | Ga0207641_10000077 | 3300026088 | Bacteria | 144978 |
| 104 | Ga0207641_10002316 | 3300026088 | Bacteria | 17682 |
| 105 | Ga0207648_10014120 | 3300026089 | Bacteria | 7385 |
| 106 | Ga0207683_10007872 | 3300026121 | Bacteria | 9117 |
| 107 | Ga0207698_10000414 | 3300026142 | Bacteria | 24644 |
| 108 | Ga0207698_10054857 | 3300026142 | Bacteria | 3068 |
| 109 | Ga0268266_10001578 | 3300028379 | Bacteria | 26646 |
| 110 | Ga0268266_10001702 | 3300028379 | Bacteria | 25200 |
| 111 | Ga0268266_10200621 | 3300028379 | Bacteria | 1825 |
| 112 | Ga0268264_10025533 | 3300028381 | Bacteria | 4828 |
| 113 | Ga0265326_10000084 | 3300028558 | Bacteria | 50129 |
| 114 | Ga0265319_1000110 | 3300028563 | Bacteria | 63277 |
| 115 | Ga0265322_10000198 | 3300028654 | Bacteria | 26588 |
| 116 | Ga0265338_10000578 | 3300028800 | Bacteria | 64450 |
| 117 | Ga0265324_10001108 | 3300029957 | Bacteria | 16206 |
| 118 | Ga0265328_10002315 | 3300031239 | Bacteria | 8588 |
| 119 | Ga0265320_10000035 | 3300031240 | Bacteria | 137855 |
| 120 | Ga0265325_10007335 | 3300031241 | Bacteria | 6609 |
| 121 | Ga0265331_10005939 | 3300031250 | Bacteria | 7292 |
| 122 | Ga0265331_10044957 | 3300031250 | Bacteria | 2133 |
| 123 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 124 | Ga0265314_10000690 | 3300031711 | Bacteria | 40955 |
| 125 | Ga0316576_10019098 | 3300031727 | Bacteria | 4692 |
| 126 | Ga0307415_100023360 | 3300032126 | Bacteria | 3836 |
| 127 | Ga0316574_0001485 | 3300035398 | Bacteria | 11177 |
| 128 | Ga0316574_0003978 | 3300035398 | Bacteria | 7696 |
| 129 | Ga0466963_0000022 | 3300044694 | Bacteria | 52600 |
| 130 | Ga0466963_0139031 | 3300044694 | Bacteria | 1681 |
| 131 | Ga0466967_0000771 | 3300045976 | Bacteria | 16619 |
| 132 | Ga0466967_0086015 | 3300045976 | Bacteria | 2848 |
| 133 | Ga0495592_0000912 | 3300046454 | Bacteria | 20489 |
| 134 | Ga0495603_0000471 | 3300046455 | Bacteria | 22167 |
| 135 | Ga0495629_0000999 | 3300046459 | Bacteria | 22693 |
| 136 | Ga0495629_0006051 | 3300046459 | Bacteria | 8991 |
| 137 | Ga0495641_0006866 | 3300046461 | Bacteria | 7275 |
| 138 | Ga0495651_0108496 | 3300046462 | Bacteria | 2056 |
| 139 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 140 | Ga0495662_0002177 | 3300046476 | Bacteria | 9850 |
| 141 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 142 | Ga0495606_0003906 | 3300046507 | Bacteria | 15347 |
| 143 | Ga0495608_0000036 | 3300046511 | Bacteria | 129609 |
| 144 | Ga0495608_0020036 | 3300046511 | Bacteria | 4598 |
| 145 | Ga0495608_0143207 | 3300046511 | Bacteria | 1525 |
| 146 | Ga0495628_0007522 | 3300046516 | Bacteria | 9426 |
| 147 | Ga0495630_0001632 | 3300046517 | Bacteria | 15592 |
| 148 | Ga0495652_0000023 | 3300046529 | Bacteria | 168049 |
| 149 | Ga0495652_0003640 | 3300046529 | Bacteria | 15091 |
| 150 | Ga0495587_0000703 | 3300046536 | Bacteria | 22378 |
| 151 | Ga0495645_0001215 | 3300046543 | Bacteria | 17592 |
| 152 | Ga0495645_0011464 | 3300046543 | Bacteria | 6239 |
| 153 | Ga0495622_0000021 | 3300046557 | Bacteria | 162267 |
| 154 | Ga0495667_0000034 | 3300046559 | Bacteria | 141464 |
| 155 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 156 | Ga0495625_0000506 | 3300046660 | Bacteria | 57832 |
| 157 | Ga0495588_0000393 | 3300046674 | Bacteria | 24845 |
| 158 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 159 | Ga0495657_0006478 | 3300046675 | Bacteria | 9155 |
| 160 | Ga0495647_0000043 | 3300046681 | Bacteria | 36874 |
| 161 | Ga0495647_0000502 | 3300046681 | Bacteria | 11377 |
| 162 | Ga0495647_0005348 | 3300046681 | Bacteria | 4205 |
| 163 | Ga0495647_0028160 | 3300046681 | Bacteria | 2070 |
| 164 | Ga0495658_0000193 | 3300046683 | Bacteria | 35142 |
| 165 | Ga0495658_0009046 | 3300046683 | Bacteria | 4952 |
| 166 | Ga0495613_0000860 | 3300046689 | Bacteria | 23282 |
| 167 | Ga0495624_0002138 | 3300046690 | Bacteria | 15054 |
| 168 | Ga0495624_0139701 | 3300046690 | Bacteria | 1484 |
| 169 | Ga0495600_0003398 | 3300046809 | Bacteria | 9370 |
| 170 | Ga0495604_0000122 | 3300047317 | Bacteria | 65938 |
| 171 | Ga0495604_0000267 | 3300047317 | Bacteria | 46398 |
| 172 | Ga0495604_0041260 | 3300047317 | Bacteria | 3620 |
| 173 | Ga0495674_0000059 | 3300047319 | Bacteria | 73353 |
| 174 | Ga0495676_0001626 | 3300047321 | Bacteria | 19533 |
| 175 | Ga0495676_0051729 | 3300047321 | Bacteria | 3284 |
| 176 | Ga0495680_0001649 | 3300047322 | Bacteria | 23717 |
| 177 | Ga0495675_0000515 | 3300047444 | Bacteria | 25086 |
| 178 | Ga0495593_0007679 | 3300047673 | Bacteria | 6294 |
| 179 | Ga0495602_0000166 | 3300048088 | Bacteria | 61220 |
| 180 | Ga0495602_0007040 | 3300048088 | Bacteria | 11806 |
| 181 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 182 | Ga0496101_0000493 | 3300048904 | Bacteria | 24897 |
| 183 | Ga0496102_0000081 | 3300048905 | Bacteria | 139266 |
| 184 | Ga0496103_0000031 | 3300048906 | Bacteria | 204016 |
| 185 | Ga0496103_0101231 | 3300048906 | Bacteria | 1824 |
| 186 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 187 | Ga0496104_0000077 | 3300048907 | Bacteria | 100848 |
| 188 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 189 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 190 | Ga0496105_0056104 | 3300048908 | Bacteria | 3252 |
| 191 | Ga0496106_0000193 | 3300048909 | Bacteria | 42951 |
| 192 | Ga0496107_0000094 | 3300048910 | Bacteria | 42797 |
| 193 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 194 | Ga0496108_0000355 | 3300048911 | Bacteria | 38685 |
| 195 | Ga0496108_0003065 | 3300048911 | Bacteria | 13430 |
| 196 | Ga0496108_0012185 | 3300048911 | Bacteria | 6992 |
| 197 | Ga0496108_0034583 | 3300048911 | Bacteria | 4199 |
| 198 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 199 | Ga0496109_0000400 | 3300048912 | Bacteria | 39194 |
| 200 | Ga0496109_0000903 | 3300048912 | Bacteria | 24701 |
| 201 | Ga0496109_0001433 | 3300048912 | Bacteria | 19779 |
| 202 | Ga0496110_0000011 | 3300048913 | Bacteria | 97293 |
| 203 | Ga0496110_0032974 | 3300048913 | Bacteria | 4478 |
| 204 | Ga0496111_0000793 | 3300048914 | Bacteria | 16908 |
| 205 | Ga0496111_0106902 | 3300048914 | Bacteria | 2059 |
| 206 | Ga0496112_0000980 | 3300048915 | Bacteria | 20831 |
| 207 | Ga0496113_0000283 | 3300048916 | Bacteria | 23978 |
| 208 | Ga0496114_0043175 | 3300048917 | Bacteria | 3739 |
| 209 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 210 | Ga0496115_0001569 | 3300048918 | Bacteria | 16428 |
| 211 | Ga0501040_0106808 | 3300049576 | Bacteria | 1956 |
| 212 | Ga0501071_0264568 | 3300049587 | Bacteria | 1299 |
| 213 | Ga0501076_0006764 | 3300049592 | Bacteria | 8322 |
| 214 | Ga0501083_0092497 | 3300049744 | Bacteria | 1996 |
| 215 | Ga0495601_0000034 | 3300053077 | Bacteria | 93719 |
| 216 | Ga0495612_0000489 | 3300053078 | Bacteria | 15785 |
| 217 | Ga0495655_0000023 | 3300053083 | Bacteria | 39507 |
| 218 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 219 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 220 | Ga0495619_0000277 | 3300053085 | Bacteria | 36725 |
| 221 | Ga0495619_0000602 | 3300053085 | Bacteria | 23838 |
| 222 | Ga0495619_0001511 | 3300053085 | Bacteria | 15342 |
| 223 | Ga0500566_0002030 | 3300053094 | Bacteria | 11955 |
| 224 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0106808 | Ga0501040_0106808_766_1719 | 314 |
| 2 | 3300046536 | Ga0495587_0000703 | Ga0495587_0000703_12969_14003 | 329 |
| 3 | 3300006852 | Ga0075433_10000244 | Ga0075433_1000024425 | 335 |
| 4 | 3300005841 | Ga0068863_100005037 | Ga0068863_1000050373 | 336 |
| 5 | 3300026088 | Ga0207641_10000077 | Ga0207641_10000077115 | 336 |
| 6 | 3300046543 | Ga0495645_0001215 | Ga0495645_0001215_8721_9794 | 337 |
| 7 | 3300006163 | Ga0070715_10000014 | Ga0070715_10000014157 | 338 |
| 8 | 3300025905 | Ga0207685_10000025 | Ga0207685_1000002510 | 338 |
| 9 | 3300025936 | Ga0207670_10152169 | Ga0207670_101521692 | 338 |
| 10 | 3300046454 | Ga0495592_0000912 | Ga0495592_0000912_6540_7616 | 338 |
| 11 | 3300049587 | Ga0501071_0264568 | Ga0501071_0264568_206_1231 | 338 |
| 12 | 3300046455 | Ga0495603_0000471 | Ga0495603_0000471_1317_2366 | 347 |
| 13 | 3300046681 | Ga0495647_0028160 | Ga0495647_0028160_76_1125 | 347 |
| 14 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_216986_218035 | 347 |
| 15 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_389729_390778 | 347 |
| 16 | 3300005341 | Ga0070691_10000362 | Ga0070691_1000036211 | 352 |
| 17 | 3300025939 | Ga0207665_10048958 | Ga0207665_100489582 | 352 |
| 18 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_10878_11945 | 353 |
| 19 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_217969_219036 | 353 |
| 20 | 3300005841 | Ga0068863_100013867 | Ga0068863_1000138673 | 354 |
| 21 | 3300026088 | Ga0207641_10002316 | Ga0207641_100023166 | 354 |
| 22 | 3300046511 | Ga0495608_0143207 | Ga0495608_0143207_326_1396 | 354 |
| 23 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_103375_104439 | 354 |
| 24 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_295044_296108 | 354 |
| 25 | 3300005333 | Ga0070677_10000468 | Ga0070677_1000046811 | 355 |
| 26 | 3300009553 | Ga0105249_10000070 | Ga0105249_1000007010 | 355 |
| 27 | 3300014968 | Ga0157379_10070388 | Ga0157379_100703883 | 355 |
| 28 | 3300025893 | Ga0207682_10000140 | Ga0207682_1000014020 | 355 |
| 29 | 3300025961 | Ga0207712_10000019 | Ga0207712_10000019301 | 355 |
| 30 | 3300044694 | Ga0466963_0000022 | Ga0466963_0000022_10654_11724 | 355 |
| 31 | 3300046681 | Ga0495647_0000043 | Ga0495647_0000043_25351_26424 | 355 |
| 32 | 3300046681 | Ga0495647_0005348 | Ga0495647_0005348_3104_4177 | 355 |
| 33 | 3300046690 | Ga0495624_0139701 | Ga0495624_0139701_280_1353 | 355 |
| 34 | 3300002074 | JGI24748J21848_1001538 | JGI24748J21848_10015383 | 356 |
| 35 | 3300002239 | JGI24034J26672_10000204 | JGI24034J26672_100002044 | 356 |
| 36 | 3300002244 | JGI24742J22300_10011402 | JGI24742J22300_100114021 | 356 |
| 37 | 3300005329 | Ga0070683_100066933 | Ga0070683_1000669332 | 356 |
| 38 | 3300005356 | Ga0070674_100000012 | Ga0070674_100000012118 | 356 |
| 39 | 3300005364 | Ga0070673_100003827 | Ga0070673_1000038274 | 356 |
| 40 | 3300005457 | Ga0070662_100000006 | Ga0070662_100000006160 | 356 |
| 41 | 3300005459 | Ga0068867_100025896 | Ga0068867_1000258961 | 356 |
| 42 | 3300005535 | Ga0070684_100025302 | Ga0070684_1000253022 | 356 |
| 43 | 3300005718 | Ga0068866_10000004 | Ga0068866_10000004197 | 356 |
| 44 | 3300005843 | Ga0068860_100006216 | Ga0068860_1000062163 | 356 |
| 45 | 3300014326 | Ga0157380_10000445 | Ga0157380_1000044510 | 356 |
| 46 | 3300025899 | Ga0207642_10000005 | Ga0207642_1000000510 | 356 |
| 47 | 3300025929 | Ga0207664_10036755 | Ga0207664_100367553 | 356 |
| 48 | 3300025933 | Ga0207706_10000017 | Ga0207706_10000017160 | 356 |
| 49 | 3300025935 | Ga0207709_10021776 | Ga0207709_100217763 | 356 |
| 50 | 3300025937 | Ga0207669_10000017 | Ga0207669_10000017103 | 356 |
| 51 | 3300025937 | Ga0207669_10000131 | Ga0207669_100001319 | 356 |
| 52 | 3300025944 | Ga0207661_10024496 | Ga0207661_100244963 | 356 |
| 53 | 3300025960 | Ga0207651_10000406 | Ga0207651_100004066 | 356 |
| 54 | 3300026067 | Ga0207678_10337525 | Ga0207678_103375251 | 356 |
| 55 | 3300026089 | Ga0207648_10014120 | Ga0207648_100141209 | 356 |
| 56 | 3300028381 | Ga0268264_10025533 | Ga0268264_100255333 | 356 |
| 57 | 3300046462 | Ga0495651_0108496 | Ga0495651_0108496_699_1775 | 356 |
| 58 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_199513_200589 | 356 |
| 59 | 3300046511 | Ga0495608_0020036 | Ga0495608_0020036_3455_4531 | 356 |
| 60 | 3300046529 | Ga0495652_0003640 | Ga0495652_0003640_3274_4350 | 356 |
| 61 | 3300046543 | Ga0495645_0011464 | Ga0495645_0011464_2683_3759 | 356 |
| 62 | 3300046675 | Ga0495657_0006478 | Ga0495657_0006478_1162_2247 | 356 |
| 63 | 3300046683 | Ga0495658_0000193 | Ga0495658_0000193_24031_25107 | 356 |
| 64 | 3300047317 | Ga0495604_0000267 | Ga0495604_0000267_10500_11582 | 356 |
| 65 | 3300048908 | Ga0496105_0056104 | Ga0496105_0056104_1827_2903 | 356 |
| 66 | 3300048914 | Ga0496111_0106902 | Ga0496111_0106902_587_1672 | 356 |
| 67 | 3300053078 | Ga0495612_0000489 | Ga0495612_0000489_4787_5863 | 356 |
| 68 | 3300031727 | Ga0316576_10019098 | Ga0316576_100190983 | 358 |
| 69 | 3300035398 | Ga0316574_0001485 | Ga0316574_0001485_3297_4388 | 358 |
| 70 | 3300035398 | Ga0316574_0003978 | Ga0316574_0003978_6366_7466 | 358 |
| 71 | 3300046459 | Ga0495629_0006051 | Ga0495629_0006051_6648_7757 | 358 |
| 72 | 3300047321 | Ga0495676_0051729 | Ga0495676_0051729_350_1459 | 358 |
| 73 | 3300046529 | Ga0495652_0000023 | Ga0495652_0000023_152287_153378 | 359 |
| 74 | 3300048911 | Ga0496108_0003065 | Ga0496108_0003065_9736_10821 | 359 |
| 75 | 3300048912 | Ga0496109_0001433 | Ga0496109_0001433_9818_10903 | 359 |
| 76 | 3300009098 | Ga0105245_10000116 | Ga0105245_1000011666 | 360 |
| 77 | 3300046516 | Ga0495628_0007522 | Ga0495628_0007522_4463_5551 | 360 |
| 78 | 3300048088 | Ga0495602_0007040 | Ga0495602_0007040_4142_5230 | 360 |
| 79 | 3300045976 | Ga0466967_0086015 | Ga0466967_0086015_113_1219 | 366 |
| 80 | 3300049744 | Ga0501083_0092497 | Ga0501083_0092497_231_1340 | 366 |
| 81 | 3300005340 | Ga0070689_100064455 | Ga0070689_1000644553 | 367 |
| 82 | 3300005365 | Ga0070688_100019656 | Ga0070688_1000196563 | 367 |
| 83 | 3300005367 | Ga0070667_100128799 | Ga0070667_1001287992 | 367 |
| 84 | 3300005435 | Ga0070714_100252572 | Ga0070714_1002525722 | 367 |
| 85 | 3300005456 | Ga0070678_100004874 | Ga0070678_1000048745 | 367 |
| 86 | 3300005466 | Ga0070685_10000174 | Ga0070685_1000017429 | 367 |
| 87 | 3300009101 | Ga0105247_10001919 | Ga0105247_1000191910 | 367 |
| 88 | 3300013308 | Ga0157375_10052588 | Ga0157375_100525883 | 367 |
| 89 | 3300014968 | Ga0157379_10089273 | Ga0157379_100892731 | 367 |
| 90 | 3300025899 | Ga0207642_10045537 | Ga0207642_100455372 | 367 |
| 91 | 3300025900 | Ga0207710_10000243 | Ga0207710_1000024331 | 367 |
| 92 | 3300025903 | Ga0207680_10020160 | Ga0207680_100201604 | 367 |
| 93 | 3300025925 | Ga0207650_10012491 | Ga0207650_100124914 | 367 |
| 94 | 3300025934 | Ga0207686_10000199 | Ga0207686_1000019910 | 367 |
| 95 | 3300025934 | Ga0207686_10003593 | Ga0207686_100035934 | 367 |
| 96 | 3300025936 | Ga0207670_10047538 | Ga0207670_100475382 | 367 |
| 97 | 3300025986 | Ga0207658_10028584 | Ga0207658_100285843 | 367 |
| 98 | 3300025986 | Ga0207658_10368022 | Ga0207658_103680221 | 367 |
| 99 | 3300026078 | Ga0207702_10005503 | Ga0207702_100055036 | 367 |
| 100 | 3300026121 | Ga0207683_10007872 | Ga0207683_100078725 | 367 |
| 101 | 3300026142 | Ga0207698_10054857 | Ga0207698_100548572 | 367 |
| 102 | 3300028379 | Ga0268266_10001702 | Ga0268266_100017022 | 367 |
| 103 | 3300028379 | Ga0268266_10200621 | Ga0268266_102006212 | 367 |
| 104 | 3300028558 | Ga0265326_10000084 | Ga0265326_1000008410 | 367 |
| 105 | 3300028563 | Ga0265319_1000110 | Ga0265319_100011052 | 367 |
| 106 | 3300028654 | Ga0265322_10000198 | Ga0265322_1000019810 | 367 |
| 107 | 3300028800 | Ga0265338_10000578 | Ga0265338_1000057853 | 367 |
| 108 | 3300029957 | Ga0265324_10001108 | Ga0265324_100011088 | 367 |
| 109 | 3300031239 | Ga0265328_10002315 | Ga0265328_100023152 | 367 |
| 110 | 3300031240 | Ga0265320_10000035 | Ga0265320_10000035111 | 367 |
| 111 | 3300031241 | Ga0265325_10007335 | Ga0265325_100073355 | 367 |
| 112 | 3300031250 | Ga0265331_10005939 | Ga0265331_100059396 | 367 |
| 113 | 3300031250 | Ga0265331_10044957 | Ga0265331_100449572 | 367 |
| 114 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015387 | 367 |
| 115 | 3300031711 | Ga0265314_10000690 | Ga0265314_1000069028 | 367 |
| 116 | 3300044694 | Ga0466963_0139031 | Ga0466963_0139031_430_1533 | 367 |
| 117 | 3300045976 | Ga0466967_0000771 | Ga0466967_0000771_11343_12452 | 367 |
| 118 | 3300046461 | Ga0495641_0006866 | Ga0495641_0006866_1732_2841 | 367 |
| 119 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_59226_60335 | 367 |
| 120 | 3300046511 | Ga0495608_0000036 | Ga0495608_0000036_117436_118545 | 367 |
| 121 | 3300046517 | Ga0495630_0001632 | Ga0495630_0001632_3949_5055 | 367 |
| 122 | 3300046557 | Ga0495622_0000021 | Ga0495622_0000021_129622_130731 | 367 |
| 123 | 3300046559 | Ga0495667_0000034 | Ga0495667_0000034_125897_127006 | 367 |
| 124 | 3300046660 | Ga0495625_0000506 | Ga0495625_0000506_41691_42800 | 367 |
| 125 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_117436_118545 | 367 |
| 126 | 3300046681 | Ga0495647_0000502 | Ga0495647_0000502_5773_6879 | 367 |
| 127 | 3300046690 | Ga0495624_0002138 | Ga0495624_0002138_3519_4625 | 367 |
| 128 | 3300047319 | Ga0495674_0000059 | Ga0495674_0000059_13473_14582 | 367 |
| 129 | 3300047321 | Ga0495676_0001626 | Ga0495676_0001626_12931_14040 | 367 |
| 130 | 3300047322 | Ga0495680_0001649 | Ga0495680_0001649_11733_12842 | 367 |
| 131 | 3300047444 | Ga0495675_0000515 | Ga0495675_0000515_11088_12197 | 367 |
| 132 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_10925_12034 | 367 |
| 133 | 3300048904 | Ga0496101_0000493 | Ga0496101_0000493_12923_14032 | 367 |
| 134 | 3300048905 | Ga0496102_0000081 | Ga0496102_0000081_125704_126813 | 367 |
| 135 | 3300048906 | Ga0496103_0000031 | Ga0496103_0000031_11531_12640 | 367 |
| 136 | 3300048906 | Ga0496103_0101231 | Ga0496103_0101231_547_1659 | 367 |
| 137 | 3300048907 | Ga0496104_0000077 | Ga0496104_0000077_14010_15119 | 367 |
| 138 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_85730_86839 | 367 |
| 139 | 3300048909 | Ga0496106_0000193 | Ga0496106_0000193_10875_11984 | 367 |
| 140 | 3300048910 | Ga0496107_0000094 | Ga0496107_0000094_10744_11853 | 367 |
| 141 | 3300048911 | Ga0496108_0012185 | Ga0496108_0012185_5863_6966 | 367 |
| 142 | 3300048917 | Ga0496114_0043175 | Ga0496114_0043175_513_1622 | 367 |
| 143 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_215183_216292 | 367 |
| 144 | 3300048918 | Ga0496115_0001569 | Ga0496115_0001569_63_1172 | 367 |
| 145 | 3300049592 | Ga0501076_0006764 | Ga0501076_0006764_5327_6439 | 367 |
| 146 | 3300053083 | Ga0495655_0000023 | Ga0495655_0000023_25471_26580 | 367 |
| 147 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_327097_328206 | 367 |
| 148 | 3300053085 | Ga0495619_0001511 | Ga0495619_0001511_3667_4776 | 367 |
| 149 | 3300053094 | Ga0500566_0002030 | Ga0500566_0002030_2581_3690 | 367 |
| 150 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_415887_416996 | 367 |
| 151 | 3300001977 | JGI24746J21847_1002767 | JGI24746J21847_10027672 | 368 |
| 152 | 3300005327 | Ga0070658_10032887 | Ga0070658_100328874 | 368 |
| 153 | 3300005329 | Ga0070683_100021686 | Ga0070683_1000216863 | 368 |
| 154 | 3300005337 | Ga0070682_100001488 | Ga0070682_10000148811 | 368 |
| 155 | 3300005338 | Ga0068868_100001000 | Ga0068868_1000010008 | 368 |
| 156 | 3300005344 | Ga0070661_100000035 | Ga0070661_10000003511 | 368 |
| 157 | 3300005354 | Ga0070675_100000377 | Ga0070675_10000037720 | 368 |
| 158 | 3300005365 | Ga0070688_100000696 | Ga0070688_1000006965 | 368 |
| 159 | 3300005436 | Ga0070713_100000380 | Ga0070713_10000038020 | 368 |
| 160 | 3300005466 | Ga0070685_10001054 | Ga0070685_1000105410 | 368 |
| 161 | 3300005539 | Ga0068853_100053698 | Ga0068853_1000536983 | 368 |
| 162 | 3300005543 | Ga0070672_100000006 | Ga0070672_100000006115 | 368 |
| 163 | 3300005544 | Ga0070686_100069032 | Ga0070686_1000690322 | 368 |
| 164 | 3300005548 | Ga0070665_100021450 | Ga0070665_1000214505 | 368 |
| 165 | 3300005548 | Ga0070665_100162424 | Ga0070665_1001624242 | 368 |
| 166 | 3300005578 | Ga0068854_100001557 | Ga0068854_1000015574 | 368 |
| 167 | 3300005614 | Ga0068856_100001768 | Ga0068856_10000176811 | 368 |
| 168 | 3300005616 | Ga0068852_100001531 | Ga0068852_1000015316 | 368 |
| 169 | 3300005834 | Ga0068851_10000945 | Ga0068851_100009453 | 368 |
| 170 | 3300005834 | Ga0068851_10014455 | Ga0068851_100144554 | 368 |
| 171 | 3300006175 | Ga0070712_100004960 | Ga0070712_1000049602 | 368 |
| 172 | 3300006881 | Ga0068865_100000293 | Ga0068865_10000029321 | 368 |
| 173 | 3300009098 | Ga0105245_10025332 | Ga0105245_100253323 | 368 |
| 174 | 3300009148 | Ga0105243_10024929 | Ga0105243_100249293 | 368 |
| 175 | 3300009177 | Ga0105248_10001622 | Ga0105248_1000162215 | 368 |
| 176 | 3300013102 | Ga0157371_10006801 | Ga0157371_100068018 | 368 |
| 177 | 3300013105 | Ga0157369_10000078 | Ga0157369_10000078128 | 368 |
| 178 | 3300013297 | Ga0157378_10140739 | Ga0157378_101407392 | 368 |
| 179 | 3300013307 | Ga0157372_10005056 | Ga0157372_100050566 | 368 |
| 180 | 3300020081 | Ga0206354_11518046 | Ga0206354_115180462 | 368 |
| 181 | 3300025321 | Ga0207656_10000514 | Ga0207656_1000051411 | 368 |
| 182 | 3300025909 | Ga0207705_10057982 | Ga0207705_100579823 | 368 |
| 183 | 3300025915 | Ga0207693_10006084 | Ga0207693_100060848 | 368 |
| 184 | 3300025920 | Ga0207649_10000028 | Ga0207649_10000028149 | 368 |
| 185 | 3300025926 | Ga0207659_10000246 | Ga0207659_1000024610 | 368 |
| 186 | 3300025927 | Ga0207687_10000031 | Ga0207687_10000031145 | 368 |
| 187 | 3300025927 | Ga0207687_10002310 | Ga0207687_100023108 | 368 |
| 188 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003310 | 368 |
| 189 | 3300025935 | Ga0207709_10005829 | Ga0207709_100058294 | 368 |
| 190 | 3300025938 | Ga0207704_10000103 | Ga0207704_100001039 | 368 |
| 191 | 3300025940 | Ga0207691_10000025 | Ga0207691_1000002510 | 368 |
| 192 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006384 | 368 |
| 193 | 3300025944 | Ga0207661_10000739 | Ga0207661_1000073910 | 368 |
| 194 | 3300025944 | Ga0207661_10002534 | Ga0207661_1000253410 | 368 |
| 195 | 3300025981 | Ga0207640_10000686 | Ga0207640_100006869 | 368 |
| 196 | 3300026023 | Ga0207677_10001183 | Ga0207677_100011834 | 368 |
| 197 | 3300026041 | Ga0207639_10034583 | Ga0207639_100345832 | 368 |
| 198 | 3300026078 | Ga0207702_10000242 | Ga0207702_1000024249 | 368 |
| 199 | 3300026142 | Ga0207698_10000414 | Ga0207698_1000041411 | 368 |
| 200 | 3300028379 | Ga0268266_10001578 | Ga0268266_1000157810 | 368 |
| 201 | 3300032126 | Ga0307415_100023360 | Ga0307415_1000233604 | 368 |
| 202 | 3300046459 | Ga0495629_0000999 | Ga0495629_0000999_11076_12182 | 368 |
| 203 | 3300046476 | Ga0495662_0002177 | Ga0495662_0002177_3507_4616 | 368 |
| 204 | 3300046507 | Ga0495606_0003906 | Ga0495606_0003906_10749_11855 | 368 |
| 205 | 3300046674 | Ga0495588_0000393 | Ga0495588_0000393_11290_12399 | 368 |
| 206 | 3300046683 | Ga0495658_0009046 | Ga0495658_0009046_3486_4595 | 368 |
| 207 | 3300046689 | Ga0495613_0000860 | Ga0495613_0000860_11743_12855 | 368 |
| 208 | 3300046809 | Ga0495600_0003398 | Ga0495600_0003398_6930_8045 | 368 |
| 209 | 3300047317 | Ga0495604_0000122 | Ga0495604_0000122_13124_14233 | 368 |
| 210 | 3300047317 | Ga0495604_0041260 | Ga0495604_0041260_1488_2603 | 368 |
| 211 | 3300047673 | Ga0495593_0007679 | Ga0495593_0007679_2538_3668 | 368 |
| 212 | 3300048088 | Ga0495602_0000166 | Ga0495602_0000166_11650_12765 | 368 |
| 213 | 3300048911 | Ga0496108_0000355 | Ga0496108_0000355_10655_11785 | 368 |
| 214 | 3300048911 | Ga0496108_0034583 | Ga0496108_0034583_2833_3945 | 368 |
| 215 | 3300048912 | Ga0496109_0000400 | Ga0496109_0000400_27217_28329 | 368 |
| 216 | 3300048912 | Ga0496109_0000903 | Ga0496109_0000903_10535_11665 | 368 |
| 217 | 3300048913 | Ga0496110_0000011 | Ga0496110_0000011_10472_11584 | 368 |
| 218 | 3300048913 | Ga0496110_0032974 | Ga0496110_0032974_1283_2395 | 368 |
| 219 | 3300048914 | Ga0496111_0000793 | Ga0496111_0000793_4499_5611 | 368 |
| 220 | 3300048915 | Ga0496112_0000980 | Ga0496112_0000980_9131_10249 | 368 |
| 221 | 3300048916 | Ga0496113_0000283 | Ga0496113_0000283_12299_13417 | 368 |
| 222 | 3300053077 | Ga0495601_0000034 | Ga0495601_0000034_71489_72598 | 368 |
| 223 | 3300053085 | Ga0495619_0000277 | Ga0495619_0000277_12413_13525 | 368 |
| 224 | 3300053085 | Ga0495619_0000602 | Ga0495619_0000602_12490_13596 | 368 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u1h-assembly1.cif.gz_A | crystal structure of ipmdh from the last common ancestor of bacillus | 0.902 | 6 | 367 |
| 5j33-assembly3.cif.gz_F | isopropylmalate dehydrogenase in complex with nad+ | 0.8945 | 3 | 367 |
| 4wuo-assembly1.cif.gz_B | structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh | 0.8915 | 6 | 367 |
| 3u1h-assembly1.cif.gz_B | crystal structure of ipmdh from the last common ancestor of bacillus | 0.8893 | 5 | 367 |
| 5j33-assembly3.cif.gz_F | isopropylmalate dehydrogenase in complex with nad+ | 0.885 | 3 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.902 | 6 | 367 | 3.40.718.10 |
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8982 | 4 | 367 | 3.40.718.10 |
| af_A1ZAD2_42_373_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8827 | 1 | 366 | 3.40.718.10 |
| 1w0dB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8749 | 4 | 368 | 3.40.718.10 |
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8729 | 6 | 367 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A5LCE6-F1-model_v4 | deleted | 0.9379 | 54 | 364 |
|
| AF-A0A7W0H339-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) | 0.9344 | 4 | 368 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-A0A7V9Q1W7-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.932 | 25 | 367 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-A0A7W0H339-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) | 0.9291 | 4 | 368 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-A0A2V7V2L8-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.9246 | 4 | 284 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar