F336837

General Info

Members Datasets Scaffolds Average Seq Length
224 166 224 364

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10054857|Ga0207698_100548572
Length 368
Sequence MSDAPRIVVLAGDGIGPEIVAAARQVLDALGEFSYDERLMGGCSIDEHGTALTDEVLDACKGADAVLLGAVGGPKWDTTNPDDPRPEQGLLGLRKGMGLYANLRPVRPSPALVGASPLREERIAGTDLLVVRELTGGIYFGDSGRDGDVAHDTCEYSVEEIDRIARTAFDAAQRRAASGRKPKVTSVDKANVLETSRLWREVVGNVAADYGDVELEHLLVDNAAMQLVSRPADFDVVLAENLFGDILSDEAAMLTGSLGMLPSASLGAEGAPGLFEPVHGSAPDIAGQGVANPLATFLSAAMMLRHGLGRGDDAARIEAAVDAVLERGLRTPDLAAGTVIEPPTSGEPMTQTAVGTQEMTAAVLEELG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 13.39
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002767 3300001977 Bacteria 2764
2 JGI24748J21848_1001538 3300002074 Bacteria 2561
3 JGI24034J26672_10000204 3300002239 Bacteria 7946
4 JGI24742J22300_10011402 3300002244 Bacteria 1475
5 Ga0070658_10032887 3300005327 Bacteria 4171
6 Ga0070683_100021686 3300005329 Bacteria 5735
7 Ga0070683_100066933 3300005329 Bacteria 3346
8 Ga0070677_10000468 3300005333 Bacteria 13840
9 Ga0070682_100001488 3300005337 Bacteria 13140
10 Ga0068868_100001000 3300005338 Bacteria 19303
11 Ga0070689_100064455 3300005340 Bacteria 2852
12 Ga0070691_10000362 3300005341 Bacteria 16367
13 Ga0070661_100000035 3300005344 Bacteria 111363
14 Ga0070675_100000377 3300005354 Bacteria 30146
15 Ga0070674_100000012 3300005356 Bacteria 130773
16 Ga0070673_100003827 3300005364 Bacteria 9441
17 Ga0070688_100000696 3300005365 Bacteria 16651
18 Ga0070688_100019656 3300005365 Bacteria 3916
19 Ga0070667_100128799 3300005367 Bacteria 2208
20 Ga0070714_100252572 3300005435 Bacteria 1631
21 Ga0070713_100000380 3300005436 Bacteria 28361
22 Ga0070678_100004874 3300005456 Bacteria 7669
23 Ga0070662_100000006 3300005457 Bacteria 169366
24 Ga0068867_100025896 3300005459 Bacteria 4208
25 Ga0070685_10000174 3300005466 Bacteria 42617
26 Ga0070685_10001054 3300005466 Bacteria 14805
27 Ga0070684_100025302 3300005535 Bacteria 4988
28 Ga0068853_100053698 3300005539 Bacteria 3470
29 Ga0070672_100000006 3300005543 Bacteria 117060
30 Ga0070686_100069032 3300005544 Bacteria 2307
31 Ga0070665_100021450 3300005548 Bacteria 6496
32 Ga0070665_100162424 3300005548 Bacteria 2236
33 Ga0068854_100001557 3300005578 Bacteria 13919
34 Ga0068856_100001768 3300005614 Bacteria 22576
35 Ga0068852_100001531 3300005616 Bacteria 15680
36 Ga0068866_10000004 3300005718 Bacteria 202810
37 Ga0068851_10000945 3300005834 Bacteria 12571
38 Ga0068851_10014455 3300005834 Bacteria 3748
39 Ga0068863_100005037 3300005841 Bacteria 13029
40 Ga0068863_100013867 3300005841 Bacteria 7770
41 Ga0068860_100006216 3300005843 Bacteria 12009
42 Ga0070715_10000014 3300006163 Bacteria 154272
43 Ga0070712_100004960 3300006175 Bacteria 8231
44 Ga0075433_10000244 3300006852 Bacteria 31446
45 Ga0068865_100000293 3300006881 Bacteria 27538
46 Ga0105245_10000116 3300009098 Bacteria 77303
47 Ga0105245_10025332 3300009098 Bacteria 5217
48 Ga0105247_10001919 3300009101 Bacteria 14503
49 Ga0105243_10024929 3300009148 Bacteria 4566
50 Ga0105248_10001622 3300009177 Bacteria 24979
51 Ga0105249_10000070 3300009553 Bacteria 147277
52 Ga0157371_10006801 3300013102 Bacteria 9348
53 Ga0157369_10000078 3300013105 Bacteria 135173
54 Ga0157378_10140739 3300013297 Bacteria 2240
55 Ga0157372_10005056 3300013307 Bacteria 14012
56 Ga0157375_10052588 3300013308 Bacteria 4005
57 Ga0157380_10000445 3300014326 Bacteria 25326
58 Ga0157379_10070388 3300014968 Bacteria 3129
59 Ga0157379_10089273 3300014968 Bacteria 2765
60 Ga0206354_11518046 3300020081 Bacteria 1703
61 Ga0207656_10000514 3300025321 Bacteria 12807
62 Ga0207682_10000140 3300025893 Bacteria 32624
63 Ga0207642_10000005 3300025899 Bacteria 401934
64 Ga0207642_10045537 3300025899 Bacteria 1948
65 Ga0207710_10000243 3300025900 Bacteria 46286
66 Ga0207680_10020160 3300025903 Bacteria 3582
67 Ga0207685_10000025 3300025905 Bacteria 110358
68 Ga0207705_10057982 3300025909 Bacteria 2794
69 Ga0207693_10006084 3300025915 Bacteria 9995
70 Ga0207649_10000028 3300025920 Bacteria 161482
71 Ga0207650_10012491 3300025925 Bacteria 5862
72 Ga0207659_10000246 3300025926 Bacteria 32971
73 Ga0207687_10000031 3300025927 Bacteria 150246
74 Ga0207687_10002310 3300025927 Bacteria 12979
75 Ga0207700_10000033 3300025928 Bacteria 123113
76 Ga0207664_10036755 3300025929 Bacteria 3786
77 Ga0207706_10000017 3300025933 Bacteria 169589
78 Ga0207686_10000199 3300025934 Bacteria 46373
79 Ga0207686_10003593 3300025934 Bacteria 8311
80 Ga0207709_10005829 3300025935 Bacteria 6962
81 Ga0207709_10021776 3300025935 Bacteria 3630
82 Ga0207670_10047538 3300025936 Bacteria 2859
83 Ga0207670_10152169 3300025936 Bacteria 1718
84 Ga0207669_10000017 3300025937 Bacteria 119878
85 Ga0207669_10000131 3300025937 Bacteria 37319
86 Ga0207704_10000103 3300025938 Bacteria 47628
87 Ga0207665_10048958 3300025939 Bacteria 2839
88 Ga0207691_10000025 3300025940 Bacteria 129424
89 Ga0207711_10000006 3300025941 Bacteria 792692
90 Ga0207661_10000739 3300025944 Bacteria 21204
91 Ga0207661_10002534 3300025944 Bacteria 12567
92 Ga0207661_10024496 3300025944 Bacteria 4575
93 Ga0207651_10000406 3300025960 Bacteria 18224
94 Ga0207712_10000019 3300025961 Bacteria 317060
95 Ga0207640_10000686 3300025981 Bacteria 19687
96 Ga0207658_10028584 3300025986 Bacteria 3927
97 Ga0207658_10368022 3300025986 Bacteria 1256
98 Ga0207677_10001183 3300026023 Bacteria 14189
99 Ga0207639_10034583 3300026041 Bacteria 3736
100 Ga0207678_10337525 3300026067 Bacteria 1298
101 Ga0207702_10000242 3300026078 Bacteria 63808
102 Ga0207702_10005503 3300026078 Bacteria 11081
103 Ga0207641_10000077 3300026088 Bacteria 144978
104 Ga0207641_10002316 3300026088 Bacteria 17682
105 Ga0207648_10014120 3300026089 Bacteria 7385
106 Ga0207683_10007872 3300026121 Bacteria 9117
107 Ga0207698_10000414 3300026142 Bacteria 24644
108 Ga0207698_10054857 3300026142 Bacteria 3068
109 Ga0268266_10001578 3300028379 Bacteria 26646
110 Ga0268266_10001702 3300028379 Bacteria 25200
111 Ga0268266_10200621 3300028379 Bacteria 1825
112 Ga0268264_10025533 3300028381 Bacteria 4828
113 Ga0265326_10000084 3300028558 Bacteria 50129
114 Ga0265319_1000110 3300028563 Bacteria 63277
115 Ga0265322_10000198 3300028654 Bacteria 26588
116 Ga0265338_10000578 3300028800 Bacteria 64450
117 Ga0265324_10001108 3300029957 Bacteria 16206
118 Ga0265328_10002315 3300031239 Bacteria 8588
119 Ga0265320_10000035 3300031240 Bacteria 137855
120 Ga0265325_10007335 3300031241 Bacteria 6609
121 Ga0265331_10005939 3300031250 Bacteria 7292
122 Ga0265331_10044957 3300031250 Bacteria 2133
123 Ga0265327_10000015 3300031251 Bacteria 496677
124 Ga0265314_10000690 3300031711 Bacteria 40955
125 Ga0316576_10019098 3300031727 Bacteria 4692
126 Ga0307415_100023360 3300032126 Bacteria 3836
127 Ga0316574_0001485 3300035398 Bacteria 11177
128 Ga0316574_0003978 3300035398 Bacteria 7696
129 Ga0466963_0000022 3300044694 Bacteria 52600
130 Ga0466963_0139031 3300044694 Bacteria 1681
131 Ga0466967_0000771 3300045976 Bacteria 16619
132 Ga0466967_0086015 3300045976 Bacteria 2848
133 Ga0495592_0000912 3300046454 Bacteria 20489
134 Ga0495603_0000471 3300046455 Bacteria 22167
135 Ga0495629_0000999 3300046459 Bacteria 22693
136 Ga0495629_0006051 3300046459 Bacteria 8991
137 Ga0495641_0006866 3300046461 Bacteria 7275
138 Ga0495651_0108496 3300046462 Bacteria 2056
139 Ga0495582_0000001 3300046473 Bacteria 252434
140 Ga0495662_0002177 3300046476 Bacteria 9850
141 Ga0495594_0000011 3300046499 Bacteria 118444
142 Ga0495606_0003906 3300046507 Bacteria 15347
143 Ga0495608_0000036 3300046511 Bacteria 129609
144 Ga0495608_0020036 3300046511 Bacteria 4598
145 Ga0495608_0143207 3300046511 Bacteria 1525
146 Ga0495628_0007522 3300046516 Bacteria 9426
147 Ga0495630_0001632 3300046517 Bacteria 15592
148 Ga0495652_0000023 3300046529 Bacteria 168049
149 Ga0495652_0003640 3300046529 Bacteria 15091
150 Ga0495587_0000703 3300046536 Bacteria 22378
151 Ga0495645_0001215 3300046543 Bacteria 17592
152 Ga0495645_0011464 3300046543 Bacteria 6239
153 Ga0495622_0000021 3300046557 Bacteria 162267
154 Ga0495667_0000034 3300046559 Bacteria 141464
155 Ga0495634_0000028 3300046642 Bacteria 114075
156 Ga0495625_0000506 3300046660 Bacteria 57832
157 Ga0495588_0000393 3300046674 Bacteria 24845
158 Ga0495657_0000001 3300046675 Bacteria 445641
159 Ga0495657_0006478 3300046675 Bacteria 9155
160 Ga0495647_0000043 3300046681 Bacteria 36874
161 Ga0495647_0000502 3300046681 Bacteria 11377
162 Ga0495647_0005348 3300046681 Bacteria 4205
163 Ga0495647_0028160 3300046681 Bacteria 2070
164 Ga0495658_0000193 3300046683 Bacteria 35142
165 Ga0495658_0009046 3300046683 Bacteria 4952
166 Ga0495613_0000860 3300046689 Bacteria 23282
167 Ga0495624_0002138 3300046690 Bacteria 15054
168 Ga0495624_0139701 3300046690 Bacteria 1484
169 Ga0495600_0003398 3300046809 Bacteria 9370
170 Ga0495604_0000122 3300047317 Bacteria 65938
171 Ga0495604_0000267 3300047317 Bacteria 46398
172 Ga0495604_0041260 3300047317 Bacteria 3620
173 Ga0495674_0000059 3300047319 Bacteria 73353
174 Ga0495676_0001626 3300047321 Bacteria 19533
175 Ga0495676_0051729 3300047321 Bacteria 3284
176 Ga0495680_0001649 3300047322 Bacteria 23717
177 Ga0495675_0000515 3300047444 Bacteria 25086
178 Ga0495593_0007679 3300047673 Bacteria 6294
179 Ga0495602_0000166 3300048088 Bacteria 61220
180 Ga0495602_0007040 3300048088 Bacteria 11806
181 Ga0496100_0000005 3300048903 Bacteria 312112
182 Ga0496101_0000493 3300048904 Bacteria 24897
183 Ga0496102_0000081 3300048905 Bacteria 139266
184 Ga0496103_0000031 3300048906 Bacteria 204016
185 Ga0496103_0101231 3300048906 Bacteria 1824
186 Ga0496104_0000024 3300048907 Bacteria 229913
187 Ga0496104_0000077 3300048907 Bacteria 100848
188 Ga0496105_0000004 3300048908 Bacteria 475798
189 Ga0496105_0000013 3300048908 Bacteria 229894
190 Ga0496105_0056104 3300048908 Bacteria 3252
191 Ga0496106_0000193 3300048909 Bacteria 42951
192 Ga0496107_0000094 3300048910 Bacteria 42797
193 Ga0496108_0000006 3300048911 Bacteria 469473
194 Ga0496108_0000355 3300048911 Bacteria 38685
195 Ga0496108_0003065 3300048911 Bacteria 13430
196 Ga0496108_0012185 3300048911 Bacteria 6992
197 Ga0496108_0034583 3300048911 Bacteria 4199
198 Ga0496109_0000004 3300048912 Bacteria 404818
199 Ga0496109_0000400 3300048912 Bacteria 39194
200 Ga0496109_0000903 3300048912 Bacteria 24701
201 Ga0496109_0001433 3300048912 Bacteria 19779
202 Ga0496110_0000011 3300048913 Bacteria 97293
203 Ga0496110_0032974 3300048913 Bacteria 4478
204 Ga0496111_0000793 3300048914 Bacteria 16908
205 Ga0496111_0106902 3300048914 Bacteria 2059
206 Ga0496112_0000980 3300048915 Bacteria 20831
207 Ga0496113_0000283 3300048916 Bacteria 23978
208 Ga0496114_0043175 3300048917 Bacteria 3739
209 Ga0496115_0000010 3300048918 Bacteria 227112
210 Ga0496115_0001569 3300048918 Bacteria 16428
211 Ga0501040_0106808 3300049576 Bacteria 1956
212 Ga0501071_0264568 3300049587 Bacteria 1299
213 Ga0501076_0006764 3300049592 Bacteria 8322
214 Ga0501083_0092497 3300049744 Bacteria 1996
215 Ga0495601_0000034 3300053077 Bacteria 93719
216 Ga0495612_0000489 3300053078 Bacteria 15785
217 Ga0495655_0000023 3300053083 Bacteria 39507
218 Ga0495595_0000002 3300053084 Bacteria 445641
219 Ga0495619_0000008 3300053085 Bacteria 305999
220 Ga0495619_0000277 3300053085 Bacteria 36725
221 Ga0495619_0000602 3300053085 Bacteria 23838
222 Ga0495619_0001511 3300053085 Bacteria 15342
223 Ga0500566_0002030 3300053094 Bacteria 11955
224 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0106808 Ga0501040_0106808_766_1719 314
2 3300046536 Ga0495587_0000703 Ga0495587_0000703_12969_14003 329
3 3300006852 Ga0075433_10000244 Ga0075433_1000024425 335
4 3300005841 Ga0068863_100005037 Ga0068863_1000050373 336
5 3300026088 Ga0207641_10000077 Ga0207641_10000077115 336
6 3300046543 Ga0495645_0001215 Ga0495645_0001215_8721_9794 337
7 3300006163 Ga0070715_10000014 Ga0070715_10000014157 338
8 3300025905 Ga0207685_10000025 Ga0207685_1000002510 338
9 3300025936 Ga0207670_10152169 Ga0207670_101521692 338
10 3300046454 Ga0495592_0000912 Ga0495592_0000912_6540_7616 338
11 3300049587 Ga0501071_0264568 Ga0501071_0264568_206_1231 338
12 3300046455 Ga0495603_0000471 Ga0495603_0000471_1317_2366 347
13 3300046681 Ga0495647_0028160 Ga0495647_0028160_76_1125 347
14 3300048911 Ga0496108_0000006 Ga0496108_0000006_216986_218035 347
15 3300048912 Ga0496109_0000004 Ga0496109_0000004_389729_390778 347
16 3300005341 Ga0070691_10000362 Ga0070691_1000036211 352
17 3300025939 Ga0207665_10048958 Ga0207665_100489582 352
18 3300048907 Ga0496104_0000024 Ga0496104_0000024_10878_11945 353
19 3300048908 Ga0496105_0000013 Ga0496105_0000013_217969_219036 353
20 3300005841 Ga0068863_100013867 Ga0068863_1000138673 354
21 3300026088 Ga0207641_10002316 Ga0207641_100023166 354
22 3300046511 Ga0495608_0143207 Ga0495608_0143207_326_1396 354
23 3300046642 Ga0495634_0000028 Ga0495634_0000028_103375_104439 354
24 3300053085 Ga0495619_0000008 Ga0495619_0000008_295044_296108 354
25 3300005333 Ga0070677_10000468 Ga0070677_1000046811 355
26 3300009553 Ga0105249_10000070 Ga0105249_1000007010 355
27 3300014968 Ga0157379_10070388 Ga0157379_100703883 355
28 3300025893 Ga0207682_10000140 Ga0207682_1000014020 355
29 3300025961 Ga0207712_10000019 Ga0207712_10000019301 355
30 3300044694 Ga0466963_0000022 Ga0466963_0000022_10654_11724 355
31 3300046681 Ga0495647_0000043 Ga0495647_0000043_25351_26424 355
32 3300046681 Ga0495647_0005348 Ga0495647_0005348_3104_4177 355
33 3300046690 Ga0495624_0139701 Ga0495624_0139701_280_1353 355
34 3300002074 JGI24748J21848_1001538 JGI24748J21848_10015383 356
35 3300002239 JGI24034J26672_10000204 JGI24034J26672_100002044 356
36 3300002244 JGI24742J22300_10011402 JGI24742J22300_100114021 356
37 3300005329 Ga0070683_100066933 Ga0070683_1000669332 356
38 3300005356 Ga0070674_100000012 Ga0070674_100000012118 356
39 3300005364 Ga0070673_100003827 Ga0070673_1000038274 356
40 3300005457 Ga0070662_100000006 Ga0070662_100000006160 356
41 3300005459 Ga0068867_100025896 Ga0068867_1000258961 356
42 3300005535 Ga0070684_100025302 Ga0070684_1000253022 356
43 3300005718 Ga0068866_10000004 Ga0068866_10000004197 356
44 3300005843 Ga0068860_100006216 Ga0068860_1000062163 356
45 3300014326 Ga0157380_10000445 Ga0157380_1000044510 356
46 3300025899 Ga0207642_10000005 Ga0207642_1000000510 356
47 3300025929 Ga0207664_10036755 Ga0207664_100367553 356
48 3300025933 Ga0207706_10000017 Ga0207706_10000017160 356
49 3300025935 Ga0207709_10021776 Ga0207709_100217763 356
50 3300025937 Ga0207669_10000017 Ga0207669_10000017103 356
51 3300025937 Ga0207669_10000131 Ga0207669_100001319 356
52 3300025944 Ga0207661_10024496 Ga0207661_100244963 356
53 3300025960 Ga0207651_10000406 Ga0207651_100004066 356
54 3300026067 Ga0207678_10337525 Ga0207678_103375251 356
55 3300026089 Ga0207648_10014120 Ga0207648_100141209 356
56 3300028381 Ga0268264_10025533 Ga0268264_100255333 356
57 3300046462 Ga0495651_0108496 Ga0495651_0108496_699_1775 356
58 3300046473 Ga0495582_0000001 Ga0495582_0000001_199513_200589 356
59 3300046511 Ga0495608_0020036 Ga0495608_0020036_3455_4531 356
60 3300046529 Ga0495652_0003640 Ga0495652_0003640_3274_4350 356
61 3300046543 Ga0495645_0011464 Ga0495645_0011464_2683_3759 356
62 3300046675 Ga0495657_0006478 Ga0495657_0006478_1162_2247 356
63 3300046683 Ga0495658_0000193 Ga0495658_0000193_24031_25107 356
64 3300047317 Ga0495604_0000267 Ga0495604_0000267_10500_11582 356
65 3300048908 Ga0496105_0056104 Ga0496105_0056104_1827_2903 356
66 3300048914 Ga0496111_0106902 Ga0496111_0106902_587_1672 356
67 3300053078 Ga0495612_0000489 Ga0495612_0000489_4787_5863 356
68 3300031727 Ga0316576_10019098 Ga0316576_100190983 358
69 3300035398 Ga0316574_0001485 Ga0316574_0001485_3297_4388 358
70 3300035398 Ga0316574_0003978 Ga0316574_0003978_6366_7466 358
71 3300046459 Ga0495629_0006051 Ga0495629_0006051_6648_7757 358
72 3300047321 Ga0495676_0051729 Ga0495676_0051729_350_1459 358
73 3300046529 Ga0495652_0000023 Ga0495652_0000023_152287_153378 359
74 3300048911 Ga0496108_0003065 Ga0496108_0003065_9736_10821 359
75 3300048912 Ga0496109_0001433 Ga0496109_0001433_9818_10903 359
76 3300009098 Ga0105245_10000116 Ga0105245_1000011666 360
77 3300046516 Ga0495628_0007522 Ga0495628_0007522_4463_5551 360
78 3300048088 Ga0495602_0007040 Ga0495602_0007040_4142_5230 360
79 3300045976 Ga0466967_0086015 Ga0466967_0086015_113_1219 366
80 3300049744 Ga0501083_0092497 Ga0501083_0092497_231_1340 366
81 3300005340 Ga0070689_100064455 Ga0070689_1000644553 367
82 3300005365 Ga0070688_100019656 Ga0070688_1000196563 367
83 3300005367 Ga0070667_100128799 Ga0070667_1001287992 367
84 3300005435 Ga0070714_100252572 Ga0070714_1002525722 367
85 3300005456 Ga0070678_100004874 Ga0070678_1000048745 367
86 3300005466 Ga0070685_10000174 Ga0070685_1000017429 367
87 3300009101 Ga0105247_10001919 Ga0105247_1000191910 367
88 3300013308 Ga0157375_10052588 Ga0157375_100525883 367
89 3300014968 Ga0157379_10089273 Ga0157379_100892731 367
90 3300025899 Ga0207642_10045537 Ga0207642_100455372 367
91 3300025900 Ga0207710_10000243 Ga0207710_1000024331 367
92 3300025903 Ga0207680_10020160 Ga0207680_100201604 367
93 3300025925 Ga0207650_10012491 Ga0207650_100124914 367
94 3300025934 Ga0207686_10000199 Ga0207686_1000019910 367
95 3300025934 Ga0207686_10003593 Ga0207686_100035934 367
96 3300025936 Ga0207670_10047538 Ga0207670_100475382 367
97 3300025986 Ga0207658_10028584 Ga0207658_100285843 367
98 3300025986 Ga0207658_10368022 Ga0207658_103680221 367
99 3300026078 Ga0207702_10005503 Ga0207702_100055036 367
100 3300026121 Ga0207683_10007872 Ga0207683_100078725 367
101 3300026142 Ga0207698_10054857 Ga0207698_100548572 367
102 3300028379 Ga0268266_10001702 Ga0268266_100017022 367
103 3300028379 Ga0268266_10200621 Ga0268266_102006212 367
104 3300028558 Ga0265326_10000084 Ga0265326_1000008410 367
105 3300028563 Ga0265319_1000110 Ga0265319_100011052 367
106 3300028654 Ga0265322_10000198 Ga0265322_1000019810 367
107 3300028800 Ga0265338_10000578 Ga0265338_1000057853 367
108 3300029957 Ga0265324_10001108 Ga0265324_100011088 367
109 3300031239 Ga0265328_10002315 Ga0265328_100023152 367
110 3300031240 Ga0265320_10000035 Ga0265320_10000035111 367
111 3300031241 Ga0265325_10007335 Ga0265325_100073355 367
112 3300031250 Ga0265331_10005939 Ga0265331_100059396 367
113 3300031250 Ga0265331_10044957 Ga0265331_100449572 367
114 3300031251 Ga0265327_10000015 Ga0265327_10000015387 367
115 3300031711 Ga0265314_10000690 Ga0265314_1000069028 367
116 3300044694 Ga0466963_0139031 Ga0466963_0139031_430_1533 367
117 3300045976 Ga0466967_0000771 Ga0466967_0000771_11343_12452 367
118 3300046461 Ga0495641_0006866 Ga0495641_0006866_1732_2841 367
119 3300046499 Ga0495594_0000011 Ga0495594_0000011_59226_60335 367
120 3300046511 Ga0495608_0000036 Ga0495608_0000036_117436_118545 367
121 3300046517 Ga0495630_0001632 Ga0495630_0001632_3949_5055 367
122 3300046557 Ga0495622_0000021 Ga0495622_0000021_129622_130731 367
123 3300046559 Ga0495667_0000034 Ga0495667_0000034_125897_127006 367
124 3300046660 Ga0495625_0000506 Ga0495625_0000506_41691_42800 367
125 3300046675 Ga0495657_0000001 Ga0495657_0000001_117436_118545 367
126 3300046681 Ga0495647_0000502 Ga0495647_0000502_5773_6879 367
127 3300046690 Ga0495624_0002138 Ga0495624_0002138_3519_4625 367
128 3300047319 Ga0495674_0000059 Ga0495674_0000059_13473_14582 367
129 3300047321 Ga0495676_0001626 Ga0495676_0001626_12931_14040 367
130 3300047322 Ga0495680_0001649 Ga0495680_0001649_11733_12842 367
131 3300047444 Ga0495675_0000515 Ga0495675_0000515_11088_12197 367
132 3300048903 Ga0496100_0000005 Ga0496100_0000005_10925_12034 367
133 3300048904 Ga0496101_0000493 Ga0496101_0000493_12923_14032 367
134 3300048905 Ga0496102_0000081 Ga0496102_0000081_125704_126813 367
135 3300048906 Ga0496103_0000031 Ga0496103_0000031_11531_12640 367
136 3300048906 Ga0496103_0101231 Ga0496103_0101231_547_1659 367
137 3300048907 Ga0496104_0000077 Ga0496104_0000077_14010_15119 367
138 3300048908 Ga0496105_0000004 Ga0496105_0000004_85730_86839 367
139 3300048909 Ga0496106_0000193 Ga0496106_0000193_10875_11984 367
140 3300048910 Ga0496107_0000094 Ga0496107_0000094_10744_11853 367
141 3300048911 Ga0496108_0012185 Ga0496108_0012185_5863_6966 367
142 3300048917 Ga0496114_0043175 Ga0496114_0043175_513_1622 367
143 3300048918 Ga0496115_0000010 Ga0496115_0000010_215183_216292 367
144 3300048918 Ga0496115_0001569 Ga0496115_0001569_63_1172 367
145 3300049592 Ga0501076_0006764 Ga0501076_0006764_5327_6439 367
146 3300053083 Ga0495655_0000023 Ga0495655_0000023_25471_26580 367
147 3300053084 Ga0495595_0000002 Ga0495595_0000002_327097_328206 367
148 3300053085 Ga0495619_0001511 Ga0495619_0001511_3667_4776 367
149 3300053094 Ga0500566_0002030 Ga0500566_0002030_2581_3690 367
150 3300053129 Ga0500628_000001 Ga0500628_000001_415887_416996 367
151 3300001977 JGI24746J21847_1002767 JGI24746J21847_10027672 368
152 3300005327 Ga0070658_10032887 Ga0070658_100328874 368
153 3300005329 Ga0070683_100021686 Ga0070683_1000216863 368
154 3300005337 Ga0070682_100001488 Ga0070682_10000148811 368
155 3300005338 Ga0068868_100001000 Ga0068868_1000010008 368
156 3300005344 Ga0070661_100000035 Ga0070661_10000003511 368
157 3300005354 Ga0070675_100000377 Ga0070675_10000037720 368
158 3300005365 Ga0070688_100000696 Ga0070688_1000006965 368
159 3300005436 Ga0070713_100000380 Ga0070713_10000038020 368
160 3300005466 Ga0070685_10001054 Ga0070685_1000105410 368
161 3300005539 Ga0068853_100053698 Ga0068853_1000536983 368
162 3300005543 Ga0070672_100000006 Ga0070672_100000006115 368
163 3300005544 Ga0070686_100069032 Ga0070686_1000690322 368
164 3300005548 Ga0070665_100021450 Ga0070665_1000214505 368
165 3300005548 Ga0070665_100162424 Ga0070665_1001624242 368
166 3300005578 Ga0068854_100001557 Ga0068854_1000015574 368
167 3300005614 Ga0068856_100001768 Ga0068856_10000176811 368
168 3300005616 Ga0068852_100001531 Ga0068852_1000015316 368
169 3300005834 Ga0068851_10000945 Ga0068851_100009453 368
170 3300005834 Ga0068851_10014455 Ga0068851_100144554 368
171 3300006175 Ga0070712_100004960 Ga0070712_1000049602 368
172 3300006881 Ga0068865_100000293 Ga0068865_10000029321 368
173 3300009098 Ga0105245_10025332 Ga0105245_100253323 368
174 3300009148 Ga0105243_10024929 Ga0105243_100249293 368
175 3300009177 Ga0105248_10001622 Ga0105248_1000162215 368
176 3300013102 Ga0157371_10006801 Ga0157371_100068018 368
177 3300013105 Ga0157369_10000078 Ga0157369_10000078128 368
178 3300013297 Ga0157378_10140739 Ga0157378_101407392 368
179 3300013307 Ga0157372_10005056 Ga0157372_100050566 368
180 3300020081 Ga0206354_11518046 Ga0206354_115180462 368
181 3300025321 Ga0207656_10000514 Ga0207656_1000051411 368
182 3300025909 Ga0207705_10057982 Ga0207705_100579823 368
183 3300025915 Ga0207693_10006084 Ga0207693_100060848 368
184 3300025920 Ga0207649_10000028 Ga0207649_10000028149 368
185 3300025926 Ga0207659_10000246 Ga0207659_1000024610 368
186 3300025927 Ga0207687_10000031 Ga0207687_10000031145 368
187 3300025927 Ga0207687_10002310 Ga0207687_100023108 368
188 3300025928 Ga0207700_10000033 Ga0207700_1000003310 368
189 3300025935 Ga0207709_10005829 Ga0207709_100058294 368
190 3300025938 Ga0207704_10000103 Ga0207704_100001039 368
191 3300025940 Ga0207691_10000025 Ga0207691_1000002510 368
192 3300025941 Ga0207711_10000006 Ga0207711_10000006384 368
193 3300025944 Ga0207661_10000739 Ga0207661_1000073910 368
194 3300025944 Ga0207661_10002534 Ga0207661_1000253410 368
195 3300025981 Ga0207640_10000686 Ga0207640_100006869 368
196 3300026023 Ga0207677_10001183 Ga0207677_100011834 368
197 3300026041 Ga0207639_10034583 Ga0207639_100345832 368
198 3300026078 Ga0207702_10000242 Ga0207702_1000024249 368
199 3300026142 Ga0207698_10000414 Ga0207698_1000041411 368
200 3300028379 Ga0268266_10001578 Ga0268266_1000157810 368
201 3300032126 Ga0307415_100023360 Ga0307415_1000233604 368
202 3300046459 Ga0495629_0000999 Ga0495629_0000999_11076_12182 368
203 3300046476 Ga0495662_0002177 Ga0495662_0002177_3507_4616 368
204 3300046507 Ga0495606_0003906 Ga0495606_0003906_10749_11855 368
205 3300046674 Ga0495588_0000393 Ga0495588_0000393_11290_12399 368
206 3300046683 Ga0495658_0009046 Ga0495658_0009046_3486_4595 368
207 3300046689 Ga0495613_0000860 Ga0495613_0000860_11743_12855 368
208 3300046809 Ga0495600_0003398 Ga0495600_0003398_6930_8045 368
209 3300047317 Ga0495604_0000122 Ga0495604_0000122_13124_14233 368
210 3300047317 Ga0495604_0041260 Ga0495604_0041260_1488_2603 368
211 3300047673 Ga0495593_0007679 Ga0495593_0007679_2538_3668 368
212 3300048088 Ga0495602_0000166 Ga0495602_0000166_11650_12765 368
213 3300048911 Ga0496108_0000355 Ga0496108_0000355_10655_11785 368
214 3300048911 Ga0496108_0034583 Ga0496108_0034583_2833_3945 368
215 3300048912 Ga0496109_0000400 Ga0496109_0000400_27217_28329 368
216 3300048912 Ga0496109_0000903 Ga0496109_0000903_10535_11665 368
217 3300048913 Ga0496110_0000011 Ga0496110_0000011_10472_11584 368
218 3300048913 Ga0496110_0032974 Ga0496110_0032974_1283_2395 368
219 3300048914 Ga0496111_0000793 Ga0496111_0000793_4499_5611 368
220 3300048915 Ga0496112_0000980 Ga0496112_0000980_9131_10249 368
221 3300048916 Ga0496113_0000283 Ga0496113_0000283_12299_13417 368
222 3300053077 Ga0495601_0000034 Ga0495601_0000034_71489_72598 368
223 3300053085 Ga0495619_0000277 Ga0495619_0000277_12413_13525 368
224 3300053085 Ga0495619_0000602 Ga0495619_0000602_12490_13596 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

6

363

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u1h-assembly1.cif.gz_A crystal structure of ipmdh from the last common ancestor of bacillus 0.902 6 367
5j33-assembly3.cif.gz_F isopropylmalate dehydrogenase in complex with nad+ 0.8945 3 367
4wuo-assembly1.cif.gz_B structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh 0.8915 6 367
3u1h-assembly1.cif.gz_B crystal structure of ipmdh from the last common ancestor of bacillus 0.8893 5 367
5j33-assembly3.cif.gz_F isopropylmalate dehydrogenase in complex with nad+ 0.885 3 367
ID Description Score Start End Superfamily
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.902 6 367 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8982 4 367 3.40.718.10
af_A1ZAD2_42_373_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8827 1 366 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8749 4 368 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8729 6 367 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A6A5LCE6-F1-model_v4 deleted 0.9379 54 364
AF-A0A7W0H339-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) 0.9344 4 368 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A7V9Q1W7-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.932 25 367 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A7W0H339-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) 0.9291 4 368 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A2V7V2L8-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9246 4 284 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287

Feature Viewer

pLDDT pTM Quality
80.68 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map