F335338

General Info

Members Datasets Scaffolds Average Seq Length
223 156 446 185

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100127074|Ga0070698_1001270743
Length 203
Sequence MTAGAPRRRGRLADLSAKARSATAEALARRRVALGFVCGAAALGLAQPTLQSIVAGMSVAAVGEALRVWAAGHLNKAREVTSSGPYRWLPHPLYAGSSIMGVGLAIACANVVVTALIAIYLIVTLTAAIRNEEAFLRRAFGERYDRYRSGDAEIGSQSGSRRRFTVAQAIANREHRAIAGLLVAMLLLVLKATYNGLFWRGGG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
85 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
86 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
87 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
88 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
89 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
100 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.04
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100127074 3300005471 Bacteria 2507
2 Ga0070683_100225547 3300005329 Bacteria 1781
3 Ga0070690_100239210 3300005330 Bacteria 1280
4 Ga0070666_10467960 3300005335 Bacteria 912
5 Ga0070691_10307690 3300005341 Bacteria 868
6 Ga0070687_100088226 3300005343 Bacteria 1710
7 Ga0070675_100000453 3300005354 Bacteria 28021
8 Ga0070671_100451351 3300005355 Unclassified 1103
9 Ga0070673_100010867 3300005364 Bacteria 6187
10 Ga0070673_101196567 3300005364 Bacteria 712
11 Ga0070688_100092498 3300005365 Bacteria 1978
12 Ga0070659_100018754 3300005366 Bacteria 5222
13 Ga0070659_100156312 3300005366 Bacteria 1862
14 Ga0070709_10015251 3300005434 Bacteria 4367
15 Ga0070701_10269902 3300005438 Bacteria 1035
16 Ga0070708_100367146 3300005445 Bacteria 1357
17 Ga0070708_100598286 3300005445 Bacteria 1040
18 Ga0070662_100581571 3300005457 Bacteria 941
19 Ga0070681_10202349 3300005458 Bacteria 1904
20 Ga0070681_10763300 3300005458 Bacteria 884
21 Ga0068867_101042950 3300005459 Bacteria 744
22 Ga0070685_10370804 3300005466 Bacteria 984
23 Ga0070707_100071378 3300005468 Bacteria 3346
24 Ga0070707_100139675 3300005468 Bacteria 2358
25 Ga0070707_100860876 3300005468 Bacteria 871
26 Ga0070698_100785827 3300005471 Bacteria 896
27 Ga0070698_100833605 3300005471 Bacteria 867
28 Ga0070698_100962892 3300005471 Unclassified 800
29 Ga0070699_100004292 3300005518 Bacteria 12598
30 Ga0070699_100031633 3300005518 Bacteria 4569
31 Ga0070699_100126228 3300005518 Bacteria 2253
32 Ga0070679_100069961 3300005530 Bacteria 3501
33 Ga0070697_100703687 3300005536 Bacteria 892
34 Ga0070697_101226378 3300005536 Bacteria 669
35 Ga0068853_100273874 3300005539 Bacteria 1555
36 Ga0070686_100038903 3300005544 Bacteria 2960
37 Ga0070686_100112945 3300005544 Bacteria 1854
38 Ga0070695_100001193 3300005545 Bacteria 14296
39 Ga0070695_100242713 3300005545 Bacteria 1307
40 Ga0070696_100209422 3300005546 Bacteria 1459
41 Ga0070696_100691438 3300005546 Bacteria 831
42 Ga0070693_100154117 3300005547 Bacteria 1458
43 Ga0068855_100569877 3300005563 Bacteria 1224
44 Ga0068855_100855016 3300005563 Bacteria 964
45 Ga0068855_101004042 3300005563 Bacteria 877
46 Ga0070664_100266734 3300005564 Bacteria 1541
47 Ga0068857_100404988 3300005577 Bacteria 1270
48 Ga0068854_100001865 3300005578 Bacteria 12844
49 Ga0068859_100325249 3300005617 Bacteria 1631
50 Ga0068859_100774670 3300005617 Bacteria 1048
51 Ga0068861_101378602 3300005719 Bacteria 688
52 Ga0068863_101073852 3300005841 Unclassified 809
53 Ga0068862_100929347 3300005844 Bacteria 857
54 Ga0081539_10002859 3300005985 Bacteria 22960
55 Ga0081539_10189110 3300005985 Bacteria 960
56 Ga0070716_100122792 3300006173 Bacteria 1629
57 Ga0075428_100115394 3300006844 Bacteria 2925
58 Ga0075433_10100969 3300006852 Bacteria 2555
59 Ga0075433_10225418 3300006852 Bacteria 1665
60 Ga0075433_10261297 3300006852 Bacteria 1535
61 Ga0075433_10390225 3300006852 Bacteria 1229
62 Ga0075433_10441160 3300006852 Bacteria 1148
63 Ga0075434_100006572 3300006871 Bacteria 10663
64 Ga0075434_100040659 3300006871 Bacteria 4605
65 Ga0075434_100110458 3300006871 Bacteria 2760
66 Ga0075434_100414121 3300006871 Bacteria 1369
67 Ga0075434_100529690 3300006871 Bacteria 1198
68 Ga0075436_100003971 3300006914 Bacteria 10138
69 Ga0075436_100212205 3300006914 Bacteria 1372
70 Ga0097620_100325245 3300006931 Bacteria 1631
71 Ga0097620_100774711 3300006931 Bacteria 1048
72 Ga0075435_100001632 3300007076 Bacteria 14522
73 Ga0075435_100126241 3300007076 Bacteria 2138
74 Ga0111539_10012789 3300009094 Bacteria 10501
75 Ga0111539_10569719 3300009094 Bacteria 1319
76 Ga0114129_10011729 3300009147 Bacteria 12471
77 Ga0114129_10113580 3300009147 Bacteria 3735
78 Ga0114129_10535694 3300009147 Bacteria 1525
79 Ga0105243_10940495 3300009148 Bacteria 863
80 Ga0105242_10959682 3300009176 Bacteria 860
81 Ga0105248_10079371 3300009177 Bacteria 3689
82 Ga0105248_10216351 3300009177 Bacteria 2158
83 Ga0105249_10069263 3300009553 Bacteria 3256
84 Ga0105249_11536816 3300009553 Bacteria 738
85 Ga0157370_10218768 3300013104 Bacteria 1764
86 Ga0157369_10335304 3300013105 Bacteria 1571
87 Ga0157375_10413807 3300013308 Unclassified 1514
88 Ga0157380_10588451 3300014326 Bacteria 1099
89 Ga0157380_10934943 3300014326 Bacteria 896
90 Ga0157377_10155679 3300014745 Bacteria 1417
91 Ga0157376_11077486 3300014969 Bacteria 829
92 Ga0182007_10128724 3300015262 Bacteria 850
93 Ga0207680_10050416 3300025903 Bacteria 2483
94 Ga0207645_10230813 3300025907 Bacteria 1221
95 Ga0207654_10586547 3300025911 Bacteria 794
96 Ga0207707_10120626 3300025912 Bacteria 2292
97 Ga0207707_10257898 3300025912 Bacteria 1513
98 Ga0207649_10618411 3300025920 Bacteria 834
99 Ga0207646_10088025 3300025922 Bacteria 2779
100 Ga0207659_10000106 3300025926 Bacteria 49900
101 Ga0207644_10628208 3300025931 Bacteria 893
102 Ga0207690_10121269 3300025932 Bacteria 1900
103 Ga0207706_10355275 3300025933 Bacteria 1274
104 Ga0207706_10404323 3300025933 Bacteria 1184
105 Ga0207686_10248802 3300025934 Bacteria 1298
106 Ga0207709_10537806 3300025935 Unclassified 917
107 Ga0207670_10444009 3300025936 Bacteria 1045
108 Ga0207670_10492578 3300025936 Bacteria 994
109 Ga0207669_10327664 3300025937 Bacteria 1175
110 Ga0207665_10176967 3300025939 Bacteria 1543
111 Ga0207711_10108427 3300025941 Bacteria 2467
112 Ga0207711_10208346 3300025941 Unclassified 1786
113 Ga0207711_10214206 3300025941 Bacteria 1760
114 Ga0207679_10074517 3300025945 Bacteria 2572
115 Ga0207667_10746335 3300025949 Bacteria 978
116 Ga0207651_10012491 3300025960 Bacteria 4810
117 Ga0207651_10553404 3300025960 Bacteria 1001
118 Ga0207640_10052336 3300025981 Bacteria 2659
119 Ga0207641_10283284 3300026088 Bacteria 1560
120 Ga0207674_10164962 3300026116 Bacteria 2169
121 Ga0207428_10028489 3300027907 Bacteria 4640
122 Ga0207428_10314255 3300027907 Bacteria 1158
123 Ga0268264_10402179 3300028381 Bacteria 1316
124 Ga0307409_100435176 3300031995 Bacteria 1262
125 Ga0373930_0028576 3300034816 Bacteria 1135
126 Ga0373948_0006093 3300034817 Bacteria 1980
127 Ga0373950_0001046 3300034818 Bacteria 3530
128 Ga0373958_0000916 3300034819 Bacteria 3813
129 Ga0373959_0009759 3300034820 Bacteria 1664
130 Ga0373938_0000977 3300034957 Bacteria 4589
131 Ga0373928_0005461 3300035084 Bacteria 2430
132 Ga0373929_0000737 3300035085 Bacteria 6334
133 Ga0373940_0009319 3300035088 Bacteria 2280
134 Ga0373949_0007736 3300035090 Bacteria 2354
135 Ga0373952_0005292 3300035092 Bacteria 2354
136 Ga0373932_0010608 3300035112 Bacteria 2233
137 Ga0373939_0002638 3300035114 Bacteria 4212
138 Ga0373941_0002304 3300035115 Bacteria 4183
139 Ga0373960_0005691 3300035121 Bacteria 2895
140 Ga0373943_0027637 3300035170 Bacteria 2667
141 Ga0373946_0170292 3300035171 Bacteria 1027
142 Ga0373942_0000347 3300035207 Bacteria 12673
143 Ga0373961_0001167 3300035241 Bacteria 8204
144 Ga0373962_0000775 3300035242 Bacteria 7294
145 Ga0373931_0076958 3300035691 Bacteria 1833
146 Ga0373937_0133142 3300036401 Bacteria 2323
147 Ga0373937_0553827 3300036401 Bacteria 1092
148 Ga0373925_0506343 3300037068 Bacteria 991
149 Ga0466963_0443180 3300044694 Bacteria 916
150 Ga0451576_0009194 3300045051 Bacteria 11481
151 Ga0451576_1224025 3300045051 Bacteria 784
152 Ga0495592_0533215 3300046454 Bacteria 724
153 Ga0495651_0463783 3300046462 Bacteria 817
154 Ga0495639_0189142 3300046475 Bacteria 1005
155 Ga0495628_0763408 3300046516 Bacteria 679
156 Ga0495640_0137588 3300046533 Bacteria 1576
157 Ga0495587_0382394 3300046536 Bacteria 783
158 Ga0495647_0296370 3300046681 Bacteria 728
159 Ga0495658_0085946 3300046683 Bacteria 1855
160 Ga0495613_0482000 3300046689 Bacteria 837
161 Ga0495604_0905379 3300047317 Unclassified 551
162 Ga0495684_0620466 3300047471 Bacteria 727
163 Ga0496101_0401057 3300048904 Bacteria 1080
164 Ga0496102_0029225 3300048905 Bacteria 4931
165 Ga0496104_0096839 3300048907 Bacteria 2823
166 Ga0496107_0413239 3300048910 Bacteria 1003
167 Ga0496107_0898804 3300048910 Bacteria 645
168 Ga0496108_0187317 3300048911 Bacteria 1793
169 Ga0496110_1708070 3300048913 Bacteria 540
170 Ga0496112_0086601 3300048915 Bacteria 3099
171 Ga0496112_0133946 3300048915 Bacteria 2448
172 Ga0501034_0070631 3300049571 Bacteria 3503
173 Ga0501034_0385539 3300049571 Unclassified 1326
174 Ga0501036_0616154 3300049572 Bacteria 900
175 Ga0501038_0373661 3300049574 Bacteria 1107
176 Ga0501039_0097008 3300049575 Bacteria 2299
177 Ga0501039_1027790 3300049575 Bacteria 640
178 Ga0501040_0085574 3300049576 Bacteria 2188
179 Ga0501041_0027235 3300049577 Bacteria 3444
180 Ga0501042_0003747 3300049578 Bacteria 9608
181 Ga0501046_0075724 3300049580 Bacteria 2608
182 Ga0501047_0225004 3300049581 Bacteria 1731
183 Ga0501048_0604620 3300049582 Bacteria 787
184 Ga0501071_0315225 3300049587 Bacteria 1187
185 Ga0501072_0008466 3300049588 Bacteria 7805
186 Ga0501074_0693375 3300049590 Bacteria 719
187 Ga0501075_0031788 3300049591 Bacteria 3920
188 Ga0501076_0237788 3300049592 Bacteria 1489
189 Ga0501077_0216307 3300049593 Bacteria 1218
190 Ga0501077_0419383 3300049593 Bacteria 856
191 Ga0501079_0024176 3300049741 Bacteria 4662
192 Ga0501079_0460249 3300049741 Bacteria 999
193 Ga0501080_0830420 3300049742 Bacteria 809
194 Ga0501081_0002284 3300049743 Bacteria 12067
195 Ga0501083_0086820 3300049744 Bacteria 2069
196 Ga0501044_0003961 3300049823 Bacteria 16585
197 Ga0501045_0069085 3300049824 Bacteria 2596
198 nmdc:mga05p37_113279_c1 3300050507 Bacteria 3335
199 nmdc:mga05p37_31753_c1 3300050507 Bacteria 6454
200 nmdc:mga08y16_300445_c1 3300050511 Bacteria 1655
201 nmdc:mga08y16_7427_c1 3300050511 Bacteria 11476
202 nmdc:mga0n895_109877_c1 3300050512 Bacteria 2772
203 nmdc:mga0n895_435272_c1 3300050512 Bacteria 1325
204 nmdc:mga0n895_570705_c1 3300050512 Bacteria 1136
205 nmdc:mga0n895_72366_c1 3300050512 Bacteria 3420
206 nmdc:mga0n895_982442_c1 3300050512 Bacteria 826
207 nmdc:mga0rr50_3327_c1 3300050513 Bacteria 9232
208 nmdc:mga0rr50_49896_c1 3300050513 Bacteria 3100
209 nmdc:mga0rr50_55291_c1 3300050513 Bacteria 2961
210 nmdc:mga08x19_142987_c1 3300050514 Bacteria 1617
211 nmdc:mga08x19_318192_c1 3300050514 Bacteria 1082
212 nmdc:mga0a205_116248_c1 3300050515 Bacteria 2573
213 nmdc:mga0a205_189464_c1 3300050515 Bacteria 1949
214 nmdc:mga0a205_201930_c1 3300050515 Bacteria 1878
215 nmdc:mga0a205_231192_c1 3300050515 Bacteria 1732
216 nmdc:mga0a205_262728_c1 3300050515 Bacteria 1604
217 nmdc:mga0a205_36658_c1 3300050515 Bacteria 4713
218 Ga0495601_0107982 3300053077 Bacteria 1801
219 Ga0495601_0132351 3300053077 Unclassified 1625
220 Ga0501084_0012716 3300054114 Bacteria 6972
221 Ga0501084_1011104 3300054114 Unclassified 699
222 Ga0501082_0002403 3300060353 Bacteria 16422
223 Ga0530510_0032957 3300061734 Bacteria 3728
224 Ga0070698_100127074
225 Ga0070683_100225547
226 Ga0070690_100239210
227 Ga0070666_10467960
228 Ga0070691_10307690
229 Ga0070687_100088226
230 Ga0070675_100000453
231 Ga0070671_100451351
232 Ga0070673_100010867
233 Ga0070673_101196567
234 Ga0070688_100092498
235 Ga0070659_100018754
236 Ga0070659_100156312
237 Ga0070709_10015251
238 Ga0070701_10269902
239 Ga0070708_100367146
240 Ga0070708_100598286
241 Ga0070662_100581571
242 Ga0070681_10202349
243 Ga0070681_10763300
244 Ga0068867_101042950
245 Ga0070685_10370804
246 Ga0070707_100071378
247 Ga0070707_100139675
248 Ga0070707_100860876
249 Ga0070698_100785827
250 Ga0070698_100833605
251 Ga0070698_100962892
252 Ga0070699_100004292
253 Ga0070699_100031633
254 Ga0070699_100126228
255 Ga0070679_100069961
256 Ga0070697_100703687
257 Ga0070697_101226378
258 Ga0068853_100273874
259 Ga0070686_100038903
260 Ga0070686_100112945
261 Ga0070695_100001193
262 Ga0070695_100242713
263 Ga0070696_100209422
264 Ga0070696_100691438
265 Ga0070693_100154117
266 Ga0068855_100569877
267 Ga0068855_100855016
268 Ga0068855_101004042
269 Ga0070664_100266734
270 Ga0068857_100404988
271 Ga0068854_100001865
272 Ga0068859_100325249
273 Ga0068859_100774670
274 Ga0068861_101378602
275 Ga0068863_101073852
276 Ga0068862_100929347
277 Ga0081539_10002859
278 Ga0081539_10189110
279 Ga0070716_100122792
280 Ga0075428_100115394
281 Ga0075433_10100969
282 Ga0075433_10225418
283 Ga0075433_10261297
284 Ga0075433_10390225
285 Ga0075433_10441160
286 Ga0075434_100006572
287 Ga0075434_100040659
288 Ga0075434_100110458
289 Ga0075434_100414121
290 Ga0075434_100529690
291 Ga0075436_100003971
292 Ga0075436_100212205
293 Ga0097620_100325245
294 Ga0097620_100774711
295 Ga0075435_100001632
296 Ga0075435_100126241
297 Ga0111539_10012789
298 Ga0111539_10569719
299 Ga0114129_10011729
300 Ga0114129_10113580
301 Ga0114129_10535694
302 Ga0105243_10940495
303 Ga0105242_10959682
304 Ga0105248_10079371
305 Ga0105248_10216351
306 Ga0105249_10069263
307 Ga0105249_11536816
308 Ga0157370_10218768
309 Ga0157369_10335304
310 Ga0157375_10413807
311 Ga0157380_10588451
312 Ga0157380_10934943
313 Ga0157377_10155679
314 Ga0157376_11077486
315 Ga0182007_10128724
316 Ga0207680_10050416
317 Ga0207645_10230813
318 Ga0207654_10586547
319 Ga0207707_10120626
320 Ga0207707_10257898
321 Ga0207649_10618411
322 Ga0207646_10088025
323 Ga0207659_10000106
324 Ga0207644_10628208
325 Ga0207690_10121269
326 Ga0207706_10355275
327 Ga0207706_10404323
328 Ga0207686_10248802
329 Ga0207709_10537806
330 Ga0207670_10444009
331 Ga0207670_10492578
332 Ga0207669_10327664
333 Ga0207665_10176967
334 Ga0207711_10108427
335 Ga0207711_10208346
336 Ga0207711_10214206
337 Ga0207679_10074517
338 Ga0207667_10746335
339 Ga0207651_10012491
340 Ga0207651_10553404
341 Ga0207640_10052336
342 Ga0207641_10283284
343 Ga0207674_10164962
344 Ga0207428_10028489
345 Ga0207428_10314255
346 Ga0268264_10402179
347 Ga0307409_100435176
348 Ga0373930_0028576
349 Ga0373948_0006093
350 Ga0373950_0001046
351 Ga0373958_0000916
352 Ga0373959_0009759
353 Ga0373938_0000977
354 Ga0373928_0005461
355 Ga0373929_0000737
356 Ga0373940_0009319
357 Ga0373949_0007736
358 Ga0373952_0005292
359 Ga0373932_0010608
360 Ga0373939_0002638
361 Ga0373941_0002304
362 Ga0373960_0005691
363 Ga0373943_0027637
364 Ga0373946_0170292
365 Ga0373942_0000347
366 Ga0373961_0001167
367 Ga0373962_0000775
368 Ga0373931_0076958
369 Ga0373937_0133142
370 Ga0373937_0553827
371 Ga0373925_0506343
372 Ga0466963_0443180
373 Ga0451576_0009194
374 Ga0451576_1224025
375 Ga0495592_0533215
376 Ga0495651_0463783
377 Ga0495639_0189142
378 Ga0495628_0763408
379 Ga0495640_0137588
380 Ga0495587_0382394
381 Ga0495647_0296370
382 Ga0495658_0085946
383 Ga0495613_0482000
384 Ga0495604_0905379
385 Ga0495684_0620466
386 Ga0496101_0401057
387 Ga0496102_0029225
388 Ga0496104_0096839
389 Ga0496107_0413239
390 Ga0496107_0898804
391 Ga0496108_0187317
392 Ga0496110_1708070
393 Ga0496112_0086601
394 Ga0496112_0133946
395 Ga0501034_0070631
396 Ga0501034_0385539
397 Ga0501036_0616154
398 Ga0501038_0373661
399 Ga0501039_0097008
400 Ga0501039_1027790
401 Ga0501040_0085574
402 Ga0501041_0027235
403 Ga0501042_0003747
404 Ga0501046_0075724
405 Ga0501047_0225004
406 Ga0501048_0604620
407 Ga0501071_0315225
408 Ga0501072_0008466
409 Ga0501074_0693375
410 Ga0501075_0031788
411 Ga0501076_0237788
412 Ga0501077_0216307
413 Ga0501077_0419383
414 Ga0501079_0024176
415 Ga0501079_0460249
416 Ga0501080_0830420
417 Ga0501081_0002284
418 Ga0501083_0086820
419 Ga0501044_0003961
420 Ga0501045_0069085
421 nmdc:mga05p37_113279_c1
422 nmdc:mga05p37_31753_c1
423 nmdc:mga08y16_300445_c1
424 nmdc:mga08y16_7427_c1
425 nmdc:mga0n895_109877_c1
426 nmdc:mga0n895_435272_c1
427 nmdc:mga0n895_570705_c1
428 nmdc:mga0n895_72366_c1
429 nmdc:mga0n895_982442_c1
430 nmdc:mga0rr50_3327_c1
431 nmdc:mga0rr50_49896_c1
432 nmdc:mga0rr50_55291_c1
433 nmdc:mga08x19_142987_c1
434 nmdc:mga08x19_318192_c1
435 nmdc:mga0a205_116248_c1
436 nmdc:mga0a205_189464_c1
437 nmdc:mga0a205_201930_c1
438 nmdc:mga0a205_231192_c1
439 nmdc:mga0a205_262728_c1
440 nmdc:mga0a205_36658_c1
441 Ga0495601_0107982
442 Ga0495601_0132351
443 Ga0501084_0012716
444 Ga0501084_1011104
445 Ga0501082_0002403
446 Ga0530510_0032957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

40

143

0.92

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

50

138

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.7526 32 143
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.7391 32 143
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.6982 8 130
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.6697 31 133
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.6005 34 121
ID Description Score Start End Superfamily
af_A0A1D8PPJ9_44_257_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8772 32 130 1.20.120.1630
af_O60725_93_277_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8522 32 130 1.20.120.1630
af_Q4DVP0_51_248_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8223 25 130 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7985 26 130 1.20.120.1630
af_A0A1D8PPI7_47_265_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7948 30 130 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A3N5XXE1-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9582 2 174 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A3D0P296-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9494 1 99 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A3N5P554-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9447 2 174 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A1Q7KF03-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9403 6 132 GO:0012505
GO:0016020
AF-A0A7C0ZMX6-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.934 2 89

Map