F334984

General Info

Members Datasets Scaffolds Average Seq Length
222 132 444 182

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_136174_c1|nmdc:mga03n38_136174_c1_535_1176
Length 213
Sequence MITVIAPVQGGRVTRHRERHEPRVTAAWHRGGVPLPQLPGLESLPVAEHADLLAPSVAAVLASWPHTGDIAVVEIDPAIADTAAMNAAYDLPDTWGANCVVVAGKRDGEERVAACLVRADTRADVNNTVKRTLDVRKASFLPLDRAVEESSMEYGGITPVGLPATWRVLLDPRVLDIEVAVIGSGVRRSKLLVPGLLLGELPGAEVVEGLAGT

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
59 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
60 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
61 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
62 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 2643221615 Nocardioides sp. Root224 Isolate Unclassified
129 2643221641 Nocardioides sp. Root122 Isolate Unclassified
130 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
131 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
132 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0.45
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.08
Nodule 0
Rhizoplane 4.05
Rhizosphere 59.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_136174_c1 3300050490 Bacteria 1222
2 JGI24735J21928_10020448 3300002067 Bacteria 2027
3 JGI24735J21928_10067334 3300002067 Bacteria 1027
4 Ga0070658_10039099 3300005327 Bacteria 3826
5 Ga0070682_100247484 3300005337 Bacteria 1283
6 Ga0070682_100349458 3300005337 Bacteria 1102
7 Ga0070682_100577541 3300005337 Bacteria 884
8 Ga0070660_100294241 3300005339 Bacteria 1330
9 Ga0070691_10098190 3300005341 Bacteria 1452
10 Ga0070687_100486931 3300005343 Bacteria 828
11 Ga0070659_100312593 3300005366 Bacteria 1312
12 Ga0070714_100032778 3300005435 Bacteria 4339
13 Ga0070678_101324548 3300005456 Bacteria 671
14 Ga0070681_10128762 3300005458 Bacteria 2464
15 Ga0070685_10110831 3300005466 Bacteria 1690
16 Ga0070679_100007341 3300005530 Bacteria 10297
17 Ga0070684_100112850 3300005535 Bacteria 2439
18 Ga0070686_100262362 3300005544 Bacteria 1267
19 Ga0070693_100561074 3300005547 Bacteria 819
20 Ga0070702_101093691 3300005615 Bacteria 637
21 Ga0068852_100909739 3300005616 Bacteria 897
22 Ga0068861_100272187 3300005719 Bacteria 1455
23 Ga0068861_100427934 3300005719 Bacteria 1181
24 Ga0075365_10004069 3300006038 Bacteria 7676
25 Ga0075365_10021520 3300006038 Bacteria 4025
26 Ga0075365_10029587 3300006038 Bacteria 3503
27 Ga0075365_10034479 3300006038 Bacteria 3268
28 Ga0075365_10152393 3300006038 Bacteria 1608
29 Ga0075365_10203395 3300006038 Bacteria 1387
30 Ga0075365_10315783 3300006038 Bacteria 1100
31 Ga0075365_10517722 3300006038 Bacteria 843
32 Ga0075365_10573019 3300006038 Bacteria 798
33 Ga0075368_10112703 3300006042 Bacteria 1122
34 Ga0075363_100034573 3300006048 Bacteria 2639
35 Ga0075363_100069516 3300006048 Bacteria 1910
36 Ga0075363_100104195 3300006048 Bacteria 1572
37 Ga0075364_10056605 3300006051 Bacteria 2567
38 Ga0075364_10093072 3300006051 Bacteria 2001
39 Ga0075364_10118627 3300006051 Bacteria 1770
40 Ga0075362_10009851 3300006177 Bacteria 3711
41 Ga0075367_10000737 3300006178 Bacteria 12744
42 Ga0075367_10090303 3300006178 Bacteria 1863
43 Ga0075367_10134201 3300006178 Bacteria 1531
44 Ga0075367_10388032 3300006178 Bacteria 883
45 Ga0075370_10004211 3300006353 Bacteria 6947
46 Ga0075370_10041746 3300006353 Bacteria 2590
47 Ga0075370_10092952 3300006353 Bacteria 1741
48 Ga0075370_10104593 3300006353 Bacteria 1641
49 Ga0068865_100228092 3300006881 Bacteria 1460
50 Ga0111539_10952541 3300009094 Bacteria 998
51 Ga0111539_12178650 3300009094 Bacteria 643
52 Ga0105245_10186485 3300009098 Bacteria 1985
53 Ga0105243_10088040 3300009148 Bacteria 2551
54 Ga0105249_10661147 3300009553 Bacteria 1103
55 Ga0157372_10380973 3300013307 Bacteria 1644
56 Ga0157375_10338648 3300013308 Bacteria 1670
57 Ga0157380_10493344 3300014326 Bacteria 1188
58 Ga0182008_10384587 3300014497 Bacteria 751
59 Ga0157376_11010313 3300014969 Bacteria 854
60 Ga0206353_11394522 3300020082 Bacteria 5144
61 Ga0207647_10030582 3300025904 Bacteria 3471
62 Ga0207705_10013918 3300025909 Bacteria 5801
63 Ga0207657_10296395 3300025919 Bacteria 1281
64 Ga0207652_10015851 3300025921 Bacteria 6142
65 Ga0207659_10341090 3300025926 Bacteria 1241
66 Ga0207664_10130370 3300025929 Bacteria 2116
67 Ga0207709_10050181 3300025935 Bacteria 2550
68 Ga0207669_10328850 3300025937 Bacteria 1173
69 Ga0207704_10159724 3300025938 Bacteria 1602
70 Ga0207691_10102902 3300025940 Bacteria 2547
71 Ga0207708_10053072 3300026075 Bacteria 3088
72 Ga0207641_10706376 3300026088 Bacteria 993
73 Ga0207675_100167404 3300026118 Bacteria 2099
74 Ga0207683_10191162 3300026121 Bacteria 1859
75 Ga0209813_10005050 3300027866 Bacteria 3190
76 Ga0209813_10025527 3300027866 Bacteria 1700
77 Ga0268264_10013833 3300028381 Bacteria 6638
78 Ga0307405_10739016 3300031731 Bacteria 819
79 Ga0307410_11049125 3300031852 Bacteria 705
80 Ga0307409_100081584 3300031995 Bacteria 2615
81 Ga0307409_100246241 3300031995 Bacteria 1631
82 Ga0307415_100172446 3300032126 Bacteria 1688
83 Ga0307415_100702380 3300032126 Bacteria 913
84 Ga0451833_0622528 3300041491 Bacteria 756
85 Ga0451837_0376566 3300041494 Bacteria 1027
86 Ga0451837_1830475 3300041494 Bacteria 3523
87 Ga0451841_1320130 3300041498 Bacteria 623
88 Ga0451845_0651134 3300041501 Bacteria 639
89 Ga0451843_0724746 3300041509 Bacteria 2539
90 Ga0451853_0724712 3300041512 Bacteria 725
91 Ga0466965_0067894 3300044683 Bacteria 1790
92 Ga0466966_0016377 3300044684 Bacteria 4899
93 Ga0466966_0030153 3300044684 Bacteria 3524
94 Ga0466961_0086731 3300044693 Bacteria 1978
95 Ga0466961_0128277 3300044693 Bacteria 1590
96 Ga0466963_0190225 3300044694 Bacteria 1434
97 Ga0466963_0333786 3300044694 Bacteria 1067
98 Ga0466964_0018665 3300044706 Bacteria 2663
99 Ga0466964_0046615 3300044706 Bacteria 1767
100 Ga0466971_0014915 3300044719 Bacteria 3420
101 Ga0466968_0102777 3300044735 Bacteria 1277
102 Ga0466968_0160359 3300044735 Bacteria 1038
103 Ga0466970_0014352 3300044765 Bacteria 4067
104 Ga0466970_0188504 3300044765 Bacteria 1145
105 Ga0466970_0247021 3300044765 Bacteria 999
106 Ga0466957_0134187 3300044842 Bacteria 1589
107 Ga0466957_0619641 3300044842 Bacteria 759
108 Ga0466960_0000389 3300044901 Bacteria 15045
109 Ga0466960_0009998 3300044901 Bacteria 3928
110 Ga0466960_0016254 3300044901 Bacteria 3224
111 Ga0466959_0230944 3300045049 Bacteria 1281
112 Ga0466959_0486681 3300045049 Bacteria 835
113 Ga0466967_0016915 3300045976 Bacteria 5768
114 Ga0466967_0105421 3300045976 Bacteria 2582
115 Ga0466967_0116881 3300045976 Bacteria 2458
116 Ga0466967_0474835 3300045976 Bacteria 1224
117 Ga0466967_0639455 3300045976 Bacteria 1051
118 Ga0466967_0798144 3300045976 Bacteria 937
119 Ga0495629_0443406 3300046459 Bacteria 879
120 Ga0495582_0047746 3300046473 Bacteria 2358
121 Ga0495666_0190481 3300046526 Bacteria 945
122 Ga0495667_0486070 3300046559 Bacteria 774
123 Ga0495658_0173884 3300046683 Bacteria 1334
124 Ga0495613_0283939 3300046689 Bacteria 1149
125 Ga0495676_0343278 3300047321 Bacteria 999
126 Ga0496100_0161068 3300048903 Bacteria 1609
127 Ga0496101_0876340 3300048904 Bacteria 707
128 Ga0496106_0174549 3300048909 Bacteria 1705
129 Ga0496107_0274908 3300048910 Bacteria 1254
130 Ga0496109_0130140 3300048912 Bacteria 2348
131 Ga0496109_0165625 3300048912 Bacteria 2072
132 Ga0496110_0115829 3300048913 Bacteria 2413
133 Ga0496114_0527660 3300048917 Bacteria 1044
134 Ga0496114_0561577 3300048917 Bacteria 1008
135 Ga0496124_0232495 3300048927 Bacteria 1377
136 Ga0501031_0096923 3300049568 Bacteria 1925
137 Ga0501031_0659330 3300049568 Bacteria 672
138 Ga0501034_0088219 3300049571 Bacteria 3100
139 Ga0501036_0161838 3300049572 Bacteria 1887
140 Ga0501039_0052289 3300049575 Bacteria 3161
141 Ga0501039_0215599 3300049575 Bacteria 1509
142 Ga0501039_0937654 3300049575 Bacteria 673
143 Ga0501040_0354594 3300049576 Bacteria 1051
144 Ga0501040_0492478 3300049576 Bacteria 884
145 Ga0501041_0046817 3300049577 Bacteria 2632
146 Ga0501042_0294202 3300049578 Bacteria 1173
147 Ga0501042_0335543 3300049578 Bacteria 1093
148 Ga0501046_0263291 3300049580 Bacteria 1266
149 Ga0501046_0484798 3300049580 Bacteria 887
150 Ga0501067_0012114 3300049583 Bacteria 4781
151 Ga0501068_0524070 3300049584 Bacteria 769
152 Ga0501070_0020609 3300049586 Bacteria 5529
153 Ga0501070_0077510 3300049586 Bacteria 2751
154 Ga0501071_0169630 3300049587 Bacteria 1633
155 Ga0501071_0226848 3300049587 Bacteria 1407
156 Ga0501071_0379054 3300049587 Bacteria 1078
157 Ga0501072_0125065 3300049588 Bacteria 2048
158 Ga0501072_0234989 3300049588 Bacteria 1460
159 Ga0501073_0010611 3300049589 Bacteria 6740
160 Ga0501073_0340961 3300049589 Bacteria 1034
161 Ga0501074_0030221 3300049590 Bacteria 3926
162 Ga0501075_0115927 3300049591 Bacteria 2037
163 Ga0501075_0191531 3300049591 Bacteria 1560
164 Ga0501076_0153360 3300049592 Bacteria 1875
165 Ga0501077_0180219 3300049593 Bacteria 1343
166 Ga0501077_0707427 3300049593 Bacteria 647
167 Ga0501079_0393106 3300049741 Bacteria 1087
168 Ga0501083_0185897 3300049744 Bacteria 1356
169 Ga0501045_0131291 3300049824 Bacteria 1862
170 nmdc:mga03683_114040_c1 3300050489 Bacteria 1197
171 nmdc:mga03683_72531_c1 3300050489 Bacteria 1475
172 nmdc:mga03n38_14964_c1 3300050490 Bacteria 2988
173 nmdc:mga03n38_367815_c1 3300050490 Bacteria 786
174 nmdc:mga00v17_143815_c1 3300050491 Bacteria 1054
175 nmdc:mga00v17_153369_c1 3300050491 Bacteria 1481
176 nmdc:mga00v17_368022_c1 3300050491 Bacteria 935
177 nmdc:mga00v17_54207_c1 3300050491 Bacteria 2446
178 nmdc:mga00v17_87390_c1 3300050491 Bacteria 1954
179 nmdc:mga00v17_96448_c1 3300050491 Bacteria 1862
180 nmdc:mga0yw44_10235_c2 3300050492 Bacteria 3512
181 nmdc:mga0yw44_104241_c1 3300050492 Bacteria 1810
182 nmdc:mga0yw44_11044_c1 3300050492 Bacteria 4640
183 nmdc:mga0yw44_131150_c1 3300050492 Bacteria 1623
184 nmdc:mga0yw44_135973_c1 3300050492 Bacteria 1595
185 nmdc:mga0yw44_144848_c1 3300050492 Bacteria 1546
186 nmdc:mga0yw44_18153_c1 3300050492 Bacteria 3847
187 nmdc:mga0yw44_182745_c1 3300050492 Bacteria 1381
188 nmdc:mga0yw44_18453_c1 3300050492 Bacteria 3822
189 nmdc:mga0yw44_256187_c1 3300050492 Bacteria 1165
190 nmdc:mga0yw44_293866_c1 3300050492 Bacteria 1088
191 nmdc:mga0yw44_45924_c1 3300050492 Bacteria 2621
192 nmdc:mga0yw44_482288_c1 3300050492 Bacteria 841
193 nmdc:mga06z11_104976_c1 3300050494 Bacteria 1556
194 nmdc:mga06z11_240241_c1 3300050494 Bacteria 1064
195 nmdc:mga06z11_44131_c1 3300050494 Bacteria 2246
196 nmdc:mga06z11_462186_c1 3300050494 Bacteria 767
197 nmdc:mga06z11_62103_c1 3300050494 Bacteria 1950
198 nmdc:mga06z11_74958_c1 3300050494 Bacteria 1800
199 nmdc:mga04h51_1872_c2 3300050495 Bacteria 2041
200 nmdc:mga04h51_54045_c1 3300050495 Bacteria 1356
201 nmdc:mga07m45_112514_c1 3300050496 Bacteria 1569
202 nmdc:mga07m45_17698_c2 3300050496 Bacteria 3343
203 nmdc:mga07m45_21126_c1 3300050496 Bacteria 3541
204 nmdc:mga08y16_977675_c1 3300050511 Bacteria 828
205 Ga0495655_0163833 3300053083 Bacteria 707
206 Ga0495619_0420841 3300053085 Bacteria 922
207 Ga0500644_0000170 3300053088 Bacteria 41542
208 Ga0500644_0007865 3300053088 Bacteria 2792
209 Ga0500641_0065697 3300053096 Bacteria 1518
210 Ga0500556_0008279 3300053104 Bacteria 2996
211 Ga0500593_000285 3300053117 Bacteria 20567
212 Ga0500573_0026044 3300053140 Bacteria 3362
213 Ga0500573_0311982 3300053140 Bacteria 781
214 Ga0501084_0053584 3300054114 Bacteria 3374
215 Ga0501082_0009085 3300060353 Bacteria 8574
216 Ga0501082_0184309 3300060353 Bacteria 1816
217 Ga0501082_1086322 3300060353 Bacteria 699
218 2644093540 2643221615 Bacteria 5487866
219 2644231678 2643221641 Bacteria 4490190
220 2644323150 2643221657 Bacteria 5490246
221 2855391159 2855386786 Bacteria 4752232
222 2857485777 2857481737 Bacteria 4761446
223 nmdc:mga03n38_136174_c1
224 JGI24735J21928_10020448
225 JGI24735J21928_10067334
226 Ga0070658_10039099
227 Ga0070682_100247484
228 Ga0070682_100349458
229 Ga0070682_100577541
230 Ga0070660_100294241
231 Ga0070691_10098190
232 Ga0070687_100486931
233 Ga0070659_100312593
234 Ga0070714_100032778
235 Ga0070678_101324548
236 Ga0070681_10128762
237 Ga0070685_10110831
238 Ga0070679_100007341
239 Ga0070684_100112850
240 Ga0070686_100262362
241 Ga0070693_100561074
242 Ga0070702_101093691
243 Ga0068852_100909739
244 Ga0068861_100272187
245 Ga0068861_100427934
246 Ga0075365_10004069
247 Ga0075365_10021520
248 Ga0075365_10029587
249 Ga0075365_10034479
250 Ga0075365_10152393
251 Ga0075365_10203395
252 Ga0075365_10315783
253 Ga0075365_10517722
254 Ga0075365_10573019
255 Ga0075368_10112703
256 Ga0075363_100034573
257 Ga0075363_100069516
258 Ga0075363_100104195
259 Ga0075364_10056605
260 Ga0075364_10093072
261 Ga0075364_10118627
262 Ga0075362_10009851
263 Ga0075367_10000737
264 Ga0075367_10090303
265 Ga0075367_10134201
266 Ga0075367_10388032
267 Ga0075370_10004211
268 Ga0075370_10041746
269 Ga0075370_10092952
270 Ga0075370_10104593
271 Ga0068865_100228092
272 Ga0111539_10952541
273 Ga0111539_12178650
274 Ga0105245_10186485
275 Ga0105243_10088040
276 Ga0105249_10661147
277 Ga0157372_10380973
278 Ga0157375_10338648
279 Ga0157380_10493344
280 Ga0182008_10384587
281 Ga0157376_11010313
282 Ga0206353_11394522
283 Ga0207647_10030582
284 Ga0207705_10013918
285 Ga0207657_10296395
286 Ga0207652_10015851
287 Ga0207659_10341090
288 Ga0207664_10130370
289 Ga0207709_10050181
290 Ga0207669_10328850
291 Ga0207704_10159724
292 Ga0207691_10102902
293 Ga0207708_10053072
294 Ga0207641_10706376
295 Ga0207675_100167404
296 Ga0207683_10191162
297 Ga0209813_10005050
298 Ga0209813_10025527
299 Ga0268264_10013833
300 Ga0307405_10739016
301 Ga0307410_11049125
302 Ga0307409_100081584
303 Ga0307409_100246241
304 Ga0307415_100172446
305 Ga0307415_100702380
306 Ga0451833_0622528
307 Ga0451837_0376566
308 Ga0451837_1830475
309 Ga0451841_1320130
310 Ga0451845_0651134
311 Ga0451843_0724746
312 Ga0451853_0724712
313 Ga0466965_0067894
314 Ga0466966_0016377
315 Ga0466966_0030153
316 Ga0466961_0086731
317 Ga0466961_0128277
318 Ga0466963_0190225
319 Ga0466963_0333786
320 Ga0466964_0018665
321 Ga0466964_0046615
322 Ga0466971_0014915
323 Ga0466968_0102777
324 Ga0466968_0160359
325 Ga0466970_0014352
326 Ga0466970_0188504
327 Ga0466970_0247021
328 Ga0466957_0134187
329 Ga0466957_0619641
330 Ga0466960_0000389
331 Ga0466960_0009998
332 Ga0466960_0016254
333 Ga0466959_0230944
334 Ga0466959_0486681
335 Ga0466967_0016915
336 Ga0466967_0105421
337 Ga0466967_0116881
338 Ga0466967_0474835
339 Ga0466967_0639455
340 Ga0466967_0798144
341 Ga0495629_0443406
342 Ga0495582_0047746
343 Ga0495666_0190481
344 Ga0495667_0486070
345 Ga0495658_0173884
346 Ga0495613_0283939
347 Ga0495676_0343278
348 Ga0496100_0161068
349 Ga0496101_0876340
350 Ga0496106_0174549
351 Ga0496107_0274908
352 Ga0496109_0130140
353 Ga0496109_0165625
354 Ga0496110_0115829
355 Ga0496114_0527660
356 Ga0496114_0561577
357 Ga0496124_0232495
358 Ga0501031_0096923
359 Ga0501031_0659330
360 Ga0501034_0088219
361 Ga0501036_0161838
362 Ga0501039_0052289
363 Ga0501039_0215599
364 Ga0501039_0937654
365 Ga0501040_0354594
366 Ga0501040_0492478
367 Ga0501041_0046817
368 Ga0501042_0294202
369 Ga0501042_0335543
370 Ga0501046_0263291
371 Ga0501046_0484798
372 Ga0501067_0012114
373 Ga0501068_0524070
374 Ga0501070_0020609
375 Ga0501070_0077510
376 Ga0501071_0169630
377 Ga0501071_0226848
378 Ga0501071_0379054
379 Ga0501072_0125065
380 Ga0501072_0234989
381 Ga0501073_0010611
382 Ga0501073_0340961
383 Ga0501074_0030221
384 Ga0501075_0115927
385 Ga0501075_0191531
386 Ga0501076_0153360
387 Ga0501077_0180219
388 Ga0501077_0707427
389 Ga0501079_0393106
390 Ga0501083_0185897
391 Ga0501045_0131291
392 nmdc:mga03683_114040_c1
393 nmdc:mga03683_72531_c1
394 nmdc:mga03n38_14964_c1
395 nmdc:mga03n38_367815_c1
396 nmdc:mga00v17_143815_c1
397 nmdc:mga00v17_153369_c1
398 nmdc:mga00v17_368022_c1
399 nmdc:mga00v17_54207_c1
400 nmdc:mga00v17_87390_c1
401 nmdc:mga00v17_96448_c1
402 nmdc:mga0yw44_10235_c2
403 nmdc:mga0yw44_104241_c1
404 nmdc:mga0yw44_11044_c1
405 nmdc:mga0yw44_131150_c1
406 nmdc:mga0yw44_135973_c1
407 nmdc:mga0yw44_144848_c1
408 nmdc:mga0yw44_18153_c1
409 nmdc:mga0yw44_182745_c1
410 nmdc:mga0yw44_18453_c1
411 nmdc:mga0yw44_256187_c1
412 nmdc:mga0yw44_293866_c1
413 nmdc:mga0yw44_45924_c1
414 nmdc:mga0yw44_482288_c1
415 nmdc:mga06z11_104976_c1
416 nmdc:mga06z11_240241_c1
417 nmdc:mga06z11_44131_c1
418 nmdc:mga06z11_462186_c1
419 nmdc:mga06z11_62103_c1
420 nmdc:mga06z11_74958_c1
421 nmdc:mga04h51_1872_c2
422 nmdc:mga04h51_54045_c1
423 nmdc:mga07m45_112514_c1
424 nmdc:mga07m45_17698_c2
425 nmdc:mga07m45_21126_c1
426 nmdc:mga08y16_977675_c1
427 Ga0495655_0163833
428 Ga0495619_0420841
429 Ga0500644_0000170
430 Ga0500644_0007865
431 Ga0500641_0065697
432 Ga0500556_0008279
433 Ga0500593_000285
434 Ga0500573_0026044
435 Ga0500573_0311982
436 Ga0501084_0053584
437 Ga0501082_0009085
438 Ga0501082_0184309
439 Ga0501082_1086322
440 2644093540
441 2644231678
442 2644323150
443 2855391159
444 2857485777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

76

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8771 24 174
2j3m-assembly1.cif.gz_A prolyl-trna synthetase from enterococcus faecalis complexed with atp, manganese and prolinol 0.855 37 160
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.8523 24 176
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8455 22 176
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.84 24 174
ID Description Score Start End Superfamily
af_P64483_2_166_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.861 37 175 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8599 24 174 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.842 24 176 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8379 40 174 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8374 22 176 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A7X0RIA6-F1-model_v4 YbaK/EbsC family protein 0.9808 1 180 GO:0002161
AF-A0A4R1TRG5-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.9805 9 179 GO:0002161
AF-A0A7X0RIA6-F1-model_v4 YbaK/EbsC family protein 0.9754 1 180 GO:0002161
AF-A0A838KPW1-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9748 21 180 GO:0002161
AF-A0A181ZFK3-F1-model_v4 Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC 0.9742 9 180 GO:0002161

Map