F333016

General Info

Members Datasets Scaffolds Average Seq Length
221 114 442 353

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100177951|Ga0068868_1001779512
Length 383
Sequence VSLRLLYLIFVRLCGWLVLLGRSSASTNAELLVLRHEVAVLRRTNPRPRLDWADRAVMAALIRLLPGKLRVHRLVTPGTVLRWHRRLVTRKWTFPHGAGRPSVSAEIAALIGRLAAENHGWGYQRIQGELLKLGHRVSASTIRRILKALKIPPAPKRLTDATWRQFLHAQAATMLATDFFHVDCAVTLQRLYCLFVMEIGSRYVHILGVTANPDGPWTTQQIRNFLIDLGERAADFRFLVRDRAGQFSASFDAVLADVGIATVKIPPRSPRANAYAERFVLTARTEVTDRMLIFSQRHLRIVMAGYARHYNGRRPHRALQLQPPRPDHLVADLSQERIKRRPVLGGLLNEYERAALKPRSQLAAQFWHPTRPAWTCPAFMSED

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
47 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
54 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
108 2508501039 Frankia saprophytica CN3 Isolate Nodule
109 2619618881 Frankia sp. ACN1ag Isolate Unclassified
110 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
111 2687453737 Frankia sp. BMG5.36 Isolate Nodule
112 2862574272 Streptomyces sp. AcE210 Isolate Nodule
113 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
114 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.26
Rhizoplane 3.17
Rhizosphere 93.21
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100177951 3300005338 Bacteria 1763
2 Ga0070709_10086623 3300005434 Bacteria 2057
3 Ga0070714_100013027 3300005435 Bacteria 6652
4 Ga0070714_100287066 3300005435 Bacteria 1530
5 Ga0070714_100416881 3300005435 Bacteria 1271
6 Ga0070713_100097521 3300005436 Bacteria 2540
7 Ga0070713_100196146 3300005436 Bacteria 1821
8 Ga0070713_100308484 3300005436 Bacteria 1459
9 Ga0070713_100459036 3300005436 Unclassified 1197
10 Ga0070710_10104985 3300005437 Unclassified 1688
11 Ga0070711_100013905 3300005439 Bacteria 5063
12 Ga0070711_100203014 3300005439 Bacteria 1531
13 Ga0070708_100047967 3300005445 Bacteria 3775
14 Ga0070706_100016779 3300005467 Bacteria 6764
15 Ga0070706_100026179 3300005467 Bacteria 5368
16 Ga0070706_100070566 3300005467 Bacteria 3230
17 Ga0070707_100006244 3300005468 Bacteria 11092
18 Ga0070707_100027057 3300005468 Bacteria 5453
19 Ga0070707_100087994 3300005468 Bacteria 3005
20 Ga0070707_100099090 3300005468 Bacteria 2823
21 Ga0070699_100003962 3300005518 Bacteria 13087
22 Ga0070699_100016327 3300005518 Bacteria 6376
23 Ga0070684_100223293 3300005535 Bacteria 1719
24 Ga0070697_100002795 3300005536 Bacteria 13443
25 Ga0070697_100011195 3300005536 Bacteria 7011
26 Ga0070697_100013093 3300005536 Bacteria 6502
27 Ga0068862_100008093 3300005844 Bacteria 8701
28 Ga0070717_10003398 3300006028 Bacteria 11389
29 Ga0070717_10126619 3300006028 Bacteria 2193
30 Ga0070717_10129662 3300006028 Bacteria 2167
31 Ga0070717_10286857 3300006028 Bacteria 1461
32 Ga0070717_10336708 3300006028 Bacteria 1347
33 Ga0070717_10357077 3300006028 Bacteria 1307
34 Ga0070717_10423679 3300006028 Unclassified 1197
35 Ga0070715_10034077 3300006163 Unclassified 2085
36 Ga0070715_10041078 3300006163 Bacteria 1937
37 Ga0070716_100045104 3300006173 Unclassified 2473
38 Ga0070712_100039012 3300006175 Bacteria 3248
39 Ga0075431_100067217 3300006847 Bacteria 3700
40 Ga0105240_10250227 3300009093 Bacteria 2050
41 Ga0105248_10042500 3300009177 Bacteria 5098
42 Ga0105237_10032339 3300009545 Bacteria 5296
43 Ga0105238_10059390 3300009551 Bacteria 3831
44 Ga0105238_10180895 3300009551 Bacteria 2085
45 Ga0105249_10021122 3300009553 Bacteria 5827
46 Ga0105239_10039733 3300010375 Bacteria 5155
47 Ga0157374_10056596 3300013296 Bacteria 3662
48 Ga0157374_10302359 3300013296 Unclassified 1583
49 Ga0157376_10274401 3300014969 Bacteria 1585
50 Ga0207692_10037040 3300025898 Unclassified 2383
51 Ga0207699_10001090 3300025906 Bacteria 12825
52 Ga0207699_10016521 3300025906 Bacteria 3864
53 Ga0207684_10014286 3300025910 Bacteria 6849
54 Ga0207684_10016185 3300025910 Bacteria 6408
55 Ga0207684_10030173 3300025910 Bacteria 4616
56 Ga0207684_10193971 3300025910 Bacteria 1752
57 Ga0207693_10012818 3300025915 Bacteria 6763
58 Ga0207693_10052566 3300025915 Bacteria 3196
59 Ga0207693_10105111 3300025915 Bacteria 2214
60 Ga0207693_10130324 3300025915 Bacteria 1977
61 Ga0207693_10171807 3300025915 Unclassified 1707
62 Ga0207663_10066020 3300025916 Bacteria 2315
63 Ga0207663_10085311 3300025916 Bacteria 2079
64 Ga0207646_10007798 3300025922 Bacteria 10828
65 Ga0207646_10034501 3300025922 Bacteria 4572
66 Ga0207646_10051568 3300025922 Bacteria 3681
67 Ga0207646_10091547 3300025922 Bacteria 2722
68 Ga0207646_10365118 3300025922 Bacteria 1304
69 Ga0207694_10048328 3300025924 Bacteria 3292
70 Ga0207700_10003033 3300025928 Bacteria 9687
71 Ga0207700_10101510 3300025928 Bacteria 2295
72 Ga0207700_10108775 3300025928 Bacteria 2227
73 Ga0207700_10376138 3300025928 Unclassified 1241
74 Ga0207664_10050627 3300025929 Bacteria 3276
75 Ga0207664_10181912 3300025929 Bacteria 1805
76 Ga0207664_10297419 3300025929 Bacteria 1419
77 Ga0207665_10131538 3300025939 Unclassified 1777
78 Ga0207711_10001146 3300025941 Bacteria 25255
79 Ga0207712_10026340 3300025961 Bacteria 3872
80 Ga0207702_10210973 3300026078 Bacteria 1805
81 Ga0207641_10001086 3300026088 Bacteria 27378
82 Ga0268265_10001264 3300028380 Bacteria 21823
83 Ga0307515_10046810 3300028794 Bacteria 6599
84 Ga0265328_10007094 3300031239 Bacteria 4695
85 Ga0265328_10018257 3300031239 Bacteria 2707
86 Ga0265329_10040137 3300031242 Bacteria 1502
87 Ga0307409_100187211 3300031995 Bacteria 1839
88 Ga0373926_0000914 3300035083 Bacteria 8501
89 Ga0373934_0078582 3300035086 Bacteria 1324
90 Ga0373944_0002249 3300035089 Bacteria 4910
91 Ga0373923_0022831 3300035111 Bacteria 2457
92 Ga0373936_0000993 3300035113 Bacteria 10112
93 Ga0373936_0047310 3300035113 Bacteria 1735
94 Ga0373945_0003229 3300035116 Bacteria 5116
95 Ga0373945_0053422 3300035116 Bacteria 1491
96 Ga0373954_0039532 3300035118 Bacteria 2196
97 Ga0373943_0004854 3300035170 Bacteria 6079
98 Ga0373943_0007531 3300035170 Bacteria 4890
99 Ga0373946_0003216 3300035171 Bacteria 5799
100 Ga0373946_0003477 3300035171 Bacteria 5590
101 Ga0373955_0053496 3300035172 Bacteria 2204
102 Ga0373924_0034696 3300035410 Bacteria 2043
103 Ga0373935_0020338 3300035692 Bacteria 4054
104 Ga0373935_0028147 3300035692 Bacteria 3473
105 Ga0373935_0144194 3300035692 Bacteria 1611
106 Ga0373927_0023530 3300035695 Bacteria 4034
107 Ga0373933_0009359 3300035724 Bacteria 5351
108 Ga0373933_0056936 3300035724 Bacteria 2348
109 Ga0373947_0001500 3300035725 Bacteria 14323
110 Ga0373947_0005337 3300035725 Bacteria 7506
111 Ga0373937_0025243 3300036401 Bacteria 5365
112 Ga0373925_0012987 3300037068 Bacteria 6030
113 Ga0373925_0071205 3300037068 Bacteria 2629
114 Ga0373925_0169279 3300037068 Bacteria 1724
115 Ga0466967_0388724 3300045976 Bacteria 1356
116 Ga0495592_0000455 3300046454 Bacteria 30633
117 Ga0495592_0079385 3300046454 Bacteria 2375
118 Ga0495592_0110957 3300046454 Bacteria 1941
119 Ga0495629_0058152 3300046459 Bacteria 2703
120 Ga0495641_0094315 3300046461 Bacteria 1337
121 Ga0495651_0000174 3300046462 Bacteria 47579
122 Ga0495651_0003133 3300046462 Bacteria 12753
123 Ga0495651_0017100 3300046462 Bacteria 5620
124 Ga0495653_0005074 3300046463 Bacteria 10686
125 Ga0495653_0006812 3300046463 Bacteria 9386
126 Ga0495653_0198182 3300046463 Bacteria 1365
127 Ga0495580_0233287 3300046472 Bacteria 1263
128 Ga0495639_0066342 3300046475 Bacteria 1661
129 Ga0495664_0009753 3300046477 Bacteria 5381
130 Ga0495664_0017573 3300046477 Bacteria 4091
131 Ga0495664_0047813 3300046477 Bacteria 2539
132 Ga0495664_0102096 3300046477 Bacteria 1728
133 Ga0495608_0015111 3300046511 Bacteria 5356
134 Ga0495608_0051955 3300046511 Bacteria 2714
135 Ga0495608_0052012 3300046511 Bacteria 2712
136 Ga0495618_0008533 3300046514 Bacteria 6191
137 Ga0495618_0121939 3300046514 Bacteria 1670
138 Ga0495618_0160012 3300046514 Bacteria 1436
139 Ga0495628_0000444 3300046516 Bacteria 37801
140 Ga0495628_0009892 3300046516 Bacteria 8119
141 Ga0495628_0208657 3300046516 Bacteria 1470
142 Ga0495630_0010543 3300046517 Bacteria 6677
143 Ga0495630_0019843 3300046517 Bacteria 4947
144 Ga0495630_0027741 3300046517 Bacteria 4204
145 Ga0495652_0000665 3300046529 Bacteria 39849
146 Ga0495652_0023089 3300046529 Bacteria 5515
147 Ga0495652_0178839 3300046529 Bacteria 1630
148 Ga0495665_0170423 3300046531 Bacteria 1133
149 Ga0495640_0006525 3300046533 Bacteria 9221
150 Ga0495640_0055525 3300046533 Bacteria 2709
151 Ga0495587_0004800 3300046536 Bacteria 8875
152 Ga0495587_0012575 3300046536 Bacteria 5323
153 Ga0495587_0067805 3300046536 Bacteria 2079
154 Ga0495587_0169122 3300046536 Bacteria 1242
155 Ga0495645_0015353 3300046543 Bacteria 5445
156 Ga0495645_0239541 3300046543 Bacteria 1211
157 Ga0495667_0000117 3300046559 Bacteria 57725
158 Ga0495667_0014273 3300046559 Bacteria 5365
159 Ga0495667_0048390 3300046559 Bacteria 2807
160 Ga0495634_0001586 3300046642 Bacteria 19947
161 Ga0495634_0014369 3300046642 Bacteria 5711
162 Ga0495635_0009560 3300046663 Bacteria 6775
163 Ga0495635_0014435 3300046663 Bacteria 5525
164 Ga0495635_0023186 3300046663 Bacteria 4325
165 Ga0495635_0052069 3300046663 Bacteria 2820
166 Ga0495657_0005088 3300046675 Bacteria 10445
167 Ga0495657_0022197 3300046675 Bacteria 4550
168 Ga0495599_0000185 3300046678 Bacteria 40953
169 Ga0495599_0004694 3300046678 Bacteria 8108
170 Ga0495599_0008233 3300046678 Bacteria 6340
171 Ga0495623_0124417 3300046679 Bacteria 1549
172 Ga0495623_0156802 3300046679 Bacteria 1341
173 Ga0495646_0000628 3300046680 Bacteria 19227
174 Ga0495624_0011001 3300046690 Bacteria 6230
175 Ga0495624_0054637 3300046690 Bacteria 2517
176 Ga0495624_0141520 3300046690 Bacteria 1473
177 Ga0495600_0046460 3300046809 Bacteria 2832
178 Ga0495600_0065449 3300046809 Bacteria 2376
179 Ga0495581_0007289 3300047315 Bacteria 6399
180 Ga0495604_0055931 3300047317 Bacteria 3039
181 Ga0495674_0000515 3300047319 Bacteria 35520
182 Ga0495674_0000984 3300047319 Bacteria 27406
183 Ga0495674_0019508 3300047319 Bacteria 6290
184 Ga0495674_0113884 3300047319 Bacteria 2290
185 Ga0495676_0150327 3300047321 Bacteria 1658
186 Ga0495680_0000401 3300047322 Bacteria 48480
187 Ga0495680_0001811 3300047322 Bacteria 22577
188 Ga0495680_0013779 3300047322 Bacteria 7036
189 Ga0495680_0021922 3300047322 Bacteria 5338
190 Ga0495680_0052846 3300047322 Bacteria 3165
191 Ga0495680_0137640 3300047322 Bacteria 1789
192 Ga0495680_0228395 3300047322 Bacteria 1326
193 Ga0495684_0000598 3300047471 Bacteria 29035
194 Ga0495684_0028050 3300047471 Bacteria 4324
195 Ga0495684_0122960 3300047471 Bacteria 1953
196 Ga0495602_0002949 3300048088 Bacteria 17454
197 Ga0495602_0036040 3300048088 Bacteria 4607
198 Ga0495602_0119129 3300048088 Bacteria 2128
199 Ga0496100_0252146 3300048903 Bacteria 1306
200 Ga0496102_0153045 3300048905 Bacteria 2168
201 Ga0496102_0313912 3300048905 Bacteria 1477
202 Ga0496105_0257627 3300048908 Bacteria 1412
203 Ga0496108_0115250 3300048911 Bacteria 2301
204 Ga0496109_0036834 3300048912 Bacteria 4417
205 Ga0496112_0277254 3300048915 Bacteria 1624
206 nmdc:mga06r32_92575_c1 3300050510 Bacteria 2956
207 Ga0495601_0001504 3300053077 Bacteria 12850
208 Ga0495612_0066541 3300053078 Bacteria 1498
209 Ga0495595_0012173 3300053084 Bacteria 3611
210 Ga0495595_0024316 3300053084 Bacteria 2675
211 Ga0495619_0031163 3300053085 Bacteria 3454
212 Ga0495619_0142013 3300053085 Bacteria 1654
213 2508672032 2508501039 Bacteria 9978592
214 2619855460 2619618881 Bacteria 7521104
215 2686534668 2684623035 Bacteria 8032739
216 2686535119 2684623035 Bacteria 8032739
217 2689957360 2687453737 Bacteria 11203906
218 2862575920 2862574272 Bacteria 10567477
219 2895883974 2895880812 Bacteria 11255272
220 8054916563 8054913762 Bacteria 7713009
221 8054920362 8054913762 Bacteria 7713009
222 Ga0068868_100177951
223 Ga0070709_10086623
224 Ga0070714_100013027
225 Ga0070714_100287066
226 Ga0070714_100416881
227 Ga0070713_100097521
228 Ga0070713_100196146
229 Ga0070713_100308484
230 Ga0070713_100459036
231 Ga0070710_10104985
232 Ga0070711_100013905
233 Ga0070711_100203014
234 Ga0070708_100047967
235 Ga0070706_100016779
236 Ga0070706_100026179
237 Ga0070706_100070566
238 Ga0070707_100006244
239 Ga0070707_100027057
240 Ga0070707_100087994
241 Ga0070707_100099090
242 Ga0070699_100003962
243 Ga0070699_100016327
244 Ga0070684_100223293
245 Ga0070697_100002795
246 Ga0070697_100011195
247 Ga0070697_100013093
248 Ga0068862_100008093
249 Ga0070717_10003398
250 Ga0070717_10126619
251 Ga0070717_10129662
252 Ga0070717_10286857
253 Ga0070717_10336708
254 Ga0070717_10357077
255 Ga0070717_10423679
256 Ga0070715_10034077
257 Ga0070715_10041078
258 Ga0070716_100045104
259 Ga0070712_100039012
260 Ga0075431_100067217
261 Ga0105240_10250227
262 Ga0105248_10042500
263 Ga0105237_10032339
264 Ga0105238_10059390
265 Ga0105238_10180895
266 Ga0105249_10021122
267 Ga0105239_10039733
268 Ga0157374_10056596
269 Ga0157374_10302359
270 Ga0157376_10274401
271 Ga0207692_10037040
272 Ga0207699_10001090
273 Ga0207699_10016521
274 Ga0207684_10014286
275 Ga0207684_10016185
276 Ga0207684_10030173
277 Ga0207684_10193971
278 Ga0207693_10012818
279 Ga0207693_10052566
280 Ga0207693_10105111
281 Ga0207693_10130324
282 Ga0207693_10171807
283 Ga0207663_10066020
284 Ga0207663_10085311
285 Ga0207646_10007798
286 Ga0207646_10034501
287 Ga0207646_10051568
288 Ga0207646_10091547
289 Ga0207646_10365118
290 Ga0207694_10048328
291 Ga0207700_10003033
292 Ga0207700_10101510
293 Ga0207700_10108775
294 Ga0207700_10376138
295 Ga0207664_10050627
296 Ga0207664_10181912
297 Ga0207664_10297419
298 Ga0207665_10131538
299 Ga0207711_10001146
300 Ga0207712_10026340
301 Ga0207702_10210973
302 Ga0207641_10001086
303 Ga0268265_10001264
304 Ga0307515_10046810
305 Ga0265328_10007094
306 Ga0265328_10018257
307 Ga0265329_10040137
308 Ga0307409_100187211
309 Ga0373926_0000914
310 Ga0373934_0078582
311 Ga0373944_0002249
312 Ga0373923_0022831
313 Ga0373936_0000993
314 Ga0373936_0047310
315 Ga0373945_0003229
316 Ga0373945_0053422
317 Ga0373954_0039532
318 Ga0373943_0004854
319 Ga0373943_0007531
320 Ga0373946_0003216
321 Ga0373946_0003477
322 Ga0373955_0053496
323 Ga0373924_0034696
324 Ga0373935_0020338
325 Ga0373935_0028147
326 Ga0373935_0144194
327 Ga0373927_0023530
328 Ga0373933_0009359
329 Ga0373933_0056936
330 Ga0373947_0001500
331 Ga0373947_0005337
332 Ga0373937_0025243
333 Ga0373925_0012987
334 Ga0373925_0071205
335 Ga0373925_0169279
336 Ga0466967_0388724
337 Ga0495592_0000455
338 Ga0495592_0079385
339 Ga0495592_0110957
340 Ga0495629_0058152
341 Ga0495641_0094315
342 Ga0495651_0000174
343 Ga0495651_0003133
344 Ga0495651_0017100
345 Ga0495653_0005074
346 Ga0495653_0006812
347 Ga0495653_0198182
348 Ga0495580_0233287
349 Ga0495639_0066342
350 Ga0495664_0009753
351 Ga0495664_0017573
352 Ga0495664_0047813
353 Ga0495664_0102096
354 Ga0495608_0015111
355 Ga0495608_0051955
356 Ga0495608_0052012
357 Ga0495618_0008533
358 Ga0495618_0121939
359 Ga0495618_0160012
360 Ga0495628_0000444
361 Ga0495628_0009892
362 Ga0495628_0208657
363 Ga0495630_0010543
364 Ga0495630_0019843
365 Ga0495630_0027741
366 Ga0495652_0000665
367 Ga0495652_0023089
368 Ga0495652_0178839
369 Ga0495665_0170423
370 Ga0495640_0006525
371 Ga0495640_0055525
372 Ga0495587_0004800
373 Ga0495587_0012575
374 Ga0495587_0067805
375 Ga0495587_0169122
376 Ga0495645_0015353
377 Ga0495645_0239541
378 Ga0495667_0000117
379 Ga0495667_0014273
380 Ga0495667_0048390
381 Ga0495634_0001586
382 Ga0495634_0014369
383 Ga0495635_0009560
384 Ga0495635_0014435
385 Ga0495635_0023186
386 Ga0495635_0052069
387 Ga0495657_0005088
388 Ga0495657_0022197
389 Ga0495599_0000185
390 Ga0495599_0004694
391 Ga0495599_0008233
392 Ga0495623_0124417
393 Ga0495623_0156802
394 Ga0495646_0000628
395 Ga0495624_0011001
396 Ga0495624_0054637
397 Ga0495624_0141520
398 Ga0495600_0046460
399 Ga0495600_0065449
400 Ga0495581_0007289
401 Ga0495604_0055931
402 Ga0495674_0000515
403 Ga0495674_0000984
404 Ga0495674_0019508
405 Ga0495674_0113884
406 Ga0495676_0150327
407 Ga0495680_0000401
408 Ga0495680_0001811
409 Ga0495680_0013779
410 Ga0495680_0021922
411 Ga0495680_0052846
412 Ga0495680_0137640
413 Ga0495680_0228395
414 Ga0495684_0000598
415 Ga0495684_0028050
416 Ga0495684_0122960
417 Ga0495602_0002949
418 Ga0495602_0036040
419 Ga0495602_0119129
420 Ga0496100_0252146
421 Ga0496102_0153045
422 Ga0496102_0313912
423 Ga0496105_0257627
424 Ga0496108_0115250
425 Ga0496109_0036834
426 Ga0496112_0277254
427 nmdc:mga06r32_92575_c1
428 Ga0495601_0001504
429 Ga0495612_0066541
430 Ga0495595_0012173
431 Ga0495595_0024316
432 Ga0495619_0031163
433 Ga0495619_0142013
434 2508672032
435 2619855460
436 2686534668
437 2686535119
438 2689957360
439 2862575920
440 2895883974
441 8054916563
442 8054920362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

258

324

0.97

Map