F332961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 221 | 148 | 221 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100002518|Ga0070683_10000251811 |
| Length | 266 |
| Sequence | MPVIDVNALIGPYPFRYVPHPDPEVLVRVLDREGIDSAWVGHLPSAFYRDPTPGNRELFAKLSAFSNRLVPVPAIRPDWPKWDVALRDAASAGAVAVRVYPPQWGMGPHDASLRELAIAAGEHGMATLLTVRFEDLRQRHPMDSAGDLSAAAIRALARAGDAVRLVVTAAGREMIEEVHWGLTPGEQARVFWDISWIWGPPEDHLGKLFRTIGSERFVFGTHWPLRLTQTPSANLDLLPDDLLGMSLADARGICATRRPSPVAHPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 96.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10024239 | 3300005327 | Bacteria | 4868 |
| 2 | Ga0070658_10156495 | 3300005327 | Unclassified | 1911 |
| 3 | Ga0070658_10160984 | 3300005327 | Unclassified | 1883 |
| 4 | Ga0070658_10234948 | 3300005327 | Bacteria | 1553 |
| 5 | Ga0070676_10004100 | 3300005328 | Bacteria | 7654 |
| 6 | Ga0070676_10046244 | 3300005328 | Bacteria | 2537 |
| 7 | Ga0070683_100002518 | 3300005329 | Bacteria | 14604 |
| 8 | Ga0070683_100017550 | 3300005329 | Bacteria | 6327 |
| 9 | Ga0070683_100028663 | 3300005329 | Bacteria | 5034 |
| 10 | Ga0070683_100150375 | 3300005329 | Unclassified | 2207 |
| 11 | Ga0070683_100204343 | 3300005329 | Archaea | 1876 |
| 12 | Ga0070690_100113265 | 3300005330 | Bacteria | 1813 |
| 13 | Ga0070670_100384750 | 3300005331 | Bacteria | 1236 |
| 14 | Ga0070677_10063542 | 3300005333 | Bacteria | 1531 |
| 15 | Ga0070680_100064595 | 3300005336 | Unclassified | 3000 |
| 16 | Ga0070660_100086434 | 3300005339 | Unclassified | 2467 |
| 17 | Ga0070660_100311034 | 3300005339 | Bacteria | 1293 |
| 18 | Ga0070687_100014559 | 3300005343 | Bacteria | 3535 |
| 19 | Ga0070661_100136236 | 3300005344 | Unclassified | 1848 |
| 20 | Ga0070668_100519689 | 3300005347 | Bacteria | 1033 |
| 21 | Ga0070669_100001331 | 3300005353 | Bacteria | 17816 |
| 22 | Ga0070675_100007872 | 3300005354 | Bacteria | 8259 |
| 23 | Ga0070675_100070422 | 3300005354 | Bacteria | 2898 |
| 24 | Ga0070675_100076789 | 3300005354 | Bacteria | 2779 |
| 25 | Ga0070675_100087374 | 3300005354 | Bacteria | 2607 |
| 26 | Ga0070675_100650170 | 3300005354 | Unclassified | 958 |
| 27 | Ga0070671_100052651 | 3300005355 | Bacteria | 3384 |
| 28 | Ga0070671_100765688 | 3300005355 | Unclassified | 839 |
| 29 | Ga0070673_100325529 | 3300005364 | Bacteria | 1358 |
| 30 | Ga0070673_100384119 | 3300005364 | Bacteria | 1252 |
| 31 | Ga0070688_100014483 | 3300005365 | Unclassified | 4469 |
| 32 | Ga0070688_100277972 | 3300005365 | Unclassified | 1202 |
| 33 | Ga0070659_100041186 | 3300005366 | Unclassified | 3609 |
| 34 | Ga0070659_100079480 | 3300005366 | Bacteria | 2618 |
| 35 | Ga0070667_100140079 | 3300005367 | Bacteria | 2117 |
| 36 | Ga0070703_10062892 | 3300005406 | Bacteria | 1219 |
| 37 | Ga0070709_10060227 | 3300005434 | Bacteria | 2412 |
| 38 | Ga0070709_10424883 | 3300005434 | Bacteria | 997 |
| 39 | Ga0070714_100081467 | 3300005435 | Bacteria | 2818 |
| 40 | Ga0070678_100506066 | 3300005456 | Bacteria | 1066 |
| 41 | Ga0070678_100798130 | 3300005456 | Bacteria | 857 |
| 42 | Ga0070662_100330569 | 3300005457 | Bacteria | 1245 |
| 43 | Ga0070681_10036586 | 3300005458 | Unclassified | 4929 |
| 44 | Ga0070681_10181247 | 3300005458 | Bacteria | 2028 |
| 45 | Ga0070681_10198989 | 3300005458 | Unclassified | 1922 |
| 46 | Ga0070681_10393978 | 3300005458 | Unclassified | 1296 |
| 47 | Ga0070685_10022653 | 3300005466 | Bacteria | 3428 |
| 48 | Ga0070706_100024495 | 3300005467 | Bacteria | 5556 |
| 49 | Ga0070698_100430228 | 3300005471 | Unclassified | 1255 |
| 50 | Ga0070679_100001774 | 3300005530 | Bacteria | 19432 |
| 51 | Ga0070679_100134090 | 3300005530 | Bacteria | 2457 |
| 52 | Ga0070679_100554687 | 3300005530 | Unclassified | 1093 |
| 53 | Ga0070684_100017084 | 3300005535 | Bacteria | 5947 |
| 54 | Ga0070684_100079278 | 3300005535 | Bacteria | 2903 |
| 55 | Ga0070684_100215580 | 3300005535 | Archaea | 1750 |
| 56 | Ga0070697_100329530 | 3300005536 | Unclassified | 1316 |
| 57 | Ga0070672_100237547 | 3300005543 | Unclassified | 1532 |
| 58 | Ga0070672_100335638 | 3300005543 | Unclassified | 1286 |
| 59 | Ga0070696_100000465 | 3300005546 | Bacteria | 25402 |
| 60 | Ga0070693_100089077 | 3300005547 | Bacteria | 1857 |
| 61 | Ga0068855_100117475 | 3300005563 | Unclassified | 3047 |
| 62 | Ga0070664_100006533 | 3300005564 | Bacteria | 9401 |
| 63 | Ga0070664_100036535 | 3300005564 | Bacteria | 4128 |
| 64 | Ga0070702_100296933 | 3300005615 | Unclassified | 1116 |
| 65 | Ga0068852_100050153 | 3300005616 | Unclassified | 3574 |
| 66 | Ga0068859_100539029 | 3300005617 | Bacteria | 1262 |
| 67 | Ga0068859_100632549 | 3300005617 | Bacteria | 1162 |
| 68 | Ga0068864_100296878 | 3300005618 | Bacteria | 1512 |
| 69 | Ga0068864_100346132 | 3300005618 | Bacteria | 1401 |
| 70 | Ga0068851_10036242 | 3300005834 | Bacteria | 2469 |
| 71 | Ga0068870_10014627 | 3300005840 | Bacteria | 3709 |
| 72 | Ga0068863_100281022 | 3300005841 | Bacteria | 1613 |
| 73 | Ga0068858_100117244 | 3300005842 | Bacteria | 2488 |
| 74 | Ga0068860_100471776 | 3300005843 | Unclassified | 1250 |
| 75 | Ga0068862_100081208 | 3300005844 | Unclassified | 2812 |
| 76 | Ga0081539_10000104 | 3300005985 | Bacteria | 197478 |
| 77 | Ga0068871_100694375 | 3300006358 | Bacteria | 932 |
| 78 | Ga0075434_100170563 | 3300006871 | Unclassified | 2196 |
| 79 | Ga0068865_100020831 | 3300006881 | Bacteria | 4258 |
| 80 | Ga0068865_100302954 | 3300006881 | Bacteria | 1280 |
| 81 | Ga0097620_100142405 | 3300006931 | Bacteria | 2471 |
| 82 | Ga0097620_100539048 | 3300006931 | Bacteria | 1262 |
| 83 | Ga0097620_100632524 | 3300006931 | Bacteria | 1162 |
| 84 | Ga0075435_100362001 | 3300007076 | Unclassified | 1244 |
| 85 | Ga0105245_10116762 | 3300009098 | Bacteria | 2488 |
| 86 | Ga0114129_10203079 | 3300009147 | Unclassified | 2683 |
| 87 | Ga0105243_10014476 | 3300009148 | Bacteria | 5969 |
| 88 | Ga0105243_10083465 | 3300009148 | Bacteria | 2614 |
| 89 | Ga0105242_10016274 | 3300009176 | Bacteria | 5782 |
| 90 | Ga0105248_10080235 | 3300009177 | Bacteria | 3667 |
| 91 | Ga0105248_10154456 | 3300009177 | Unclassified | 2590 |
| 92 | Ga0105248_10249759 | 3300009177 | Bacteria | 1997 |
| 93 | Ga0105248_10629919 | 3300009177 | Bacteria | 1210 |
| 94 | Ga0105237_10289674 | 3300009545 | Bacteria | 1640 |
| 95 | Ga0105239_10697328 | 3300010375 | Bacteria | 1161 |
| 96 | Ga0105246_10148064 | 3300011119 | Bacteria | 1774 |
| 97 | Ga0105246_10231136 | 3300011119 | Unclassified | 1456 |
| 98 | Ga0157370_10014099 | 3300013104 | Bacteria | 8198 |
| 99 | Ga0157370_10150843 | 3300013104 | Bacteria | 2163 |
| 100 | Ga0157369_10716936 | 3300013105 | Bacteria | 1030 |
| 101 | Ga0157378_10266904 | 3300013297 | Unclassified | 1644 |
| 102 | Ga0163162_10138930 | 3300013306 | Bacteria | 2542 |
| 103 | Ga0157372_10093652 | 3300013307 | Bacteria | 3419 |
| 104 | Ga0157372_10145864 | 3300013307 | Bacteria | 2729 |
| 105 | Ga0157375_10063599 | 3300013308 | Bacteria | 3672 |
| 106 | Ga0157375_10184439 | 3300013308 | Bacteria | 2239 |
| 107 | Ga0163163_10642475 | 3300014325 | Bacteria | 1125 |
| 108 | Ga0157377_10071351 | 3300014745 | Bacteria | 2008 |
| 109 | Ga0157379_10241554 | 3300014968 | Bacteria | 1638 |
| 110 | Ga0157376_10257678 | 3300014969 | Bacteria | 1632 |
| 111 | Ga0163161_10143257 | 3300017792 | Bacteria | 1811 |
| 112 | Ga0163161_10146925 | 3300017792 | Unclassified | 1789 |
| 113 | Ga0207697_10110755 | 3300025315 | Bacteria | 1175 |
| 114 | Ga0207656_10117139 | 3300025321 | Archaea | 1237 |
| 115 | Ga0207682_10005752 | 3300025893 | Bacteria | 5029 |
| 116 | Ga0207688_10031980 | 3300025901 | Bacteria | 2907 |
| 117 | Ga0207699_10014006 | 3300025906 | Bacteria | 4121 |
| 118 | Ga0207699_10096548 | 3300025906 | Bacteria | 1866 |
| 119 | Ga0207645_10037079 | 3300025907 | Bacteria | 3130 |
| 120 | Ga0207643_10010002 | 3300025908 | Bacteria | 5099 |
| 121 | Ga0207705_10041935 | 3300025909 | Bacteria | 3284 |
| 122 | Ga0207684_10066349 | 3300025910 | Unclassified | 3065 |
| 123 | Ga0207707_10004829 | 3300025912 | Bacteria | 11820 |
| 124 | Ga0207707_10096259 | 3300025912 | Bacteria | 2587 |
| 125 | Ga0207695_10121710 | 3300025913 | Bacteria | 2577 |
| 126 | Ga0207671_10174060 | 3300025914 | Bacteria | 1672 |
| 127 | Ga0207662_10002023 | 3300025918 | Bacteria | 10033 |
| 128 | Ga0207657_10248879 | 3300025919 | Bacteria | 1417 |
| 129 | Ga0207657_10329224 | 3300025919 | Unclassified | 1207 |
| 130 | Ga0207649_10034011 | 3300025920 | Bacteria | 3050 |
| 131 | Ga0207652_10001243 | 3300025921 | Bacteria | 22729 |
| 132 | Ga0207681_10203910 | 3300025923 | Bacteria | 1520 |
| 133 | Ga0207659_10004233 | 3300025926 | Bacteria | 8676 |
| 134 | Ga0207659_10114723 | 3300025926 | Bacteria | 2054 |
| 135 | Ga0207659_10135204 | 3300025926 | Bacteria | 1908 |
| 136 | Ga0207664_10056091 | 3300025929 | Unclassified | 3128 |
| 137 | Ga0207644_10329172 | 3300025931 | Bacteria | 1237 |
| 138 | Ga0207644_10464723 | 3300025931 | Unclassified | 1041 |
| 139 | Ga0207690_10068734 | 3300025932 | Bacteria | 2435 |
| 140 | Ga0207690_10254211 | 3300025932 | Bacteria | 1359 |
| 141 | Ga0207706_10033231 | 3300025933 | Bacteria | 4592 |
| 142 | Ga0207706_10113485 | 3300025933 | Bacteria | 2383 |
| 143 | Ga0207670_10288963 | 3300025936 | Unclassified | 1280 |
| 144 | Ga0207704_10109963 | 3300025938 | Bacteria | 1860 |
| 145 | Ga0207665_10146677 | 3300025939 | Bacteria | 1687 |
| 146 | Ga0207691_10069161 | 3300025940 | Bacteria | 3190 |
| 147 | Ga0207691_10072275 | 3300025940 | Bacteria | 3112 |
| 148 | Ga0207691_10147863 | 3300025940 | Unclassified | 2067 |
| 149 | Ga0207711_10095535 | 3300025941 | Bacteria | 2622 |
| 150 | Ga0207711_10196373 | 3300025941 | Bacteria | 1840 |
| 151 | Ga0207711_10202129 | 3300025941 | Bacteria | 1813 |
| 152 | Ga0207711_10403701 | 3300025941 | Bacteria | 1270 |
| 153 | Ga0207661_10000657 | 3300025944 | Bacteria | 22340 |
| 154 | Ga0207661_10040217 | 3300025944 | Bacteria | 3674 |
| 155 | Ga0207661_10047119 | 3300025944 | Bacteria | 3420 |
| 156 | Ga0207661_10123874 | 3300025944 | Unclassified | 2205 |
| 157 | Ga0207661_10258974 | 3300025944 | Archaea | 1549 |
| 158 | Ga0207661_10368370 | 3300025944 | Bacteria | 1299 |
| 159 | Ga0207679_10026507 | 3300025945 | Bacteria | 3997 |
| 160 | Ga0207679_10045214 | 3300025945 | Bacteria | 3183 |
| 161 | Ga0207679_10401843 | 3300025945 | Unclassified | 1205 |
| 162 | Ga0207679_10512711 | 3300025945 | Unclassified | 1071 |
| 163 | Ga0207667_10129945 | 3300025949 | Bacteria | 2594 |
| 164 | Ga0207651_10233908 | 3300025960 | Unclassified | 1494 |
| 165 | Ga0207668_10073226 | 3300025972 | Bacteria | 2454 |
| 166 | Ga0207658_10055601 | 3300025986 | Bacteria | 2934 |
| 167 | Ga0207658_10173742 | 3300025986 | Unclassified | 1778 |
| 168 | Ga0207677_10279921 | 3300026023 | Bacteria | 1369 |
| 169 | Ga0207703_10465649 | 3300026035 | Bacteria | 1183 |
| 170 | Ga0207708_10040380 | 3300026075 | Unclassified | 3558 |
| 171 | Ga0207702_10013303 | 3300026078 | Bacteria | 6843 |
| 172 | Ga0207641_10022232 | 3300026088 | Bacteria | 5220 |
| 173 | Ga0207648_10035257 | 3300026089 | Bacteria | 4408 |
| 174 | Ga0207676_10461896 | 3300026095 | Bacteria | 1199 |
| 175 | Ga0207676_10477958 | 3300026095 | Bacteria | 1180 |
| 176 | Ga0207674_10017940 | 3300026116 | Bacteria | 7712 |
| 177 | Ga0207675_100433236 | 3300026118 | Bacteria | 1300 |
| 178 | Ga0207683_10537135 | 3300026121 | Bacteria | 1081 |
| 179 | Ga0268266_10293122 | 3300028379 | Unclassified | 1516 |
| 180 | Ga0268265_10025106 | 3300028380 | Unclassified | 4225 |
| 181 | Ga0268265_10425597 | 3300028380 | Unclassified | 1234 |
| 182 | Ga0268264_10100722 | 3300028381 | Unclassified | 2510 |
| 183 | Ga0265320_10054599 | 3300031240 | Bacteria | 1927 |
| 184 | Ga0265314_10026326 | 3300031711 | Bacteria | 4371 |
| 185 | Ga0265342_10101658 | 3300031712 | Bacteria | 1636 |
| 186 | Ga0307413_10347647 | 3300031824 | Unclassified | 1143 |
| 187 | Ga0307410_10297969 | 3300031852 | Bacteria | 1271 |
| 188 | Ga0307406_10080109 | 3300031901 | Bacteria | 2167 |
| 189 | Ga0307407_10276478 | 3300031903 | Unclassified | 1161 |
| 190 | Ga0307412_10048679 | 3300031911 | Bacteria | 2789 |
| 191 | Ga0307409_100104572 | 3300031995 | Unclassified | 2358 |
| 192 | Ga0307409_100277435 | 3300031995 | Unclassified | 1547 |
| 193 | Ga0307411_10130172 | 3300032005 | Bacteria | 1838 |
| 194 | Ga0307411_10441314 | 3300032005 | Bacteria | 1086 |
| 195 | Ga0373931_0120507 | 3300035691 | Unclassified | 1499 |
| 196 | Ga0373937_0739833 | 3300036401 | Bacteria | 931 |
| 197 | Ga0436365_1242846 | 3300039437 | Bacteria | 3869 |
| 198 | Ga0436365_1563250 | 3300039437 | Bacteria | 1437 |
| 199 | Ga0436365_1617744 | 3300039437 | Bacteria | 3982 |
| 200 | Ga0466963_0181367 | 3300044694 | Unclassified | 1470 |
| 201 | Ga0466957_0058122 | 3300044842 | Bacteria | 2369 |
| 202 | Ga0466958_0137826 | 3300045836 | Bacteria | 1535 |
| 203 | Ga0466967_0017927 | 3300045976 | Bacteria | 5642 |
| 204 | Ga0466967_0018403 | 3300045976 | Bacteria | 5581 |
| 205 | Ga0495580_0163071 | 3300046472 | Bacteria | 1542 |
| 206 | Ga0495594_0042933 | 3300046499 | Bacteria | 2477 |
| 207 | Ga0495642_0136153 | 3300046528 | Bacteria | 1059 |
| 208 | Ga0495659_0061244 | 3300046664 | Bacteria | 1390 |
| 209 | Ga0495657_0388569 | 3300046675 | Bacteria | 822 |
| 210 | Ga0495672_0033715 | 3300047320 | Bacteria | 3170 |
| 211 | Ga0496106_0076557 | 3300048909 | Bacteria | 2565 |
| 212 | Ga0496110_0173338 | 3300048913 | Bacteria | 1958 |
| 213 | Ga0496112_0066886 | 3300048915 | Bacteria | 3546 |
| 214 | Ga0496113_0012080 | 3300048916 | Bacteria | 5792 |
| 215 | Ga0501033_0057515 | 3300049570 | Unclassified | 2874 |
| 216 | Ga0501034_0053947 | 3300049571 | Bacteria | 4047 |
| 217 | Ga0501036_0137643 | 3300049572 | Unclassified | 2061 |
| 218 | Ga0501047_0083975 | 3300049581 | Unclassified | 3061 |
| 219 | Ga0501047_0110109 | 3300049581 | Bacteria | 2637 |
| 220 | Ga0501044_0005534 | 3300049823 | Bacteria | 14018 |
| 221 | Ga0501044_0105679 | 3300049823 | Unclassified | 2828 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10181247 | Ga0070681_101812472 | 235 |
| 2 | 3300025906 | Ga0207699_10014006 | Ga0207699_100140065 | 235 |
| 3 | 3300025912 | Ga0207707_10096259 | Ga0207707_100962592 | 235 |
| 4 | 3300025939 | Ga0207665_10146677 | Ga0207665_101466772 | 235 |
| 5 | 3300013104 | Ga0157370_10014099 | Ga0157370_100140994 | 237 |
| 6 | 3300014969 | Ga0157376_10257678 | Ga0157376_102576782 | 238 |
| 7 | 3300009147 | Ga0114129_10203079 | Ga0114129_102030792 | 240 |
| 8 | 3300005457 | Ga0070662_100330569 | Ga0070662_1003305692 | 248 |
| 9 | 3300010375 | Ga0105239_10697328 | Ga0105239_106973281 | 248 |
| 10 | 3300025923 | Ga0207681_10203910 | Ga0207681_102039102 | 248 |
| 11 | 3300025933 | Ga0207706_10113485 | Ga0207706_101134851 | 248 |
| 12 | 3300026118 | Ga0207675_100433236 | Ga0207675_1004332361 | 248 |
| 13 | 3300035691 | Ga0373931_0120507 | Ga0373931_0120507_456_1202 | 248 |
| 14 | 3300005434 | Ga0070709_10424883 | Ga0070709_104248831 | 250 |
| 15 | 3300031240 | Ga0265320_10054599 | Ga0265320_100545993 | 251 |
| 16 | 3300031711 | Ga0265314_10026326 | Ga0265314_100263264 | 251 |
| 17 | 3300031712 | Ga0265342_10101658 | Ga0265342_101016581 | 251 |
| 18 | 3300005327 | Ga0070658_10156495 | Ga0070658_101564953 | 252 |
| 19 | 3300005328 | Ga0070676_10004100 | Ga0070676_100041004 | 252 |
| 20 | 3300005406 | Ga0070703_10062892 | Ga0070703_100628922 | 252 |
| 21 | 3300005434 | Ga0070709_10060227 | Ga0070709_100602272 | 252 |
| 22 | 3300005471 | Ga0070698_100430228 | Ga0070698_1004302282 | 252 |
| 23 | 3300005547 | Ga0070693_100089077 | Ga0070693_1000890772 | 252 |
| 24 | 3300025906 | Ga0207699_10096548 | Ga0207699_100965482 | 252 |
| 25 | 3300049572 | Ga0501036_0137643 | Ga0501036_0137643_162_959 | 252 |
| 26 | 3300005327 | Ga0070658_10024239 | Ga0070658_100242391 | 253 |
| 27 | 3300005327 | Ga0070658_10160984 | Ga0070658_101609842 | 253 |
| 28 | 3300005327 | Ga0070658_10234948 | Ga0070658_102349482 | 253 |
| 29 | 3300005328 | Ga0070676_10046244 | Ga0070676_100462442 | 253 |
| 30 | 3300005329 | Ga0070683_100002518 | Ga0070683_10000251811 | 253 |
| 31 | 3300005329 | Ga0070683_100017550 | Ga0070683_1000175502 | 253 |
| 32 | 3300005329 | Ga0070683_100028663 | Ga0070683_1000286633 | 253 |
| 33 | 3300005329 | Ga0070683_100150375 | Ga0070683_1001503752 | 253 |
| 34 | 3300005329 | Ga0070683_100204343 | Ga0070683_1002043431 | 253 |
| 35 | 3300005330 | Ga0070690_100113265 | Ga0070690_1001132652 | 253 |
| 36 | 3300005331 | Ga0070670_100384750 | Ga0070670_1003847501 | 253 |
| 37 | 3300005333 | Ga0070677_10063542 | Ga0070677_100635422 | 253 |
| 38 | 3300005336 | Ga0070680_100064595 | Ga0070680_1000645952 | 253 |
| 39 | 3300005339 | Ga0070660_100086434 | Ga0070660_1000864343 | 253 |
| 40 | 3300005339 | Ga0070660_100311034 | Ga0070660_1003110341 | 253 |
| 41 | 3300005343 | Ga0070687_100014559 | Ga0070687_1000145593 | 253 |
| 42 | 3300005344 | Ga0070661_100136236 | Ga0070661_1001362362 | 253 |
| 43 | 3300005347 | Ga0070668_100519689 | Ga0070668_1005196891 | 253 |
| 44 | 3300005353 | Ga0070669_100001331 | Ga0070669_1000013311 | 253 |
| 45 | 3300005354 | Ga0070675_100007872 | Ga0070675_1000078727 | 253 |
| 46 | 3300005354 | Ga0070675_100070422 | Ga0070675_1000704223 | 253 |
| 47 | 3300005354 | Ga0070675_100076789 | Ga0070675_1000767891 | 253 |
| 48 | 3300005354 | Ga0070675_100087374 | Ga0070675_1000873742 | 253 |
| 49 | 3300005354 | Ga0070675_100650170 | Ga0070675_1006501701 | 253 |
| 50 | 3300005355 | Ga0070671_100052651 | Ga0070671_1000526511 | 253 |
| 51 | 3300005355 | Ga0070671_100765688 | Ga0070671_1007656881 | 253 |
| 52 | 3300005364 | Ga0070673_100325529 | Ga0070673_1003255291 | 253 |
| 53 | 3300005364 | Ga0070673_100384119 | Ga0070673_1003841192 | 253 |
| 54 | 3300005365 | Ga0070688_100014483 | Ga0070688_1000144833 | 253 |
| 55 | 3300005365 | Ga0070688_100277972 | Ga0070688_1002779722 | 253 |
| 56 | 3300005366 | Ga0070659_100041186 | Ga0070659_1000411863 | 253 |
| 57 | 3300005366 | Ga0070659_100079480 | Ga0070659_1000794803 | 253 |
| 58 | 3300005367 | Ga0070667_100140079 | Ga0070667_1001400793 | 253 |
| 59 | 3300005435 | Ga0070714_100081467 | Ga0070714_1000814672 | 253 |
| 60 | 3300005456 | Ga0070678_100506066 | Ga0070678_1005060661 | 253 |
| 61 | 3300005456 | Ga0070678_100798130 | Ga0070678_1007981301 | 253 |
| 62 | 3300005458 | Ga0070681_10036586 | Ga0070681_100365863 | 253 |
| 63 | 3300005458 | Ga0070681_10198989 | Ga0070681_101989892 | 253 |
| 64 | 3300005458 | Ga0070681_10393978 | Ga0070681_103939782 | 253 |
| 65 | 3300005466 | Ga0070685_10022653 | Ga0070685_100226532 | 253 |
| 66 | 3300005467 | Ga0070706_100024495 | Ga0070706_1000244953 | 253 |
| 67 | 3300005530 | Ga0070679_100001774 | Ga0070679_1000017747 | 253 |
| 68 | 3300005530 | Ga0070679_100134090 | Ga0070679_1001340902 | 253 |
| 69 | 3300005530 | Ga0070679_100554687 | Ga0070679_1005546872 | 253 |
| 70 | 3300005535 | Ga0070684_100017084 | Ga0070684_1000170846 | 253 |
| 71 | 3300005535 | Ga0070684_100079278 | Ga0070684_1000792783 | 253 |
| 72 | 3300005535 | Ga0070684_100215580 | Ga0070684_1002155802 | 253 |
| 73 | 3300005536 | Ga0070697_100329530 | Ga0070697_1003295302 | 253 |
| 74 | 3300005543 | Ga0070672_100237547 | Ga0070672_1002375471 | 253 |
| 75 | 3300005543 | Ga0070672_100335638 | Ga0070672_1003356382 | 253 |
| 76 | 3300005546 | Ga0070696_100000465 | Ga0070696_10000046513 | 253 |
| 77 | 3300005563 | Ga0068855_100117475 | Ga0068855_1001174752 | 253 |
| 78 | 3300005564 | Ga0070664_100006533 | Ga0070664_1000065336 | 253 |
| 79 | 3300005564 | Ga0070664_100036535 | Ga0070664_1000365352 | 253 |
| 80 | 3300005615 | Ga0070702_100296933 | Ga0070702_1002969332 | 253 |
| 81 | 3300005616 | Ga0068852_100050153 | Ga0068852_1000501533 | 253 |
| 82 | 3300005617 | Ga0068859_100539029 | Ga0068859_1005390292 | 253 |
| 83 | 3300005617 | Ga0068859_100632549 | Ga0068859_1006325492 | 253 |
| 84 | 3300005618 | Ga0068864_100296878 | Ga0068864_1002968782 | 253 |
| 85 | 3300005618 | Ga0068864_100346132 | Ga0068864_1003461321 | 253 |
| 86 | 3300005834 | Ga0068851_10036242 | Ga0068851_100362423 | 253 |
| 87 | 3300005840 | Ga0068870_10014627 | Ga0068870_100146274 | 253 |
| 88 | 3300005841 | Ga0068863_100281022 | Ga0068863_1002810222 | 253 |
| 89 | 3300005842 | Ga0068858_100117244 | Ga0068858_1001172442 | 253 |
| 90 | 3300005843 | Ga0068860_100471776 | Ga0068860_1004717761 | 253 |
| 91 | 3300005844 | Ga0068862_100081208 | Ga0068862_1000812083 | 253 |
| 92 | 3300005985 | Ga0081539_10000104 | Ga0081539_1000010424 | 253 |
| 93 | 3300006358 | Ga0068871_100694375 | Ga0068871_1006943752 | 253 |
| 94 | 3300006871 | Ga0075434_100170563 | Ga0075434_1001705631 | 253 |
| 95 | 3300006881 | Ga0068865_100020831 | Ga0068865_1000208312 | 253 |
| 96 | 3300006881 | Ga0068865_100302954 | Ga0068865_1003029542 | 253 |
| 97 | 3300006931 | Ga0097620_100142405 | Ga0097620_1001424052 | 253 |
| 98 | 3300006931 | Ga0097620_100539048 | Ga0097620_1005390482 | 253 |
| 99 | 3300006931 | Ga0097620_100632524 | Ga0097620_1006325242 | 253 |
| 100 | 3300007076 | Ga0075435_100362001 | Ga0075435_1003620012 | 253 |
| 101 | 3300009098 | Ga0105245_10116762 | Ga0105245_101167621 | 253 |
| 102 | 3300009148 | Ga0105243_10014476 | Ga0105243_100144763 | 253 |
| 103 | 3300009148 | Ga0105243_10083465 | Ga0105243_100834653 | 253 |
| 104 | 3300009176 | Ga0105242_10016274 | Ga0105242_100162744 | 253 |
| 105 | 3300009177 | Ga0105248_10080235 | Ga0105248_100802353 | 253 |
| 106 | 3300009177 | Ga0105248_10154456 | Ga0105248_101544562 | 253 |
| 107 | 3300009177 | Ga0105248_10249759 | Ga0105248_102497592 | 253 |
| 108 | 3300009177 | Ga0105248_10629919 | Ga0105248_106299191 | 253 |
| 109 | 3300009545 | Ga0105237_10289674 | Ga0105237_102896741 | 253 |
| 110 | 3300011119 | Ga0105246_10148064 | Ga0105246_101480642 | 253 |
| 111 | 3300011119 | Ga0105246_10231136 | Ga0105246_102311361 | 253 |
| 112 | 3300013104 | Ga0157370_10150843 | Ga0157370_101508432 | 253 |
| 113 | 3300013105 | Ga0157369_10716936 | Ga0157369_107169362 | 253 |
| 114 | 3300013297 | Ga0157378_10266904 | Ga0157378_102669042 | 253 |
| 115 | 3300013306 | Ga0163162_10138930 | Ga0163162_101389303 | 253 |
| 116 | 3300013307 | Ga0157372_10093652 | Ga0157372_100936524 | 253 |
| 117 | 3300013307 | Ga0157372_10145864 | Ga0157372_101458642 | 253 |
| 118 | 3300013308 | Ga0157375_10063599 | Ga0157375_100635993 | 253 |
| 119 | 3300013308 | Ga0157375_10184439 | Ga0157375_101844391 | 253 |
| 120 | 3300014325 | Ga0163163_10642475 | Ga0163163_106424751 | 253 |
| 121 | 3300014745 | Ga0157377_10071351 | Ga0157377_100713512 | 253 |
| 122 | 3300014968 | Ga0157379_10241554 | Ga0157379_102415542 | 253 |
| 123 | 3300017792 | Ga0163161_10143257 | Ga0163161_101432572 | 253 |
| 124 | 3300017792 | Ga0163161_10146925 | Ga0163161_101469252 | 253 |
| 125 | 3300025315 | Ga0207697_10110755 | Ga0207697_101107552 | 253 |
| 126 | 3300025321 | Ga0207656_10117139 | Ga0207656_101171392 | 253 |
| 127 | 3300025893 | Ga0207682_10005752 | Ga0207682_100057523 | 253 |
| 128 | 3300025901 | Ga0207688_10031980 | Ga0207688_100319802 | 253 |
| 129 | 3300025907 | Ga0207645_10037079 | Ga0207645_100370792 | 253 |
| 130 | 3300025908 | Ga0207643_10010002 | Ga0207643_100100023 | 253 |
| 131 | 3300025909 | Ga0207705_10041935 | Ga0207705_100419354 | 253 |
| 132 | 3300025910 | Ga0207684_10066349 | Ga0207684_100663493 | 253 |
| 133 | 3300025912 | Ga0207707_10004829 | Ga0207707_100048297 | 253 |
| 134 | 3300025913 | Ga0207695_10121710 | Ga0207695_101217102 | 253 |
| 135 | 3300025914 | Ga0207671_10174060 | Ga0207671_101740602 | 253 |
| 136 | 3300025918 | Ga0207662_10002023 | Ga0207662_100020234 | 253 |
| 137 | 3300025919 | Ga0207657_10248879 | Ga0207657_102488792 | 253 |
| 138 | 3300025919 | Ga0207657_10329224 | Ga0207657_103292242 | 253 |
| 139 | 3300025920 | Ga0207649_10034011 | Ga0207649_100340112 | 253 |
| 140 | 3300025921 | Ga0207652_10001243 | Ga0207652_1000124323 | 253 |
| 141 | 3300025926 | Ga0207659_10004233 | Ga0207659_100042334 | 253 |
| 142 | 3300025926 | Ga0207659_10114723 | Ga0207659_101147233 | 253 |
| 143 | 3300025926 | Ga0207659_10135204 | Ga0207659_101352042 | 253 |
| 144 | 3300025929 | Ga0207664_10056091 | Ga0207664_100560912 | 253 |
| 145 | 3300025931 | Ga0207644_10329172 | Ga0207644_103291722 | 253 |
| 146 | 3300025931 | Ga0207644_10464723 | Ga0207644_104647231 | 253 |
| 147 | 3300025932 | Ga0207690_10068734 | Ga0207690_100687344 | 253 |
| 148 | 3300025932 | Ga0207690_10254211 | Ga0207690_102542112 | 253 |
| 149 | 3300025933 | Ga0207706_10033231 | Ga0207706_100332312 | 253 |
| 150 | 3300025936 | Ga0207670_10288963 | Ga0207670_102889632 | 253 |
| 151 | 3300025938 | Ga0207704_10109963 | Ga0207704_101099633 | 253 |
| 152 | 3300025940 | Ga0207691_10069161 | Ga0207691_100691614 | 253 |
| 153 | 3300025940 | Ga0207691_10072275 | Ga0207691_100722754 | 253 |
| 154 | 3300025940 | Ga0207691_10147863 | Ga0207691_101478632 | 253 |
| 155 | 3300025941 | Ga0207711_10095535 | Ga0207711_100955353 | 253 |
| 156 | 3300025941 | Ga0207711_10196373 | Ga0207711_101963732 | 253 |
| 157 | 3300025941 | Ga0207711_10202129 | Ga0207711_102021292 | 253 |
| 158 | 3300025941 | Ga0207711_10403701 | Ga0207711_104037011 | 253 |
| 159 | 3300025944 | Ga0207661_10000657 | Ga0207661_1000065715 | 253 |
| 160 | 3300025944 | Ga0207661_10040217 | Ga0207661_100402171 | 253 |
| 161 | 3300025944 | Ga0207661_10047119 | Ga0207661_100471192 | 253 |
| 162 | 3300025944 | Ga0207661_10123874 | Ga0207661_101238742 | 253 |
| 163 | 3300025944 | Ga0207661_10258974 | Ga0207661_102589742 | 253 |
| 164 | 3300025944 | Ga0207661_10368370 | Ga0207661_103683702 | 253 |
| 165 | 3300025945 | Ga0207679_10026507 | Ga0207679_100265072 | 253 |
| 166 | 3300025945 | Ga0207679_10045214 | Ga0207679_100452143 | 253 |
| 167 | 3300025945 | Ga0207679_10401843 | Ga0207679_104018432 | 253 |
| 168 | 3300025945 | Ga0207679_10512711 | Ga0207679_105127112 | 253 |
| 169 | 3300025949 | Ga0207667_10129945 | Ga0207667_101299453 | 253 |
| 170 | 3300025960 | Ga0207651_10233908 | Ga0207651_102339082 | 253 |
| 171 | 3300025972 | Ga0207668_10073226 | Ga0207668_100732262 | 253 |
| 172 | 3300025986 | Ga0207658_10055601 | Ga0207658_100556013 | 253 |
| 173 | 3300025986 | Ga0207658_10173742 | Ga0207658_101737421 | 253 |
| 174 | 3300026023 | Ga0207677_10279921 | Ga0207677_102799211 | 253 |
| 175 | 3300026035 | Ga0207703_10465649 | Ga0207703_104656491 | 253 |
| 176 | 3300026075 | Ga0207708_10040380 | Ga0207708_100403802 | 253 |
| 177 | 3300026078 | Ga0207702_10013303 | Ga0207702_100133033 | 253 |
| 178 | 3300026088 | Ga0207641_10022232 | Ga0207641_100222326 | 253 |
| 179 | 3300026089 | Ga0207648_10035257 | Ga0207648_100352574 | 253 |
| 180 | 3300026095 | Ga0207676_10461896 | Ga0207676_104618961 | 253 |
| 181 | 3300026095 | Ga0207676_10477958 | Ga0207676_104779582 | 253 |
| 182 | 3300026116 | Ga0207674_10017940 | Ga0207674_100179403 | 253 |
| 183 | 3300026121 | Ga0207683_10537135 | Ga0207683_105371352 | 253 |
| 184 | 3300028379 | Ga0268266_10293122 | Ga0268266_102931222 | 253 |
| 185 | 3300028380 | Ga0268265_10025106 | Ga0268265_100251063 | 253 |
| 186 | 3300028380 | Ga0268265_10425597 | Ga0268265_104255972 | 253 |
| 187 | 3300028381 | Ga0268264_10100722 | Ga0268264_101007223 | 253 |
| 188 | 3300031824 | Ga0307413_10347647 | Ga0307413_103476471 | 253 |
| 189 | 3300031852 | Ga0307410_10297969 | Ga0307410_102979691 | 253 |
| 190 | 3300031901 | Ga0307406_10080109 | Ga0307406_100801092 | 253 |
| 191 | 3300031903 | Ga0307407_10276478 | Ga0307407_102764782 | 253 |
| 192 | 3300031911 | Ga0307412_10048679 | Ga0307412_100486793 | 253 |
| 193 | 3300031995 | Ga0307409_100104572 | Ga0307409_1001045722 | 253 |
| 194 | 3300031995 | Ga0307409_100277435 | Ga0307409_1002774352 | 253 |
| 195 | 3300032005 | Ga0307411_10130172 | Ga0307411_101301722 | 253 |
| 196 | 3300032005 | Ga0307411_10441314 | Ga0307411_104413141 | 253 |
| 197 | 3300036401 | Ga0373937_0739833 | Ga0373937_0739833_75_836 | 253 |
| 198 | 3300039437 | Ga0436365_1242846 | Ga0436365_1242846_2655_3443 | 253 |
| 199 | 3300039437 | Ga0436365_1563250 | Ga0436365_1563250_562_1329 | 253 |
| 200 | 3300039437 | Ga0436365_1617744 | Ga0436365_1617744_2809_3612 | 253 |
| 201 | 3300044694 | Ga0466963_0181367 | Ga0466963_0181367_571_1371 | 253 |
| 202 | 3300044842 | Ga0466957_0058122 | Ga0466957_0058122_1360_2136 | 253 |
| 203 | 3300045836 | Ga0466958_0137826 | Ga0466958_0137826_601_1362 | 253 |
| 204 | 3300045976 | Ga0466967_0017927 | Ga0466967_0017927_49_825 | 253 |
| 205 | 3300045976 | Ga0466967_0018403 | Ga0466967_0018403_1982_2782 | 253 |
| 206 | 3300046472 | Ga0495580_0163071 | Ga0495580_0163071_692_1471 | 253 |
| 207 | 3300046499 | Ga0495594_0042933 | Ga0495594_0042933_1184_1963 | 253 |
| 208 | 3300046528 | Ga0495642_0136153 | Ga0495642_0136153_102_863 | 253 |
| 209 | 3300046664 | Ga0495659_0061244 | Ga0495659_0061244_328_1089 | 253 |
| 210 | 3300046675 | Ga0495657_0388569 | Ga0495657_0388569_38_799 | 253 |
| 211 | 3300047320 | Ga0495672_0033715 | Ga0495672_0033715_1901_2677 | 253 |
| 212 | 3300048909 | Ga0496106_0076557 | Ga0496106_0076557_653_1414 | 253 |
| 213 | 3300048913 | Ga0496110_0173338 | Ga0496110_0173338_1141_1902 | 253 |
| 214 | 3300048915 | Ga0496112_0066886 | Ga0496112_0066886_265_1026 | 253 |
| 215 | 3300048916 | Ga0496113_0012080 | Ga0496113_0012080_325_1086 | 253 |
| 216 | 3300049570 | Ga0501033_0057515 | Ga0501033_0057515_1092_1856 | 253 |
| 217 | 3300049571 | Ga0501034_0053947 | Ga0501034_0053947_38_802 | 253 |
| 218 | 3300049581 | Ga0501047_0083975 | Ga0501047_0083975_1075_1839 | 253 |
| 219 | 3300049581 | Ga0501047_0110109 | Ga0501047_0110109_754_1515 | 253 |
| 220 | 3300049823 | Ga0501044_0005534 | Ga0501044_0005534_9604_10368 | 253 |
| 221 | 3300049823 | Ga0501044_0105679 | Ga0501044_0105679_13_867 | 253 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h0t-assembly1.cif.gz_A-2 | crystal structure of mnmm from b. subtilis complexed with sah (1.17 a) | 0.7659 | 147 | 190 |
| 4ign-assembly2.cif.gz_B | 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd | 0.7162 | 20 | 224 |
| 7pwy-assembly2.cif.gz_C | structure of human dimeric acmsd in complex with the inhibitor tes-1025 | 0.7135 | 2 | 224 |
| 4ofc-assembly1.cif.gz_A | 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase | 0.7117 | 2 | 234 |
| 2hbx-assembly1.cif.gz_A | crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd) | 0.7114 | 20 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y3Q7_2_272_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7195 | 9 | 241 | 3.20.20.140 |
| 4eraA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7195 | 20 | 225 | 3.20.20.140 |
| 4infC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7098 | 25 | 234 | 3.20.20.140 |
| 3ij6C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7093 | 24 | 236 | 3.20.20.140 |
| 1gkpA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7025 | 2 | 191 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0LE30-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9329 | 52 | 235 |
|
| AF-A0A7Y5QQE3-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9194 | 99 | 251 |
|
| AF-A0A1G0LE30-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9184 | 52 | 235 |
|
| AF-A0A7V9TK81-F1-model_v4 | Amidohydrolase family protein | 0.917 | 2 | 246 |
GO:0016787
|
| AF-A0A7Y5QQE3-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9137 | 99 | 251 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar