F332961

General Info

Members Datasets Scaffolds Average Seq Length
221 148 221 256

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100002518|Ga0070683_10000251811
Length 266
Sequence MPVIDVNALIGPYPFRYVPHPDPEVLVRVLDREGIDSAWVGHLPSAFYRDPTPGNRELFAKLSAFSNRLVPVPAIRPDWPKWDVALRDAASAGAVAVRVYPPQWGMGPHDASLRELAIAAGEHGMATLLTVRFEDLRQRHPMDSAGDLSAAAIRALARAGDAVRLVVTAAGREMIEEVHWGLTPGEQARVFWDISWIWGPPEDHLGKLFRTIGSERFVFGTHWPLRLTQTPSANLDLLPDDLLGMSLADARGICATRRPSPVAHPP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10024239 3300005327 Bacteria 4868
2 Ga0070658_10156495 3300005327 Unclassified 1911
3 Ga0070658_10160984 3300005327 Unclassified 1883
4 Ga0070658_10234948 3300005327 Bacteria 1553
5 Ga0070676_10004100 3300005328 Bacteria 7654
6 Ga0070676_10046244 3300005328 Bacteria 2537
7 Ga0070683_100002518 3300005329 Bacteria 14604
8 Ga0070683_100017550 3300005329 Bacteria 6327
9 Ga0070683_100028663 3300005329 Bacteria 5034
10 Ga0070683_100150375 3300005329 Unclassified 2207
11 Ga0070683_100204343 3300005329 Archaea 1876
12 Ga0070690_100113265 3300005330 Bacteria 1813
13 Ga0070670_100384750 3300005331 Bacteria 1236
14 Ga0070677_10063542 3300005333 Bacteria 1531
15 Ga0070680_100064595 3300005336 Unclassified 3000
16 Ga0070660_100086434 3300005339 Unclassified 2467
17 Ga0070660_100311034 3300005339 Bacteria 1293
18 Ga0070687_100014559 3300005343 Bacteria 3535
19 Ga0070661_100136236 3300005344 Unclassified 1848
20 Ga0070668_100519689 3300005347 Bacteria 1033
21 Ga0070669_100001331 3300005353 Bacteria 17816
22 Ga0070675_100007872 3300005354 Bacteria 8259
23 Ga0070675_100070422 3300005354 Bacteria 2898
24 Ga0070675_100076789 3300005354 Bacteria 2779
25 Ga0070675_100087374 3300005354 Bacteria 2607
26 Ga0070675_100650170 3300005354 Unclassified 958
27 Ga0070671_100052651 3300005355 Bacteria 3384
28 Ga0070671_100765688 3300005355 Unclassified 839
29 Ga0070673_100325529 3300005364 Bacteria 1358
30 Ga0070673_100384119 3300005364 Bacteria 1252
31 Ga0070688_100014483 3300005365 Unclassified 4469
32 Ga0070688_100277972 3300005365 Unclassified 1202
33 Ga0070659_100041186 3300005366 Unclassified 3609
34 Ga0070659_100079480 3300005366 Bacteria 2618
35 Ga0070667_100140079 3300005367 Bacteria 2117
36 Ga0070703_10062892 3300005406 Bacteria 1219
37 Ga0070709_10060227 3300005434 Bacteria 2412
38 Ga0070709_10424883 3300005434 Bacteria 997
39 Ga0070714_100081467 3300005435 Bacteria 2818
40 Ga0070678_100506066 3300005456 Bacteria 1066
41 Ga0070678_100798130 3300005456 Bacteria 857
42 Ga0070662_100330569 3300005457 Bacteria 1245
43 Ga0070681_10036586 3300005458 Unclassified 4929
44 Ga0070681_10181247 3300005458 Bacteria 2028
45 Ga0070681_10198989 3300005458 Unclassified 1922
46 Ga0070681_10393978 3300005458 Unclassified 1296
47 Ga0070685_10022653 3300005466 Bacteria 3428
48 Ga0070706_100024495 3300005467 Bacteria 5556
49 Ga0070698_100430228 3300005471 Unclassified 1255
50 Ga0070679_100001774 3300005530 Bacteria 19432
51 Ga0070679_100134090 3300005530 Bacteria 2457
52 Ga0070679_100554687 3300005530 Unclassified 1093
53 Ga0070684_100017084 3300005535 Bacteria 5947
54 Ga0070684_100079278 3300005535 Bacteria 2903
55 Ga0070684_100215580 3300005535 Archaea 1750
56 Ga0070697_100329530 3300005536 Unclassified 1316
57 Ga0070672_100237547 3300005543 Unclassified 1532
58 Ga0070672_100335638 3300005543 Unclassified 1286
59 Ga0070696_100000465 3300005546 Bacteria 25402
60 Ga0070693_100089077 3300005547 Bacteria 1857
61 Ga0068855_100117475 3300005563 Unclassified 3047
62 Ga0070664_100006533 3300005564 Bacteria 9401
63 Ga0070664_100036535 3300005564 Bacteria 4128
64 Ga0070702_100296933 3300005615 Unclassified 1116
65 Ga0068852_100050153 3300005616 Unclassified 3574
66 Ga0068859_100539029 3300005617 Bacteria 1262
67 Ga0068859_100632549 3300005617 Bacteria 1162
68 Ga0068864_100296878 3300005618 Bacteria 1512
69 Ga0068864_100346132 3300005618 Bacteria 1401
70 Ga0068851_10036242 3300005834 Bacteria 2469
71 Ga0068870_10014627 3300005840 Bacteria 3709
72 Ga0068863_100281022 3300005841 Bacteria 1613
73 Ga0068858_100117244 3300005842 Bacteria 2488
74 Ga0068860_100471776 3300005843 Unclassified 1250
75 Ga0068862_100081208 3300005844 Unclassified 2812
76 Ga0081539_10000104 3300005985 Bacteria 197478
77 Ga0068871_100694375 3300006358 Bacteria 932
78 Ga0075434_100170563 3300006871 Unclassified 2196
79 Ga0068865_100020831 3300006881 Bacteria 4258
80 Ga0068865_100302954 3300006881 Bacteria 1280
81 Ga0097620_100142405 3300006931 Bacteria 2471
82 Ga0097620_100539048 3300006931 Bacteria 1262
83 Ga0097620_100632524 3300006931 Bacteria 1162
84 Ga0075435_100362001 3300007076 Unclassified 1244
85 Ga0105245_10116762 3300009098 Bacteria 2488
86 Ga0114129_10203079 3300009147 Unclassified 2683
87 Ga0105243_10014476 3300009148 Bacteria 5969
88 Ga0105243_10083465 3300009148 Bacteria 2614
89 Ga0105242_10016274 3300009176 Bacteria 5782
90 Ga0105248_10080235 3300009177 Bacteria 3667
91 Ga0105248_10154456 3300009177 Unclassified 2590
92 Ga0105248_10249759 3300009177 Bacteria 1997
93 Ga0105248_10629919 3300009177 Bacteria 1210
94 Ga0105237_10289674 3300009545 Bacteria 1640
95 Ga0105239_10697328 3300010375 Bacteria 1161
96 Ga0105246_10148064 3300011119 Bacteria 1774
97 Ga0105246_10231136 3300011119 Unclassified 1456
98 Ga0157370_10014099 3300013104 Bacteria 8198
99 Ga0157370_10150843 3300013104 Bacteria 2163
100 Ga0157369_10716936 3300013105 Bacteria 1030
101 Ga0157378_10266904 3300013297 Unclassified 1644
102 Ga0163162_10138930 3300013306 Bacteria 2542
103 Ga0157372_10093652 3300013307 Bacteria 3419
104 Ga0157372_10145864 3300013307 Bacteria 2729
105 Ga0157375_10063599 3300013308 Bacteria 3672
106 Ga0157375_10184439 3300013308 Bacteria 2239
107 Ga0163163_10642475 3300014325 Bacteria 1125
108 Ga0157377_10071351 3300014745 Bacteria 2008
109 Ga0157379_10241554 3300014968 Bacteria 1638
110 Ga0157376_10257678 3300014969 Bacteria 1632
111 Ga0163161_10143257 3300017792 Bacteria 1811
112 Ga0163161_10146925 3300017792 Unclassified 1789
113 Ga0207697_10110755 3300025315 Bacteria 1175
114 Ga0207656_10117139 3300025321 Archaea 1237
115 Ga0207682_10005752 3300025893 Bacteria 5029
116 Ga0207688_10031980 3300025901 Bacteria 2907
117 Ga0207699_10014006 3300025906 Bacteria 4121
118 Ga0207699_10096548 3300025906 Bacteria 1866
119 Ga0207645_10037079 3300025907 Bacteria 3130
120 Ga0207643_10010002 3300025908 Bacteria 5099
121 Ga0207705_10041935 3300025909 Bacteria 3284
122 Ga0207684_10066349 3300025910 Unclassified 3065
123 Ga0207707_10004829 3300025912 Bacteria 11820
124 Ga0207707_10096259 3300025912 Bacteria 2587
125 Ga0207695_10121710 3300025913 Bacteria 2577
126 Ga0207671_10174060 3300025914 Bacteria 1672
127 Ga0207662_10002023 3300025918 Bacteria 10033
128 Ga0207657_10248879 3300025919 Bacteria 1417
129 Ga0207657_10329224 3300025919 Unclassified 1207
130 Ga0207649_10034011 3300025920 Bacteria 3050
131 Ga0207652_10001243 3300025921 Bacteria 22729
132 Ga0207681_10203910 3300025923 Bacteria 1520
133 Ga0207659_10004233 3300025926 Bacteria 8676
134 Ga0207659_10114723 3300025926 Bacteria 2054
135 Ga0207659_10135204 3300025926 Bacteria 1908
136 Ga0207664_10056091 3300025929 Unclassified 3128
137 Ga0207644_10329172 3300025931 Bacteria 1237
138 Ga0207644_10464723 3300025931 Unclassified 1041
139 Ga0207690_10068734 3300025932 Bacteria 2435
140 Ga0207690_10254211 3300025932 Bacteria 1359
141 Ga0207706_10033231 3300025933 Bacteria 4592
142 Ga0207706_10113485 3300025933 Bacteria 2383
143 Ga0207670_10288963 3300025936 Unclassified 1280
144 Ga0207704_10109963 3300025938 Bacteria 1860
145 Ga0207665_10146677 3300025939 Bacteria 1687
146 Ga0207691_10069161 3300025940 Bacteria 3190
147 Ga0207691_10072275 3300025940 Bacteria 3112
148 Ga0207691_10147863 3300025940 Unclassified 2067
149 Ga0207711_10095535 3300025941 Bacteria 2622
150 Ga0207711_10196373 3300025941 Bacteria 1840
151 Ga0207711_10202129 3300025941 Bacteria 1813
152 Ga0207711_10403701 3300025941 Bacteria 1270
153 Ga0207661_10000657 3300025944 Bacteria 22340
154 Ga0207661_10040217 3300025944 Bacteria 3674
155 Ga0207661_10047119 3300025944 Bacteria 3420
156 Ga0207661_10123874 3300025944 Unclassified 2205
157 Ga0207661_10258974 3300025944 Archaea 1549
158 Ga0207661_10368370 3300025944 Bacteria 1299
159 Ga0207679_10026507 3300025945 Bacteria 3997
160 Ga0207679_10045214 3300025945 Bacteria 3183
161 Ga0207679_10401843 3300025945 Unclassified 1205
162 Ga0207679_10512711 3300025945 Unclassified 1071
163 Ga0207667_10129945 3300025949 Bacteria 2594
164 Ga0207651_10233908 3300025960 Unclassified 1494
165 Ga0207668_10073226 3300025972 Bacteria 2454
166 Ga0207658_10055601 3300025986 Bacteria 2934
167 Ga0207658_10173742 3300025986 Unclassified 1778
168 Ga0207677_10279921 3300026023 Bacteria 1369
169 Ga0207703_10465649 3300026035 Bacteria 1183
170 Ga0207708_10040380 3300026075 Unclassified 3558
171 Ga0207702_10013303 3300026078 Bacteria 6843
172 Ga0207641_10022232 3300026088 Bacteria 5220
173 Ga0207648_10035257 3300026089 Bacteria 4408
174 Ga0207676_10461896 3300026095 Bacteria 1199
175 Ga0207676_10477958 3300026095 Bacteria 1180
176 Ga0207674_10017940 3300026116 Bacteria 7712
177 Ga0207675_100433236 3300026118 Bacteria 1300
178 Ga0207683_10537135 3300026121 Bacteria 1081
179 Ga0268266_10293122 3300028379 Unclassified 1516
180 Ga0268265_10025106 3300028380 Unclassified 4225
181 Ga0268265_10425597 3300028380 Unclassified 1234
182 Ga0268264_10100722 3300028381 Unclassified 2510
183 Ga0265320_10054599 3300031240 Bacteria 1927
184 Ga0265314_10026326 3300031711 Bacteria 4371
185 Ga0265342_10101658 3300031712 Bacteria 1636
186 Ga0307413_10347647 3300031824 Unclassified 1143
187 Ga0307410_10297969 3300031852 Bacteria 1271
188 Ga0307406_10080109 3300031901 Bacteria 2167
189 Ga0307407_10276478 3300031903 Unclassified 1161
190 Ga0307412_10048679 3300031911 Bacteria 2789
191 Ga0307409_100104572 3300031995 Unclassified 2358
192 Ga0307409_100277435 3300031995 Unclassified 1547
193 Ga0307411_10130172 3300032005 Bacteria 1838
194 Ga0307411_10441314 3300032005 Bacteria 1086
195 Ga0373931_0120507 3300035691 Unclassified 1499
196 Ga0373937_0739833 3300036401 Bacteria 931
197 Ga0436365_1242846 3300039437 Bacteria 3869
198 Ga0436365_1563250 3300039437 Bacteria 1437
199 Ga0436365_1617744 3300039437 Bacteria 3982
200 Ga0466963_0181367 3300044694 Unclassified 1470
201 Ga0466957_0058122 3300044842 Bacteria 2369
202 Ga0466958_0137826 3300045836 Bacteria 1535
203 Ga0466967_0017927 3300045976 Bacteria 5642
204 Ga0466967_0018403 3300045976 Bacteria 5581
205 Ga0495580_0163071 3300046472 Bacteria 1542
206 Ga0495594_0042933 3300046499 Bacteria 2477
207 Ga0495642_0136153 3300046528 Bacteria 1059
208 Ga0495659_0061244 3300046664 Bacteria 1390
209 Ga0495657_0388569 3300046675 Bacteria 822
210 Ga0495672_0033715 3300047320 Bacteria 3170
211 Ga0496106_0076557 3300048909 Bacteria 2565
212 Ga0496110_0173338 3300048913 Bacteria 1958
213 Ga0496112_0066886 3300048915 Bacteria 3546
214 Ga0496113_0012080 3300048916 Bacteria 5792
215 Ga0501033_0057515 3300049570 Unclassified 2874
216 Ga0501034_0053947 3300049571 Bacteria 4047
217 Ga0501036_0137643 3300049572 Unclassified 2061
218 Ga0501047_0083975 3300049581 Unclassified 3061
219 Ga0501047_0110109 3300049581 Bacteria 2637
220 Ga0501044_0005534 3300049823 Bacteria 14018
221 Ga0501044_0105679 3300049823 Unclassified 2828

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10181247 Ga0070681_101812472 235
2 3300025906 Ga0207699_10014006 Ga0207699_100140065 235
3 3300025912 Ga0207707_10096259 Ga0207707_100962592 235
4 3300025939 Ga0207665_10146677 Ga0207665_101466772 235
5 3300013104 Ga0157370_10014099 Ga0157370_100140994 237
6 3300014969 Ga0157376_10257678 Ga0157376_102576782 238
7 3300009147 Ga0114129_10203079 Ga0114129_102030792 240
8 3300005457 Ga0070662_100330569 Ga0070662_1003305692 248
9 3300010375 Ga0105239_10697328 Ga0105239_106973281 248
10 3300025923 Ga0207681_10203910 Ga0207681_102039102 248
11 3300025933 Ga0207706_10113485 Ga0207706_101134851 248
12 3300026118 Ga0207675_100433236 Ga0207675_1004332361 248
13 3300035691 Ga0373931_0120507 Ga0373931_0120507_456_1202 248
14 3300005434 Ga0070709_10424883 Ga0070709_104248831 250
15 3300031240 Ga0265320_10054599 Ga0265320_100545993 251
16 3300031711 Ga0265314_10026326 Ga0265314_100263264 251
17 3300031712 Ga0265342_10101658 Ga0265342_101016581 251
18 3300005327 Ga0070658_10156495 Ga0070658_101564953 252
19 3300005328 Ga0070676_10004100 Ga0070676_100041004 252
20 3300005406 Ga0070703_10062892 Ga0070703_100628922 252
21 3300005434 Ga0070709_10060227 Ga0070709_100602272 252
22 3300005471 Ga0070698_100430228 Ga0070698_1004302282 252
23 3300005547 Ga0070693_100089077 Ga0070693_1000890772 252
24 3300025906 Ga0207699_10096548 Ga0207699_100965482 252
25 3300049572 Ga0501036_0137643 Ga0501036_0137643_162_959 252
26 3300005327 Ga0070658_10024239 Ga0070658_100242391 253
27 3300005327 Ga0070658_10160984 Ga0070658_101609842 253
28 3300005327 Ga0070658_10234948 Ga0070658_102349482 253
29 3300005328 Ga0070676_10046244 Ga0070676_100462442 253
30 3300005329 Ga0070683_100002518 Ga0070683_10000251811 253
31 3300005329 Ga0070683_100017550 Ga0070683_1000175502 253
32 3300005329 Ga0070683_100028663 Ga0070683_1000286633 253
33 3300005329 Ga0070683_100150375 Ga0070683_1001503752 253
34 3300005329 Ga0070683_100204343 Ga0070683_1002043431 253
35 3300005330 Ga0070690_100113265 Ga0070690_1001132652 253
36 3300005331 Ga0070670_100384750 Ga0070670_1003847501 253
37 3300005333 Ga0070677_10063542 Ga0070677_100635422 253
38 3300005336 Ga0070680_100064595 Ga0070680_1000645952 253
39 3300005339 Ga0070660_100086434 Ga0070660_1000864343 253
40 3300005339 Ga0070660_100311034 Ga0070660_1003110341 253
41 3300005343 Ga0070687_100014559 Ga0070687_1000145593 253
42 3300005344 Ga0070661_100136236 Ga0070661_1001362362 253
43 3300005347 Ga0070668_100519689 Ga0070668_1005196891 253
44 3300005353 Ga0070669_100001331 Ga0070669_1000013311 253
45 3300005354 Ga0070675_100007872 Ga0070675_1000078727 253
46 3300005354 Ga0070675_100070422 Ga0070675_1000704223 253
47 3300005354 Ga0070675_100076789 Ga0070675_1000767891 253
48 3300005354 Ga0070675_100087374 Ga0070675_1000873742 253
49 3300005354 Ga0070675_100650170 Ga0070675_1006501701 253
50 3300005355 Ga0070671_100052651 Ga0070671_1000526511 253
51 3300005355 Ga0070671_100765688 Ga0070671_1007656881 253
52 3300005364 Ga0070673_100325529 Ga0070673_1003255291 253
53 3300005364 Ga0070673_100384119 Ga0070673_1003841192 253
54 3300005365 Ga0070688_100014483 Ga0070688_1000144833 253
55 3300005365 Ga0070688_100277972 Ga0070688_1002779722 253
56 3300005366 Ga0070659_100041186 Ga0070659_1000411863 253
57 3300005366 Ga0070659_100079480 Ga0070659_1000794803 253
58 3300005367 Ga0070667_100140079 Ga0070667_1001400793 253
59 3300005435 Ga0070714_100081467 Ga0070714_1000814672 253
60 3300005456 Ga0070678_100506066 Ga0070678_1005060661 253
61 3300005456 Ga0070678_100798130 Ga0070678_1007981301 253
62 3300005458 Ga0070681_10036586 Ga0070681_100365863 253
63 3300005458 Ga0070681_10198989 Ga0070681_101989892 253
64 3300005458 Ga0070681_10393978 Ga0070681_103939782 253
65 3300005466 Ga0070685_10022653 Ga0070685_100226532 253
66 3300005467 Ga0070706_100024495 Ga0070706_1000244953 253
67 3300005530 Ga0070679_100001774 Ga0070679_1000017747 253
68 3300005530 Ga0070679_100134090 Ga0070679_1001340902 253
69 3300005530 Ga0070679_100554687 Ga0070679_1005546872 253
70 3300005535 Ga0070684_100017084 Ga0070684_1000170846 253
71 3300005535 Ga0070684_100079278 Ga0070684_1000792783 253
72 3300005535 Ga0070684_100215580 Ga0070684_1002155802 253
73 3300005536 Ga0070697_100329530 Ga0070697_1003295302 253
74 3300005543 Ga0070672_100237547 Ga0070672_1002375471 253
75 3300005543 Ga0070672_100335638 Ga0070672_1003356382 253
76 3300005546 Ga0070696_100000465 Ga0070696_10000046513 253
77 3300005563 Ga0068855_100117475 Ga0068855_1001174752 253
78 3300005564 Ga0070664_100006533 Ga0070664_1000065336 253
79 3300005564 Ga0070664_100036535 Ga0070664_1000365352 253
80 3300005615 Ga0070702_100296933 Ga0070702_1002969332 253
81 3300005616 Ga0068852_100050153 Ga0068852_1000501533 253
82 3300005617 Ga0068859_100539029 Ga0068859_1005390292 253
83 3300005617 Ga0068859_100632549 Ga0068859_1006325492 253
84 3300005618 Ga0068864_100296878 Ga0068864_1002968782 253
85 3300005618 Ga0068864_100346132 Ga0068864_1003461321 253
86 3300005834 Ga0068851_10036242 Ga0068851_100362423 253
87 3300005840 Ga0068870_10014627 Ga0068870_100146274 253
88 3300005841 Ga0068863_100281022 Ga0068863_1002810222 253
89 3300005842 Ga0068858_100117244 Ga0068858_1001172442 253
90 3300005843 Ga0068860_100471776 Ga0068860_1004717761 253
91 3300005844 Ga0068862_100081208 Ga0068862_1000812083 253
92 3300005985 Ga0081539_10000104 Ga0081539_1000010424 253
93 3300006358 Ga0068871_100694375 Ga0068871_1006943752 253
94 3300006871 Ga0075434_100170563 Ga0075434_1001705631 253
95 3300006881 Ga0068865_100020831 Ga0068865_1000208312 253
96 3300006881 Ga0068865_100302954 Ga0068865_1003029542 253
97 3300006931 Ga0097620_100142405 Ga0097620_1001424052 253
98 3300006931 Ga0097620_100539048 Ga0097620_1005390482 253
99 3300006931 Ga0097620_100632524 Ga0097620_1006325242 253
100 3300007076 Ga0075435_100362001 Ga0075435_1003620012 253
101 3300009098 Ga0105245_10116762 Ga0105245_101167621 253
102 3300009148 Ga0105243_10014476 Ga0105243_100144763 253
103 3300009148 Ga0105243_10083465 Ga0105243_100834653 253
104 3300009176 Ga0105242_10016274 Ga0105242_100162744 253
105 3300009177 Ga0105248_10080235 Ga0105248_100802353 253
106 3300009177 Ga0105248_10154456 Ga0105248_101544562 253
107 3300009177 Ga0105248_10249759 Ga0105248_102497592 253
108 3300009177 Ga0105248_10629919 Ga0105248_106299191 253
109 3300009545 Ga0105237_10289674 Ga0105237_102896741 253
110 3300011119 Ga0105246_10148064 Ga0105246_101480642 253
111 3300011119 Ga0105246_10231136 Ga0105246_102311361 253
112 3300013104 Ga0157370_10150843 Ga0157370_101508432 253
113 3300013105 Ga0157369_10716936 Ga0157369_107169362 253
114 3300013297 Ga0157378_10266904 Ga0157378_102669042 253
115 3300013306 Ga0163162_10138930 Ga0163162_101389303 253
116 3300013307 Ga0157372_10093652 Ga0157372_100936524 253
117 3300013307 Ga0157372_10145864 Ga0157372_101458642 253
118 3300013308 Ga0157375_10063599 Ga0157375_100635993 253
119 3300013308 Ga0157375_10184439 Ga0157375_101844391 253
120 3300014325 Ga0163163_10642475 Ga0163163_106424751 253
121 3300014745 Ga0157377_10071351 Ga0157377_100713512 253
122 3300014968 Ga0157379_10241554 Ga0157379_102415542 253
123 3300017792 Ga0163161_10143257 Ga0163161_101432572 253
124 3300017792 Ga0163161_10146925 Ga0163161_101469252 253
125 3300025315 Ga0207697_10110755 Ga0207697_101107552 253
126 3300025321 Ga0207656_10117139 Ga0207656_101171392 253
127 3300025893 Ga0207682_10005752 Ga0207682_100057523 253
128 3300025901 Ga0207688_10031980 Ga0207688_100319802 253
129 3300025907 Ga0207645_10037079 Ga0207645_100370792 253
130 3300025908 Ga0207643_10010002 Ga0207643_100100023 253
131 3300025909 Ga0207705_10041935 Ga0207705_100419354 253
132 3300025910 Ga0207684_10066349 Ga0207684_100663493 253
133 3300025912 Ga0207707_10004829 Ga0207707_100048297 253
134 3300025913 Ga0207695_10121710 Ga0207695_101217102 253
135 3300025914 Ga0207671_10174060 Ga0207671_101740602 253
136 3300025918 Ga0207662_10002023 Ga0207662_100020234 253
137 3300025919 Ga0207657_10248879 Ga0207657_102488792 253
138 3300025919 Ga0207657_10329224 Ga0207657_103292242 253
139 3300025920 Ga0207649_10034011 Ga0207649_100340112 253
140 3300025921 Ga0207652_10001243 Ga0207652_1000124323 253
141 3300025926 Ga0207659_10004233 Ga0207659_100042334 253
142 3300025926 Ga0207659_10114723 Ga0207659_101147233 253
143 3300025926 Ga0207659_10135204 Ga0207659_101352042 253
144 3300025929 Ga0207664_10056091 Ga0207664_100560912 253
145 3300025931 Ga0207644_10329172 Ga0207644_103291722 253
146 3300025931 Ga0207644_10464723 Ga0207644_104647231 253
147 3300025932 Ga0207690_10068734 Ga0207690_100687344 253
148 3300025932 Ga0207690_10254211 Ga0207690_102542112 253
149 3300025933 Ga0207706_10033231 Ga0207706_100332312 253
150 3300025936 Ga0207670_10288963 Ga0207670_102889632 253
151 3300025938 Ga0207704_10109963 Ga0207704_101099633 253
152 3300025940 Ga0207691_10069161 Ga0207691_100691614 253
153 3300025940 Ga0207691_10072275 Ga0207691_100722754 253
154 3300025940 Ga0207691_10147863 Ga0207691_101478632 253
155 3300025941 Ga0207711_10095535 Ga0207711_100955353 253
156 3300025941 Ga0207711_10196373 Ga0207711_101963732 253
157 3300025941 Ga0207711_10202129 Ga0207711_102021292 253
158 3300025941 Ga0207711_10403701 Ga0207711_104037011 253
159 3300025944 Ga0207661_10000657 Ga0207661_1000065715 253
160 3300025944 Ga0207661_10040217 Ga0207661_100402171 253
161 3300025944 Ga0207661_10047119 Ga0207661_100471192 253
162 3300025944 Ga0207661_10123874 Ga0207661_101238742 253
163 3300025944 Ga0207661_10258974 Ga0207661_102589742 253
164 3300025944 Ga0207661_10368370 Ga0207661_103683702 253
165 3300025945 Ga0207679_10026507 Ga0207679_100265072 253
166 3300025945 Ga0207679_10045214 Ga0207679_100452143 253
167 3300025945 Ga0207679_10401843 Ga0207679_104018432 253
168 3300025945 Ga0207679_10512711 Ga0207679_105127112 253
169 3300025949 Ga0207667_10129945 Ga0207667_101299453 253
170 3300025960 Ga0207651_10233908 Ga0207651_102339082 253
171 3300025972 Ga0207668_10073226 Ga0207668_100732262 253
172 3300025986 Ga0207658_10055601 Ga0207658_100556013 253
173 3300025986 Ga0207658_10173742 Ga0207658_101737421 253
174 3300026023 Ga0207677_10279921 Ga0207677_102799211 253
175 3300026035 Ga0207703_10465649 Ga0207703_104656491 253
176 3300026075 Ga0207708_10040380 Ga0207708_100403802 253
177 3300026078 Ga0207702_10013303 Ga0207702_100133033 253
178 3300026088 Ga0207641_10022232 Ga0207641_100222326 253
179 3300026089 Ga0207648_10035257 Ga0207648_100352574 253
180 3300026095 Ga0207676_10461896 Ga0207676_104618961 253
181 3300026095 Ga0207676_10477958 Ga0207676_104779582 253
182 3300026116 Ga0207674_10017940 Ga0207674_100179403 253
183 3300026121 Ga0207683_10537135 Ga0207683_105371352 253
184 3300028379 Ga0268266_10293122 Ga0268266_102931222 253
185 3300028380 Ga0268265_10025106 Ga0268265_100251063 253
186 3300028380 Ga0268265_10425597 Ga0268265_104255972 253
187 3300028381 Ga0268264_10100722 Ga0268264_101007223 253
188 3300031824 Ga0307413_10347647 Ga0307413_103476471 253
189 3300031852 Ga0307410_10297969 Ga0307410_102979691 253
190 3300031901 Ga0307406_10080109 Ga0307406_100801092 253
191 3300031903 Ga0307407_10276478 Ga0307407_102764782 253
192 3300031911 Ga0307412_10048679 Ga0307412_100486793 253
193 3300031995 Ga0307409_100104572 Ga0307409_1001045722 253
194 3300031995 Ga0307409_100277435 Ga0307409_1002774352 253
195 3300032005 Ga0307411_10130172 Ga0307411_101301722 253
196 3300032005 Ga0307411_10441314 Ga0307411_104413141 253
197 3300036401 Ga0373937_0739833 Ga0373937_0739833_75_836 253
198 3300039437 Ga0436365_1242846 Ga0436365_1242846_2655_3443 253
199 3300039437 Ga0436365_1563250 Ga0436365_1563250_562_1329 253
200 3300039437 Ga0436365_1617744 Ga0436365_1617744_2809_3612 253
201 3300044694 Ga0466963_0181367 Ga0466963_0181367_571_1371 253
202 3300044842 Ga0466957_0058122 Ga0466957_0058122_1360_2136 253
203 3300045836 Ga0466958_0137826 Ga0466958_0137826_601_1362 253
204 3300045976 Ga0466967_0017927 Ga0466967_0017927_49_825 253
205 3300045976 Ga0466967_0018403 Ga0466967_0018403_1982_2782 253
206 3300046472 Ga0495580_0163071 Ga0495580_0163071_692_1471 253
207 3300046499 Ga0495594_0042933 Ga0495594_0042933_1184_1963 253
208 3300046528 Ga0495642_0136153 Ga0495642_0136153_102_863 253
209 3300046664 Ga0495659_0061244 Ga0495659_0061244_328_1089 253
210 3300046675 Ga0495657_0388569 Ga0495657_0388569_38_799 253
211 3300047320 Ga0495672_0033715 Ga0495672_0033715_1901_2677 253
212 3300048909 Ga0496106_0076557 Ga0496106_0076557_653_1414 253
213 3300048913 Ga0496110_0173338 Ga0496110_0173338_1141_1902 253
214 3300048915 Ga0496112_0066886 Ga0496112_0066886_265_1026 253
215 3300048916 Ga0496113_0012080 Ga0496113_0012080_325_1086 253
216 3300049570 Ga0501033_0057515 Ga0501033_0057515_1092_1856 253
217 3300049571 Ga0501034_0053947 Ga0501034_0053947_38_802 253
218 3300049581 Ga0501047_0083975 Ga0501047_0083975_1075_1839 253
219 3300049581 Ga0501047_0110109 Ga0501047_0110109_754_1515 253
220 3300049823 Ga0501044_0005534 Ga0501044_0005534_9604_10368 253
221 3300049823 Ga0501044_0105679 Ga0501044_0105679_13_867 253

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h0t-assembly1.cif.gz_A-2 crystal structure of mnmm from b. subtilis complexed with sah (1.17 a) 0.7659 147 190
4ign-assembly2.cif.gz_B 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd 0.7162 20 224
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.7135 2 224
4ofc-assembly1.cif.gz_A 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase 0.7117 2 234
2hbx-assembly1.cif.gz_A crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd) 0.7114 20 224
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7195 9 241 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7195 20 225 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7098 25 234 3.20.20.140
3ij6C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7093 24 236 3.20.20.140
1gkpA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7025 2 191 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1G0LE30-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9329 52 235
AF-A0A7Y5QQE3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9194 99 251
AF-A0A1G0LE30-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9184 52 235
AF-A0A7V9TK81-F1-model_v4 Amidohydrolase family protein 0.917 2 246 GO:0016787
AF-A0A7Y5QQE3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9137 99 251

Feature Viewer

pLDDT pTM Quality
82.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map