F332396

General Info

Members Datasets Scaffolds Average Seq Length
220 169 440 139

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10140057|Ga0265320_101400572
Length 135
Sequence VLTGRCLCGGVRFELTEPPAAAGYCHCTRCQRRTGTAASAQVRIDGGTFRLLEGAELVEGWRHPDGGFEKCFCRECGAHLFSRDPDNPEARMGVRLGAFDGDPGIRPSWRAYVAYAAPWEPIPDDGLARYPEATP

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
120 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.91
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10140057 3300031240 Bacteria 1096
2 Ga0070658_10256642 3300005327 Bacteria 1484
3 Ga0070683_100785637 3300005329 Bacteria 912
4 Ga0070683_101166823 3300005329 Unclassified 740
5 Ga0068869_100974187 3300005334 Bacteria 737
6 Ga0070680_100053811 3300005336 Bacteria 3285
7 Ga0070680_100229960 3300005336 Bacteria 1566
8 Ga0068868_101654228 3300005338 Unclassified 602
9 Ga0070691_10242009 3300005341 Unclassified 964
10 Ga0070661_100037729 3300005344 Bacteria 3516
11 Ga0070661_101431751 3300005344 Bacteria 582
12 Ga0070692_10120072 3300005345 Bacteria 1465
13 Ga0070668_100450945 3300005347 Bacteria 1106
14 Ga0070659_101819914 3300005366 Bacteria 545
15 Ga0070714_100270357 3300005435 Bacteria 1576
16 Ga0070713_100474249 3300005436 Unclassified 1178
17 Ga0070710_10985870 3300005437 Bacteria 613
18 Ga0070710_11233176 3300005437 Bacteria 554
19 Ga0070663_100184100 3300005455 Unclassified 1622
20 Ga0070678_100039140 3300005456 Bacteria 3342
21 Ga0070681_10037219 3300005458 Bacteria 4884
22 Ga0070681_11116411 3300005458 Bacteria 709
23 Ga0068867_100259120 3300005459 Unclassified 1417
24 Ga0070706_100375717 3300005467 Bacteria 1324
25 Ga0070707_100489978 3300005468 Bacteria 1191
26 Ga0070699_101740827 3300005518 Unclassified 571
27 Ga0070679_100474400 3300005530 Bacteria 1195
28 Ga0070684_100257141 3300005535 Bacteria 1597
29 Ga0070697_100143902 3300005536 Bacteria 2006
30 Ga0070697_100581918 3300005536 Bacteria 983
31 Ga0070697_101107158 3300005536 Unclassified 705
32 Ga0070696_100838535 3300005546 Unclassified 759
33 Ga0070693_100154196 3300005547 Bacteria 1457
34 Ga0070665_100269927 3300005548 Bacteria 1703
35 Ga0070704_100303258 3300005549 Bacteria 1332
36 Ga0070664_100353876 3300005564 Bacteria 1336
37 Ga0068857_101130011 3300005577 Bacteria 757
38 Ga0068854_101207805 3300005578 Bacteria 678
39 Ga0068856_100221777 3300005614 Bacteria 1906
40 Ga0068856_100270056 3300005614 Bacteria 1717
41 Ga0070702_100039610 3300005615 Bacteria 2630
42 Ga0068852_100062335 3300005616 Bacteria 3243
43 Ga0068859_100161841 3300005617 Bacteria 2317
44 Ga0068866_10106382 3300005718 Unclassified 1557
45 Ga0068858_100081663 3300005842 Bacteria 3004
46 Ga0068860_100065582 3300005843 Bacteria 3448
47 Ga0081455_10111278 3300005937 Bacteria 2176
48 Ga0081455_10177618 3300005937 Bacteria 1615
49 Ga0081538_10000548 3300005981 Bacteria 41457
50 Ga0081538_10007819 3300005981 Bacteria 9176
51 Ga0081538_10021737 3300005981 Bacteria 4670
52 Ga0081538_10030969 3300005981 Bacteria 3619
53 Ga0081538_10036963 3300005981 Bacteria 3177
54 Ga0081540_1119574 3300005983 Bacteria 1096
55 Ga0070717_10803050 3300006028 Unclassified 856
56 Ga0070715_10092917 3300006163 Unclassified 1392
57 Ga0070712_100752996 3300006175 Unclassified 834
58 Ga0097621_100200682 3300006237 Unclassified 1731
59 Ga0068871_100055503 3300006358 Bacteria 3216
60 Ga0075428_102190429 3300006844 Bacteria 570
61 Ga0075430_100184980 3300006846 Bacteria 1732
62 Ga0075431_100181721 3300006847 Bacteria 2158
63 Ga0075431_100359651 3300006847 Bacteria 1462
64 Ga0075431_101666802 3300006847 Bacteria 595
65 Ga0075433_10013858 3300006852 Bacteria 6573
66 Ga0075434_100013737 3300006871 Bacteria 7721
67 Ga0075434_100339931 3300006871 Bacteria 1522
68 Ga0097620_100161846 3300006931 Bacteria 2317
69 Ga0075435_100058585 3300007076 Bacteria 3120
70 Ga0105240_10115142 3300009093 Bacteria 3246
71 Ga0111539_10123071 3300009094 Bacteria 3040
72 Ga0111539_10147429 3300009094 Bacteria 2755
73 Ga0111539_10434647 3300009094 Bacteria 1528
74 Ga0105245_10502683 3300009098 Unclassified 1228
75 Ga0114129_10362485 3300009147 Bacteria 1917
76 Ga0105243_10024556 3300009148 Bacteria 4598
77 Ga0105241_10091426 3300009174 Bacteria 2401
78 Ga0105242_10036196 3300009176 Bacteria 3959
79 Ga0105248_10761422 3300009177 Unclassified 1093
80 Ga0105237_10064612 3300009545 Bacteria 3655
81 Ga0105238_10215615 3300009551 Bacteria 1896
82 Ga0105246_10680813 3300011119 Bacteria 899
83 Ga0157371_10315767 3300013102 Bacteria 1133
84 Ga0157370_10054106 3300013104 Bacteria 3826
85 Ga0157369_10087083 3300013105 Bacteria 3335
86 Ga0157378_10014808 3300013297 Bacteria 6826
87 Ga0157372_10046556 3300013307 Bacteria 4815
88 Ga0157380_10318591 3300014326 Bacteria 1441
89 Ga0157379_10048687 3300014968 Bacteria 3783
90 Ga0157379_10870254 3300014968 Bacteria 853
91 Ga0157376_10634128 3300014969 Unclassified 1067
92 Ga0206354_10342054 3300020081 Bacteria 1704
93 Ga0206353_10908472 3300020082 Bacteria 2992
94 Ga0213873_10019439 3300021358 Bacteria 1576
95 Ga0213876_10302994 3300021384 Unclassified 849
96 Ga0213875_10120806 3300021388 Bacteria 1224
97 Ga0207692_10652994 3300025898 Unclassified 680
98 Ga0207710_10086019 3300025900 Bacteria 1465
99 Ga0207707_10593642 3300025912 Bacteria 938
100 Ga0207671_10114582 3300025914 Bacteria 2055
101 Ga0207660_10307304 3300025917 Bacteria 1264
102 Ga0207657_10004175 3300025919 Bacteria 15310
103 Ga0207649_10125129 3300025920 Bacteria 1738
104 Ga0207652_10024701 3300025921 Bacteria 4987
105 Ga0207646_10220973 3300025922 Bacteria 1711
106 Ga0207694_11017174 3300025924 Bacteria 701
107 Ga0207687_10891897 3300025927 Unclassified 761
108 Ga0207700_10584006 3300025928 Unclassified 994
109 Ga0207709_10173969 3300025935 Unclassified 1514
110 Ga0207704_10110608 3300025938 Bacteria 1856
111 Ga0207711_10322461 3300025941 Unclassified 1428
112 Ga0207661_10026630 3300025944 Bacteria 4408
113 Ga0207679_10219430 3300025945 Bacteria 1599
114 Ga0207640_11626250 3300025981 Bacteria 582
115 Ga0207678_10610503 3300026067 Unclassified 957
116 Ga0207678_10942759 3300026067 Bacteria 764
117 Ga0207702_10066817 3300026078 Bacteria 3083
118 Ga0207702_10303331 3300026078 Bacteria 1516
119 Ga0207648_10209498 3300026089 Bacteria 1730
120 Ga0207674_10103759 3300026116 Bacteria 2822
121 Ga0207674_10991214 3300026116 Bacteria 809
122 Ga0207683_10000353 3300026121 Bacteria 42039
123 Ga0207698_10024278 3300026142 Bacteria 4252
124 Ga0207428_10009867 3300027907 Bacteria 8553
125 Ga0207428_10471183 3300027907 Bacteria 914
126 Ga0268266_11255280 3300028379 Bacteria 716
127 Ga0268264_10013171 3300028381 Bacteria 6803
128 Ga0265326_10079985 3300028558 Bacteria 924
129 Ga0265319_1014377 3300028563 Bacteria 3107
130 Ga0265319_1031387 3300028563 Bacteria 1850
131 Ga0265319_1037799 3300028563 Bacteria 1643
132 Ga0265319_1067233 3300028563 Bacteria 1153
133 Ga0265334_10094885 3300028573 Bacteria 1085
134 Ga0265318_10026411 3300028577 Bacteria 2286
135 Ga0265318_10078559 3300028577 Bacteria 1219
136 Ga0265322_10120284 3300028654 Bacteria 748
137 Ga0265338_10153369 3300028800 Bacteria 1787
138 Ga0265338_10543062 3300028800 Unclassified 814
139 Ga0265330_10204322 3300031235 Bacteria 835
140 Ga0265320_10001317 3300031240 Bacteria 18160
141 Ga0265320_10028662 3300031240 Bacteria 2889
142 Ga0265316_10026463 3300031344 Bacteria 4824
143 Ga0265314_10202193 3300031711 Bacteria 1173
144 Ga0307409_102330403 3300031995 Bacteria 565
145 Ga0436364_0853286 3300037853 Bacteria 7737
146 Ga0436365_0545470 3300039437 Bacteria 1425
147 Ga0436365_0671899 3300039437 Bacteria 5486
148 Ga0436365_1107254 3300039437 Bacteria 943
149 Ga0436363_1312639 3300039450 Bacteria 899
150 Ga0436362_0916569 3300039453 Bacteria 1825
151 Ga0451795_0509576 3300041456 Bacteria 575
152 Ga0451851_0393238 3300041507 Bacteria 596
153 Ga0439448_0021129 3300042005 Bacteria 2018
154 Ga0439455_0157226 3300042012 Bacteria 649
155 Ga0439440_0256506 3300042993 Bacteria 534
156 Ga0466969_0007048 3300044656 Bacteria 5978
157 Ga0466965_0202853 3300044683 Bacteria 1052
158 Ga0466966_0910184 3300044684 Bacteria 530
159 Ga0466961_0022716 3300044693 Bacteria 4034
160 Ga0466963_0234241 3300044694 Bacteria 1287
161 Ga0466964_0068340 3300044706 Bacteria 1496
162 Ga0466964_0150640 3300044706 Bacteria 1078
163 Ga0466971_0128426 3300044719 Bacteria 1176
164 Ga0466970_0113083 3300044765 Bacteria 1483
165 Ga0466957_0040431 3300044842 Bacteria 2817
166 Ga0466957_0246562 3300044842 Bacteria 1186
167 Ga0466960_0022825 3300044901 Bacteria 2802
168 Ga0466959_0006933 3300045049 Bacteria 7912
169 Ga0466959_1158358 3300045049 Bacteria 514
170 Ga0466958_0003506 3300045836 Bacteria 8149
171 Ga0466958_0439019 3300045836 Bacteria 845
172 Ga0466967_0020690 3300045976 Bacteria 5326
173 Ga0466967_0038560 3300045976 Bacteria 4099
174 Ga0466967_0210496 3300045976 Bacteria 1844
175 Ga0466967_1937653 3300045976 Bacteria 586
176 Ga0495598_0342557 3300046537 Bacteria 574
177 Ga0495623_0361014 3300046679 Bacteria 789
178 Ga0495636_0454011 3300047318 Bacteria 616
179 Ga0496102_0013127 3300048905 Bacteria 7166
180 Ga0496103_0038151 3300048906 Bacteria 2946
181 Ga0496103_0193369 3300048906 Bacteria 1308
182 Ga0496104_0548874 3300048907 Unclassified 1066
183 Ga0496106_0040278 3300048909 Bacteria 3498
184 Ga0496107_0007019 3300048910 Bacteria 7759
185 Ga0496108_0196876 3300048911 Bacteria 1748
186 Ga0496109_0504890 3300048912 Bacteria 1141
187 Ga0496109_0750026 3300048912 Unclassified 914
188 Ga0496113_0129674 3300048916 Bacteria 1977
189 Ga0496114_0547498 3300048917 Unclassified 1022
190 Ga0496115_0355569 3300048918 Unclassified 1194
191 Ga0501031_0113609 3300049568 Bacteria 1769
192 Ga0501033_0693409 3300049570 Bacteria 693
193 Ga0501039_0545946 3300049575 Bacteria 909
194 Ga0501040_0173291 3300049576 Bacteria 1528
195 Ga0501048_0249734 3300049582 Bacteria 1259
196 Ga0501071_0296950 3300049587 Bacteria 1224
197 Ga0501071_0655992 3300049587 Unclassified 807
198 Ga0501072_0076172 3300049588 Bacteria 2654
199 Ga0501076_0564596 3300049592 Bacteria 938
200 Ga0501079_0073760 3300049741 Bacteria 2638
201 Ga0501035_0398790 3300049822 Bacteria 1145
202 Ga0501045_0047623 3300049824 Bacteria 3123
203 nmdc:mga05p37_291989_c1 3300050507 Bacteria 1940
204 nmdc:mga05p37_96959_c1 3300050507 Bacteria 3633
205 nmdc:mga0qj67_1243484_c1 3300050509 Bacteria 578
206 nmdc:mga0qj67_1325158_c1 3300050509 Unclassified 557
207 nmdc:mga0qj67_99126_c1 3300050509 Bacteria 2347
208 nmdc:mga06r32_1579140_c1 3300050510 Bacteria 595
209 nmdc:mga06r32_24615_c1 3300050510 Bacteria 5591
210 nmdc:mga06r32_585283_c1 3300050510 Unclassified 1088
211 nmdc:mga08y16_15604_c1 3300050511 Bacteria 7987
212 nmdc:mga08y16_177917_c1 3300050511 Unclassified 2209
213 nmdc:mga08y16_700164_c1 3300050511 Bacteria 1013
214 nmdc:mga08y16_750814_c1 3300050511 Bacteria 972
215 nmdc:mga0n895_12658_c1 3300050512 Bacteria 7574
216 nmdc:mga0n895_466009_c1 3300050512 Bacteria 1275
217 nmdc:mga0rr50_130539_c1 3300050513 Bacteria 2011
218 nmdc:mga0a205_138171_c1 3300050515 Bacteria 2337
219 Ga0501084_0806691 3300054114 Bacteria 790
220 Ga0530510_0041008 3300061734 Bacteria 3342
221 Ga0265320_10140057
222 Ga0070658_10256642
223 Ga0070683_100785637
224 Ga0070683_101166823
225 Ga0068869_100974187
226 Ga0070680_100053811
227 Ga0070680_100229960
228 Ga0068868_101654228
229 Ga0070691_10242009
230 Ga0070661_100037729
231 Ga0070661_101431751
232 Ga0070692_10120072
233 Ga0070668_100450945
234 Ga0070659_101819914
235 Ga0070714_100270357
236 Ga0070713_100474249
237 Ga0070710_10985870
238 Ga0070710_11233176
239 Ga0070663_100184100
240 Ga0070678_100039140
241 Ga0070681_10037219
242 Ga0070681_11116411
243 Ga0068867_100259120
244 Ga0070706_100375717
245 Ga0070707_100489978
246 Ga0070699_101740827
247 Ga0070679_100474400
248 Ga0070684_100257141
249 Ga0070697_100143902
250 Ga0070697_100581918
251 Ga0070697_101107158
252 Ga0070696_100838535
253 Ga0070693_100154196
254 Ga0070665_100269927
255 Ga0070704_100303258
256 Ga0070664_100353876
257 Ga0068857_101130011
258 Ga0068854_101207805
259 Ga0068856_100221777
260 Ga0068856_100270056
261 Ga0070702_100039610
262 Ga0068852_100062335
263 Ga0068859_100161841
264 Ga0068866_10106382
265 Ga0068858_100081663
266 Ga0068860_100065582
267 Ga0081455_10111278
268 Ga0081455_10177618
269 Ga0081538_10000548
270 Ga0081538_10007819
271 Ga0081538_10021737
272 Ga0081538_10030969
273 Ga0081538_10036963
274 Ga0081540_1119574
275 Ga0070717_10803050
276 Ga0070715_10092917
277 Ga0070712_100752996
278 Ga0097621_100200682
279 Ga0068871_100055503
280 Ga0075428_102190429
281 Ga0075430_100184980
282 Ga0075431_100181721
283 Ga0075431_100359651
284 Ga0075431_101666802
285 Ga0075433_10013858
286 Ga0075434_100013737
287 Ga0075434_100339931
288 Ga0097620_100161846
289 Ga0075435_100058585
290 Ga0105240_10115142
291 Ga0111539_10123071
292 Ga0111539_10147429
293 Ga0111539_10434647
294 Ga0105245_10502683
295 Ga0114129_10362485
296 Ga0105243_10024556
297 Ga0105241_10091426
298 Ga0105242_10036196
299 Ga0105248_10761422
300 Ga0105237_10064612
301 Ga0105238_10215615
302 Ga0105246_10680813
303 Ga0157371_10315767
304 Ga0157370_10054106
305 Ga0157369_10087083
306 Ga0157378_10014808
307 Ga0157372_10046556
308 Ga0157380_10318591
309 Ga0157379_10048687
310 Ga0157379_10870254
311 Ga0157376_10634128
312 Ga0206354_10342054
313 Ga0206353_10908472
314 Ga0213873_10019439
315 Ga0213876_10302994
316 Ga0213875_10120806
317 Ga0207692_10652994
318 Ga0207710_10086019
319 Ga0207707_10593642
320 Ga0207671_10114582
321 Ga0207660_10307304
322 Ga0207657_10004175
323 Ga0207649_10125129
324 Ga0207652_10024701
325 Ga0207646_10220973
326 Ga0207694_11017174
327 Ga0207687_10891897
328 Ga0207700_10584006
329 Ga0207709_10173969
330 Ga0207704_10110608
331 Ga0207711_10322461
332 Ga0207661_10026630
333 Ga0207679_10219430
334 Ga0207640_11626250
335 Ga0207678_10610503
336 Ga0207678_10942759
337 Ga0207702_10066817
338 Ga0207702_10303331
339 Ga0207648_10209498
340 Ga0207674_10103759
341 Ga0207674_10991214
342 Ga0207683_10000353
343 Ga0207698_10024278
344 Ga0207428_10009867
345 Ga0207428_10471183
346 Ga0268266_11255280
347 Ga0268264_10013171
348 Ga0265326_10079985
349 Ga0265319_1014377
350 Ga0265319_1031387
351 Ga0265319_1037799
352 Ga0265319_1067233
353 Ga0265334_10094885
354 Ga0265318_10026411
355 Ga0265318_10078559
356 Ga0265322_10120284
357 Ga0265338_10153369
358 Ga0265338_10543062
359 Ga0265330_10204322
360 Ga0265320_10001317
361 Ga0265320_10028662
362 Ga0265316_10026463
363 Ga0265314_10202193
364 Ga0307409_102330403
365 Ga0436364_0853286
366 Ga0436365_0545470
367 Ga0436365_0671899
368 Ga0436365_1107254
369 Ga0436363_1312639
370 Ga0436362_0916569
371 Ga0451795_0509576
372 Ga0451851_0393238
373 Ga0439448_0021129
374 Ga0439455_0157226
375 Ga0439440_0256506
376 Ga0466969_0007048
377 Ga0466965_0202853
378 Ga0466966_0910184
379 Ga0466961_0022716
380 Ga0466963_0234241
381 Ga0466964_0068340
382 Ga0466964_0150640
383 Ga0466971_0128426
384 Ga0466970_0113083
385 Ga0466957_0040431
386 Ga0466957_0246562
387 Ga0466960_0022825
388 Ga0466959_0006933
389 Ga0466959_1158358
390 Ga0466958_0003506
391 Ga0466958_0439019
392 Ga0466967_0020690
393 Ga0466967_0038560
394 Ga0466967_0210496
395 Ga0466967_1937653
396 Ga0495598_0342557
397 Ga0495623_0361014
398 Ga0495636_0454011
399 Ga0496102_0013127
400 Ga0496103_0038151
401 Ga0496103_0193369
402 Ga0496104_0548874
403 Ga0496106_0040278
404 Ga0496107_0007019
405 Ga0496108_0196876
406 Ga0496109_0504890
407 Ga0496109_0750026
408 Ga0496113_0129674
409 Ga0496114_0547498
410 Ga0496115_0355569
411 Ga0501031_0113609
412 Ga0501033_0693409
413 Ga0501039_0545946
414 Ga0501040_0173291
415 Ga0501048_0249734
416 Ga0501071_0296950
417 Ga0501071_0655992
418 Ga0501072_0076172
419 Ga0501076_0564596
420 Ga0501079_0073760
421 Ga0501035_0398790
422 Ga0501045_0047623
423 nmdc:mga05p37_291989_c1
424 nmdc:mga05p37_96959_c1
425 nmdc:mga0qj67_1243484_c1
426 nmdc:mga0qj67_1325158_c1
427 nmdc:mga0qj67_99126_c1
428 nmdc:mga06r32_1579140_c1
429 nmdc:mga06r32_24615_c1
430 nmdc:mga06r32_585283_c1
431 nmdc:mga08y16_15604_c1
432 nmdc:mga08y16_177917_c1
433 nmdc:mga08y16_700164_c1
434 nmdc:mga08y16_750814_c1
435 nmdc:mga0n895_12658_c1
436 nmdc:mga0n895_466009_c1
437 nmdc:mga0rr50_130539_c1
438 nmdc:mga0a205_138171_c1
439 Ga0501084_0806691
440 Ga0530510_0041008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

23

115

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8472 4 101
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8367 1 137
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7853 1 137
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7845 2 135
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7642 2 135
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8429 1 130 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8285 4 101 2.170.150.70
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7995 2 135 3.90.1590.10
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7983 4 101 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7971 1 130 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A640XYS7-F1-model_v4 GFA family protein 0.9591 1 112 GO:0016846
GO:0046872
AF-A0A538EP70-F1-model_v4 GFA family protein 0.9445 1 137 GO:0016846
GO:0046872
AF-A0A1Q7HVD6-F1-model_v4 CENP-V/GFA domain-containing protein 0.939 2 115 GO:0016846
GO:0046872
AF-A0A1F2WC68-F1-model_v4 CENP-V/GFA domain-containing protein 0.9386 5 135 GO:0016846
GO:0046872
AF-A0A538CQL5-F1-model_v4 GFA family protein 0.9371 2 135 GO:0016846
GO:0046872

Map