F331363

General Info

Members Datasets Scaffolds Average Seq Length
219 190 432 151

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_003524|Ga0439442_003524_910_1443
Length 177
Sequence MAQGRRQASLADVTYAAPLLVRSYRMPKIDIAAVPVRKGSGYPSPFDAPCAGRVRRRLGDAGGLRDFGVNLMTLPPGGWSSQRHWHSHEDEFVYVLEGEVTLIEDDGETVLRAGDCAAFAKGTGNGHHLINRSSAMVVFLDVGSRSPLDVCIYSDIDMMTTNTDDRFVHKDGTPYPK

Samples

Sample ID Description Type Environment
1 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
71 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
74 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
113 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
114 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
115 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
118 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
119 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
120 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
121 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
122 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
123 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
124 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
125 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
126 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
127 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
128 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
129 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
130 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
131 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
132 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
133 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
134 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
135 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
136 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
137 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
138 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
139 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
140 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
141 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
142 2904699407
143 2906610324
144 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
145 2922425934
146 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
147 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
148 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
149 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
150 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
151 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
152 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
153 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
154 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
155 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
156 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
157 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
158 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
159 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
160 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
161 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
162 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
163 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
164 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
165 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
166 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
167 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
168 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
169 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
173 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
174 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
175 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
176 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
177 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
178 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
179 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
180 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
181 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
182 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
183 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
184 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
185 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
186 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
187 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
188 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
189 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
190 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.13
Metatranscriptomes 0
Isolates 32.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.79
Nodule 27.85
Rhizoplane 5.02
Rhizosphere 47.03
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439442_003524 3300042002 Bacteria 3095
2 JGI24739J22299_10034760 3300001989 Bacteria 1715
3 JGI25159J45721_1006432 3300002987 Bacteria 3515
4 JGI25151J46595_10000064 3300003187 Bacteria 145243
5 JGI25151J46595_10000290 3300003187 Bacteria 56749
6 rootH1_10055561 3300003316 Bacteria 1292
7 rootH1_10388260 3300003323 Bacteria 1387
8 JGI25160J50197_1006240 3300003354 Bacteria 4843
9 Ga0065165_1038035 3300005262 Bacteria 1454
10 Ga0070683_100128424 3300005329 Bacteria 2398
11 Ga0070680_100831151 3300005336 Bacteria 796
12 Ga0070680_101139500 3300005336 Unclassified 674
13 Ga0070669_100022043 3300005353 Bacteria 4557
14 Ga0070659_100053423 3300005366 Bacteria 3180
15 Ga0070713_100256205 3300005436 Bacteria 1598
16 Ga0070663_100068544 3300005455 Bacteria 2575
17 Ga0070681_10173395 3300005458 Bacteria 2078
18 Ga0070681_10268590 3300005458 Bacteria 1617
19 Ga0070679_100765434 3300005530 Bacteria 908
20 Ga0070679_101212805 3300005530 Unclassified 700
21 Ga0070696_100150249 3300005546 Bacteria 1709
22 Ga0070696_100485747 3300005546 Bacteria 980
23 Ga0070665_100045037 3300005548 Bacteria 4430
24 Ga0068855_100397444 3300005563 Bacteria 1511
25 Ga0068855_100624359 3300005563 Bacteria 1160
26 Ga0068859_100410626 3300005617 Bacteria 1450
27 Ga0068864_101695753 3300005618 Bacteria 637
28 Ga0068861_101427913 3300005719 Bacteria 677
29 Ga0068860_100703526 3300005843 Bacteria 1020
30 Ga0068860_101069109 3300005843 Bacteria 826
31 Ga0075362_10284987 3300006177 Bacteria 817
32 Ga0075367_10167792 3300006178 Bacteria 1367
33 Ga0075369_10001033 3300006186 Bacteria 9312
34 Ga0075366_10327676 3300006195 Bacteria 938
35 Ga0075366_10951708 3300006195 Unclassified 535
36 Ga0097621_100012806 3300006237 Bacteria 6231
37 Ga0097621_100537202 3300006237 Bacteria 1063
38 Ga0075370_10082721 3300006353 Bacteria 1846
39 Ga0075370_10221276 3300006353 Bacteria 1119
40 Ga0068871_100012268 3300006358 Bacteria 6312
41 Ga0068871_100769084 3300006358 Bacteria 886
42 Ga0075431_100004240 3300006847 Bacteria 14052
43 Ga0097620_100410621 3300006931 Bacteria 1450
44 Ga0111539_10009098 3300009094 Bacteria 12572
45 Ga0114129_10162285 3300009147 Bacteria 3052
46 Ga0105237_10202627 3300009545 Bacteria 1985
47 Ga0105237_10451865 3300009545 Bacteria 1291
48 Ga0105238_10883039 3300009551 Bacteria 912
49 Ga0157370_10493933 3300013104 Bacteria 1124
50 Ga0157369_10516630 3300013105 Bacteria 1235
51 Ga0157378_11833088 3300013297 Bacteria 655
52 Ga0163162_12333654 3300013306 Bacteria 615
53 Ga0157372_10695063 3300013307 Bacteria 1184
54 Ga0157375_10536568 3300013308 Bacteria 1332
55 Ga0157375_10966001 3300013308 Bacteria 993
56 Ga0163163_10185657 3300014325 Bacteria 2127
57 Ga0157380_10463995 3300014326 Bacteria 1220
58 Ga0157380_12990855 3300014326 Bacteria 538
59 Ga0157376_10689096 3300014969 Bacteria 1026
60 Ga0182005_1052561 3300015265 Bacteria 1109
61 Ga0209130_1000868 3300025284 Bacteria 24786
62 Ga0209025_1000212 3300025294 Bacteria 139086
63 Ga0209758_1004688 3300025297 Bacteria 11165
64 Ga0209758_1109260 3300025297 Bacteria 769
65 Ga0207426_1000102 3300025302 Bacteria 255303
66 Ga0207647_10373978 3300025904 Bacteria 805
67 Ga0207707_10219068 3300025912 Bacteria 1657
68 Ga0207707_10268114 3300025912 Bacteria 1480
69 Ga0207707_10913447 3300025912 Bacteria 725
70 Ga0207695_10060637 3300025913 Bacteria 3914
71 Ga0207671_10106410 3300025914 Bacteria 2129
72 Ga0207660_10369128 3300025917 Bacteria 1152
73 Ga0207660_10755178 3300025917 Bacteria 794
74 Ga0207681_10055410 3300025923 Bacteria 2700
75 Ga0207681_11469277 3300025923 Bacteria 572
76 Ga0207689_10270782 3300025942 Bacteria 1406
77 Ga0207661_10791861 3300025944 Bacteria 873
78 Ga0207678_10228577 3300026067 Bacteria 1593
79 Ga0207676_10956606 3300026095 Bacteria 842
80 Ga0268266_10025013 3300028379 Bacteria 5083
81 Ga0268264_10118380 3300028381 Bacteria 2331
82 Ga0265318_10000115 3300028577 Bacteria 74110
83 Ga0307511_10006704 3300030521 Bacteria 11597
84 Ga0307511_10079194 3300030521 Bacteria 2324
85 Ga0307408_100080928 3300031548 Bacteria 2427
86 Ga0307408_100578937 3300031548 Bacteria 994
87 Ga0307406_10133650 3300031901 Bacteria 1745
88 Ga0307406_10338340 3300031901 Bacteria 1171
89 Ga0307407_10636294 3300031903 Bacteria 798
90 Ga0307412_11186231 3300031911 Bacteria 683
91 Ga0395900_0010739 3300037418 Bacteria 9367
92 Ga0451800_0426719 3300041459 Bacteria 691
93 Ga0451839_1339528 3300041496 Bacteria 688
94 Ga0439448_0062187 3300042005 Bacteria 1235
95 Ga0439455_0159458 3300042012 Bacteria 645
96 Ga0450909_038682 3300042185 Bacteria 732
97 Ga0466966_0077700 3300044684 Bacteria 2071
98 Ga0466966_0154850 3300044684 Bacteria 1396
99 Ga0466961_0020774 3300044693 Bacteria 4226
100 Ga0466961_0198610 3300044693 Bacteria 1241
101 Ga0466968_0202490 3300044735 Bacteria 930
102 Ga0466970_0483113 3300044765 Bacteria 712
103 Ga0466957_0008385 3300044842 Bacteria 5877
104 Ga0466957_0179149 3300044842 Bacteria 1384
105 Ga0466959_0213770 3300045049 Bacteria 1339
106 Ga0495664_0536616 3300046477 Bacteria 698
107 Ga0495610_0009557 3300046512 Bacteria 6115
108 Ga0495632_0214507 3300046519 Bacteria 872
109 Ga0495643_0080984 3300046522 Bacteria 1689
110 Ga0495648_0125985 3300046524 Bacteria 1369
111 Ga0495668_0449111 3300046616 Bacteria 709
112 Ga0495625_0033278 3300046660 Bacteria 3814
113 Ga0495589_0345306 3300046794 Bacteria 686
114 Ga0495593_0075214 3300047673 Bacteria 1751
115 Ga0496101_0641667 3300048904 Bacteria 839
116 Ga0496103_0057538 3300048906 Bacteria 2414
117 Ga0496104_0211660 3300048907 Bacteria 1850
118 Ga0496112_0460630 3300048915 Bacteria 1209
119 Ga0496113_0412201 3300048916 Bacteria 1085
120 Ga0496117_0188605 3300048920 Bacteria 1177
121 Ga0496118_0031642 3300048921 Bacteria 4380
122 Ga0496124_0244563 3300048927 Bacteria 1332
123 Ga0501048_0503232 3300049582 Bacteria 869
124 Ga0501067_0034039 3300049583 Bacteria 2827
125 Ga0501070_0194452 3300049586 Bacteria 1666
126 Ga0501072_0076847 3300049588 Bacteria 2642
127 Ga0501076_0618250 3300049592 Bacteria 894
128 Ga0501080_0131512 3300049742 Bacteria 2317
129 nmdc:mga0yw44_190955_c1 3300050492 Bacteria 1351
130 nmdc:mga0k408_299050_c1 3300050493 Bacteria 960
131 nmdc:mga0k408_58936_c1 3300050493 Bacteria 2230
132 nmdc:mga06z11_8109_c1 3300050494 Bacteria 4359
133 nmdc:mga05p37_1069119_c1 3300050507 Bacteria 849
134 nmdc:mga08y16_1766_c1 3300050511 Bacteria 21907
135 nmdc:mga0sz30_263_c1 3300050516 Bacteria 20151
136 Ga0500556_0142444 3300053104 Bacteria 943
137 Ga0500594_0328216 3300053118 Bacteria 514
138 Ga0500597_010509 3300053120 Bacteria 3309
139 Ga0500588_0098777 3300053146 Bacteria 1003
140 Ga0500604_0064363 3300053151 Bacteria 1158
141 Ga0500620_054701 3300053155 Bacteria 1347
142 Ga0501084_0018304 3300054114 Bacteria 5833
143 2509114949 2508501123 Bacteria 6283661
144 2513658337 2513237096 Bacteria 8722461
145 2513706345 2513237102 Bacteria 7703324
146 2513857588 2513237137 Bacteria 9558895
147 2513920171 2513237145 Bacteria 8979722
148 2514013735 2513237161 Bacteria 8871253
149 2517893548 2517572143 Bacteria 9484767
150 2524536048 2524023228 Bacteria 10118060
151 2599723948 2599185236 Bacteria 6875203
152 2599747507 2599185240 Bacteria 7968121
153 2600209391 2599185355 Bacteria 7968906
154 2617347318 2617270735 Bacteria 9163226
155 2671118182 2667528175 Bacteria 7532676
156 2676746061 2675903129 Bacteria 7964495
157 2776271471 2775506902 Bacteria 6208009
158 2776280019 2775506904 Bacteria 5954060
159 2793070893 2791355197 Bacteria 8420563
160 2847946771 2847939898 Bacteria 8606328
161 2879090202 2879083081 Bacteria 8587928
162 2879105700 2879099564 Bacteria 10442239
163 2881161423 2881155292 Bacteria 6461656
164 2885347034 2885342637 Bacteria 7011821
165 2885352853 2885350715 Bacteria 6787678
166 2885373522 2885366525 Bacteria 8326213
167 2888338667 2888337043 Bacteria 6629336
168 2904701585
169 2906610428
170 2908743945 2908739725 Bacteria 8628932
171 2922428928
172 2932790575 2932784394 Bacteria 9704911
173 2932810996 2932809354 Bacteria 9135765
174 2932823674 2932818245 Bacteria 9955613
175 2932830206 2932828146 Bacteria 9745859
176 2935622568 2935616580 Bacteria 9032984
177 2935635672 2935630451 Bacteria 8169952
178 2935642632 2935638405 Bacteria 10015038
179 2935668064 2935665750 Bacteria 9571747
180 2935686081 2935684952 Bacteria 9590419
181 2935701293 2935694250 Bacteria 9291695
182 2935705924 2935703347 Bacteria 10242284
183 2935714633 2935713505 Bacteria 9608509
184 2935725252 2935722832 Bacteria 9608746
185 2935732388 2935732158 Bacteria 9706831
186 2935741767 2935741537 Bacteria 9707219
187 2935752046 2935750917 Bacteria 9590372
188 2935766394 2935760218 Bacteria 9817913
189 2935802922 2935801545 Bacteria 9301974
190 2935814240 2935810662 Bacteria 9401221
191 2935831377 2935827899 Bacteria 10038562
192 2935838237 2935837841 Bacteria 9454360
193 2935860817 2935855204 Bacteria 9035059
194 2935869846 2935864058 Bacteria 9784707
195 2935878735 2935873716 Bacteria 9632195
196 2935994869 2935992306 Bacteria 9802711
197 2936003512 2936002035 Bacteria 9362176
198 2936039796 2936037263 Bacteria 9446081
199 2937828925 2937822353 Bacteria 7290551
200 2940557151 2940556831 Bacteria 9590747
201 2941509321 2941507105 Bacteria 8166816
202 2941517150 2941515067 Bacteria 8166720
203 2941524755 2941523033 Bacteria 8169134
204 2941539095 2941538514 Bacteria 9402094
205 2961133106 2961127735 Bacteria 7196641
206 2968017092 2968016561 Bacteria 7022047
207 2970470386 2970469710 Bacteria 6969209
208 8016522103 8016511872 Bacteria 9921665
209 8017063565 8017057580 Bacteria 10023680
210 8019558006 8019555841 Bacteria 9642137
211 8019567284 8019565922 Bacteria 9639779
212 8019582884 8019576017 Bacteria 10049540
213 8019590679 8019586578 Bacteria 10212056
214 8019600670 8019597564 Bacteria 10041141
215 8019617876 8019608314 Bacteria 10042931
216 8056691181 8056689827 Bacteria 6712655
217 Ga0439442_003524
218 JGI24739J22299_10034760
219 JGI25159J45721_1006432
220 JGI25151J46595_10000064
221 JGI25151J46595_10000290
222 rootH1_10055561
223 rootH1_10388260
224 JGI25160J50197_1006240
225 Ga0065165_1038035
226 Ga0070683_100128424
227 Ga0070680_100831151
228 Ga0070680_101139500
229 Ga0070669_100022043
230 Ga0070659_100053423
231 Ga0070713_100256205
232 Ga0070663_100068544
233 Ga0070681_10173395
234 Ga0070681_10268590
235 Ga0070679_100765434
236 Ga0070679_101212805
237 Ga0070696_100150249
238 Ga0070696_100485747
239 Ga0070665_100045037
240 Ga0068855_100397444
241 Ga0068855_100624359
242 Ga0068859_100410626
243 Ga0068864_101695753
244 Ga0068861_101427913
245 Ga0068860_100703526
246 Ga0068860_101069109
247 Ga0075362_10284987
248 Ga0075367_10167792
249 Ga0075369_10001033
250 Ga0075366_10327676
251 Ga0075366_10951708
252 Ga0097621_100012806
253 Ga0097621_100537202
254 Ga0075370_10082721
255 Ga0075370_10221276
256 Ga0068871_100012268
257 Ga0068871_100769084
258 Ga0075431_100004240
259 Ga0097620_100410621
260 Ga0111539_10009098
261 Ga0114129_10162285
262 Ga0105237_10202627
263 Ga0105237_10451865
264 Ga0105238_10883039
265 Ga0157370_10493933
266 Ga0157369_10516630
267 Ga0157378_11833088
268 Ga0163162_12333654
269 Ga0157372_10695063
270 Ga0157375_10536568
271 Ga0157375_10966001
272 Ga0163163_10185657
273 Ga0157380_10463995
274 Ga0157380_12990855
275 Ga0157376_10689096
276 Ga0182005_1052561
277 Ga0209130_1000868
278 Ga0209025_1000212
279 Ga0209758_1004688
280 Ga0209758_1109260
281 Ga0207426_1000102
282 Ga0207647_10373978
283 Ga0207707_10219068
284 Ga0207707_10268114
285 Ga0207707_10913447
286 Ga0207695_10060637
287 Ga0207671_10106410
288 Ga0207660_10369128
289 Ga0207660_10755178
290 Ga0207681_10055410
291 Ga0207681_11469277
292 Ga0207689_10270782
293 Ga0207661_10791861
294 Ga0207678_10228577
295 Ga0207676_10956606
296 Ga0268266_10025013
297 Ga0268264_10118380
298 Ga0265318_10000115
299 Ga0307511_10006704
300 Ga0307511_10079194
301 Ga0307408_100080928
302 Ga0307408_100578937
303 Ga0307406_10133650
304 Ga0307406_10338340
305 Ga0307407_10636294
306 Ga0307412_11186231
307 Ga0395900_0010739
308 Ga0451800_0426719
309 Ga0451839_1339528
310 Ga0439448_0062187
311 Ga0439455_0159458
312 Ga0450909_038682
313 Ga0466966_0077700
314 Ga0466966_0154850
315 Ga0466961_0020774
316 Ga0466961_0198610
317 Ga0466968_0202490
318 Ga0466970_0483113
319 Ga0466957_0008385
320 Ga0466957_0179149
321 Ga0466959_0213770
322 Ga0495664_0536616
323 Ga0495610_0009557
324 Ga0495632_0214507
325 Ga0495643_0080984
326 Ga0495648_0125985
327 Ga0495668_0449111
328 Ga0495625_0033278
329 Ga0495589_0345306
330 Ga0495593_0075214
331 Ga0496101_0641667
332 Ga0496103_0057538
333 Ga0496104_0211660
334 Ga0496112_0460630
335 Ga0496113_0412201
336 Ga0496117_0188605
337 Ga0496118_0031642
338 Ga0496124_0244563
339 Ga0501048_0503232
340 Ga0501067_0034039
341 Ga0501070_0194452
342 Ga0501072_0076847
343 Ga0501076_0618250
344 Ga0501080_0131512
345 nmdc:mga0yw44_190955_c1
346 nmdc:mga0k408_299050_c1
347 nmdc:mga0k408_58936_c1
348 nmdc:mga06z11_8109_c1
349 nmdc:mga05p37_1069119_c1
350 nmdc:mga08y16_1766_c1
351 nmdc:mga0sz30_263_c1
352 Ga0500556_0142444
353 Ga0500594_0328216
354 Ga0500597_010509
355 Ga0500588_0098777
356 Ga0500604_0064363
357 Ga0500620_054701
358 Ga0501084_0018304
359 2509114949
360 2513658337
361 2513706345
362 2513857588
363 2513920171
364 2514013735
365 2517893548
366 2524536048
367 2599723948
368 2599747507
369 2600209391
370 2617347318
371 2671118182
372 2676746061
373 2776271471
374 2776280019
375 2793070893
376 2847946771
377 2879090202
378 2879105700
379 2881161423
380 2885347034
381 2885352853
382 2885373522
383 2888338667
384 2904701585
385 2906610428
386 2908743945
387 2922428928
388 2932790575
389 2932810996
390 2932823674
391 2932830206
392 2935622568
393 2935635672
394 2935642632
395 2935668064
396 2935686081
397 2935701293
398 2935705924
399 2935714633
400 2935725252
401 2935732388
402 2935741767
403 2935752046
404 2935766394
405 2935802922
406 2935814240
407 2935831377
408 2935838237
409 2935860817
410 2935869846
411 2935878735
412 2935994869
413 2936003512
414 2936039796
415 2937828925
416 2940557151
417 2941509321
418 2941517150
419 2941524755
420 2941539095
421 2961133106
422 2968017092
423 2970470386
424 8016522103
425 8017063565
426 8019558006
427 8019567284
428 8019582884
429 8019590679
430 8019600670
431 8019617876
432 8056691181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

70

143

0.96

PF05899

Cupin_3

EutQ-like cupin domain

66

138

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9502 26 134
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9392 2 150
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9252 41 119
3h8u-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9245 41 119
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9209 41 122
ID Description Score Start End Superfamily
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9215 41 122 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9163 2 150 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9056 41 120 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9045 41 119 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9027 40 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A434VWL6-F1-model_v4 Cupin domain-containing protein 1.002 18 151 GO:0046872
AF-A0A7I8BUP5-F1-model_v4 Cupin type-2 domain-containing protein 0.999 47 150 GO:0046872
AF-Q98I83-F1-model_v4 Mll2521 protein 0.9972 1 151 GO:0046872
AF-X6CAQ3-F1-model_v4 Transcriptional regulator 0.9967 1 151 GO:0046872
AF-A0A4P2R3B7-F1-model_v4 Cupin type-2 domain-containing protein 0.9966 49 135 GO:0046872

Map