F331275

General Info

Members Datasets Scaffolds Average Seq Length
219 148 438 284

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0034663|Ga0373930_0034663_104_1018
Length 304
Sequence VKQVPIDAVPSLPIAAARRSSASVADYVALTKPRLNFLVVATSAAGYYLGVVAPFDGAAMIAAVAGTALVAGGAAVLNQLYERDTDALMRRTRSRPLPAGRVIPADAGIFGSVLSAAGLALLAARTNWLAASLALATLVVYLAVYTPMKRRTPAATLVGAVPGALPALIGWAASHGSVAIGGTALFAIVFLWQIPHFMAIAWLYRDDYGKAGFPMLPVVEPNGVRAGRQALAYAAALVPVALVPNFIGLAGSVYLVAATLLGIALLVLAVRFWRERTDASARALFFGSIIYLPLIWIVLVADKL

Samples

Sample ID Description Type Environment
1 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.2
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373930_0034663 3300034816 Bacteria 1052
2 Ga0070658_10041899 3300005327 Bacteria 3694
3 Ga0070676_10011244 3300005328 Bacteria 4867
4 Ga0070690_100028537 3300005330 Bacteria 3457
5 Ga0070666_10032029 3300005335 Bacteria 3472
6 Ga0070666_10071702 3300005335 Bacteria 2358
7 Ga0070680_100273557 3300005336 Bacteria 1430
8 Ga0070660_100005841 3300005339 Bacteria 8520
9 Ga0070689_100118848 3300005340 Bacteria 2110
10 Ga0070691_10002038 3300005341 Bacteria 8921
11 Ga0070661_100115157 3300005344 Bacteria 2010
12 Ga0070669_100016932 3300005353 Bacteria 5204
13 Ga0070669_100109712 3300005353 Bacteria 2092
14 Ga0070669_100132470 3300005353 Bacteria 1914
15 Ga0070675_100006173 3300005354 Bacteria 9188
16 Ga0070675_100335050 3300005354 Bacteria 1339
17 Ga0070671_100032906 3300005355 Bacteria 4285
18 Ga0070673_100305408 3300005364 Bacteria 1402
19 Ga0070659_100013935 3300005366 Bacteria 6000
20 Ga0070659_100093560 3300005366 Bacteria 2412
21 Ga0070667_100313373 3300005367 Bacteria 1415
22 Ga0070714_100033018 3300005435 Bacteria 4324
23 Ga0070713_100109868 3300005436 Bacteria 2402
24 Ga0070705_100010209 3300005440 Bacteria 4693
25 Ga0070705_100014502 3300005440 Bacteria 4057
26 Ga0070708_100025490 3300005445 Bacteria 5055
27 Ga0070678_100132659 3300005456 Bacteria 1982
28 Ga0070678_100522451 3300005456 Bacteria 1050
29 Ga0070662_100049430 3300005457 Bacteria 3033
30 Ga0068867_100054311 3300005459 Bacteria 2959
31 Ga0068867_100075148 3300005459 Bacteria 2534
32 Ga0070707_100296935 3300005468 Bacteria 1570
33 Ga0070707_100400164 3300005468 Bacteria 1333
34 Ga0070698_100061189 3300005471 Bacteria 3799
35 Ga0070698_100276753 3300005471 Bacteria 1610
36 Ga0070699_100260615 3300005518 Bacteria 1550
37 Ga0070679_100051964 3300005530 Bacteria 4083
38 Ga0070679_100127242 3300005530 Bacteria 2529
39 Ga0070679_100333162 3300005530 Bacteria 1466
40 Ga0070684_100260106 3300005535 Unclassified 1588
41 Ga0070697_100020164 3300005536 Bacteria 5270
42 Ga0070697_100137623 3300005536 Bacteria 2052
43 Ga0070697_100204191 3300005536 Unclassified 1680
44 Ga0070672_100050284 3300005543 Bacteria 3246
45 Ga0070672_100060026 3300005543 Bacteria 2993
46 Ga0070686_100091000 3300005544 Bacteria 2041
47 Ga0070686_100231750 3300005544 Bacteria 1340
48 Ga0070695_100014055 3300005545 Bacteria 4820
49 Ga0070695_100163180 3300005545 Bacteria 1566
50 Ga0070693_100066814 3300005547 Bacteria 2105
51 Ga0070693_100122557 3300005547 Bacteria 1614
52 Ga0070665_100004997 3300005548 Bacteria 13753
53 Ga0070665_100012795 3300005548 Bacteria 8452
54 Ga0068855_100048456 3300005563 Bacteria 5013
55 Ga0068855_100415072 3300005563 Bacteria 1473
56 Ga0070664_100087170 3300005564 Bacteria 2698
57 Ga0068854_100017835 3300005578 Bacteria 4758
58 Ga0068864_100010022 3300005618 Bacteria 7823
59 Ga0068863_100008228 3300005841 Bacteria 10190
60 Ga0068858_100001341 3300005842 Bacteria 25378
61 Ga0068858_100006021 3300005842 Bacteria 11828
62 Ga0068858_100195365 3300005842 Unclassified 1912
63 Ga0068858_100225954 3300005842 Unclassified 1774
64 Ga0068858_100485337 3300005842 Bacteria 1193
65 Ga0068860_100085186 3300005843 Bacteria 3007
66 Ga0068860_100174790 3300005843 Bacteria 2075
67 Ga0068862_100009306 3300005844 Bacteria 8134
68 Ga0068862_100130711 3300005844 Bacteria 2220
69 Ga0075367_10059187 3300006178 Bacteria 2280
70 Ga0097621_100043239 3300006237 Bacteria 3631
71 Ga0097621_100231732 3300006237 Bacteria 1612
72 Ga0097621_100273544 3300006237 Bacteria 1485
73 Ga0068871_100011894 3300006358 Bacteria 6403
74 Ga0068871_100014030 3300006358 Bacteria 5960
75 Ga0075433_10289539 3300006852 Unclassified 1451
76 Ga0075434_100060970 3300006871 Bacteria 3752
77 Ga0075434_100101330 3300006871 Bacteria 2886
78 Ga0075429_100410615 3300006880 Bacteria 1186
79 Ga0075429_100428005 3300006880 Bacteria 1159
80 Ga0068865_100026688 3300006881 Bacteria 3810
81 Ga0068865_100119889 3300006881 Bacteria 1954
82 Ga0075436_100011962 3300006914 Bacteria 5952
83 Ga0075436_100086229 3300006914 Bacteria 2180
84 Ga0075436_100115834 3300006914 Bacteria 1872
85 Ga0075435_100012822 3300007076 Bacteria 6212
86 Ga0075435_100036260 3300007076 Bacteria 3918
87 Ga0075435_100037589 3300007076 Bacteria 3856
88 Ga0105240_10066788 3300009093 Bacteria 4460
89 Ga0105240_10469469 3300009093 Bacteria 1404
90 Ga0111539_10003468 3300009094 Bacteria 20768
91 Ga0111539_10058512 3300009094 Bacteria 4572
92 Ga0111539_10637767 3300009094 Bacteria 1240
93 Ga0105245_10281193 3300009098 Bacteria 1626
94 Ga0105245_10501935 3300009098 Unclassified 1229
95 Ga0114129_10003301 3300009147 Bacteria 22655
96 Ga0114129_10311955 3300009147 Bacteria 2093
97 Ga0105243_10215758 3300009148 Bacteria 1693
98 Ga0105241_10555116 3300009174 Bacteria 1032
99 Ga0105242_10018876 3300009176 Bacteria 5400
100 Ga0105242_10058604 3300009176 Bacteria 3158
101 Ga0105248_10016893 3300009177 Bacteria 8035
102 Ga0105248_10040754 3300009177 Bacteria 5206
103 Ga0105248_10240930 3300009177 Unclassified 2036
104 Ga0105248_10561816 3300009177 Unclassified 1287
105 Ga0105248_10664788 3300009177 Bacteria 1175
106 Ga0105238_10366486 3300009551 Unclassified 1431
107 Ga0105249_10581593 3300009553 Bacteria 1173
108 Ga0105249_10755676 3300009553 Unclassified 1034
109 Ga0157374_10003656 3300013296 Bacteria 12937
110 Ga0163162_10113164 3300013306 Bacteria 2812
111 Ga0163163_10052341 3300014325 Bacteria 4028
112 Ga0157376_10018554 3300014969 Bacteria 5337
113 Ga0157376_10156281 3300014969 Bacteria 2062
114 Ga0206353_10166717 3300020082 Bacteria 1489
115 Ga0207680_10244249 3300025903 Bacteria 1238
116 Ga0207705_10047032 3300025909 Bacteria 3102
117 Ga0207684_10188328 3300025910 Bacteria 1779
118 Ga0207707_10161628 3300025912 Bacteria 1958
119 Ga0207695_10121118 3300025913 Bacteria 2584
120 Ga0207660_10229925 3300025917 Bacteria 1458
121 Ga0207657_10011114 3300025919 Bacteria 8950
122 Ga0207652_10039625 3300025921 Bacteria 3999
123 Ga0207652_10060991 3300025921 Bacteria 3256
124 Ga0207646_10249804 3300025922 Bacteria 1602
125 Ga0207681_10009628 3300025923 Bacteria 5907
126 Ga0207681_10172346 3300025923 Bacteria 1641
127 Ga0207650_10439183 3300025925 Bacteria 1085
128 Ga0207659_10002433 3300025926 Bacteria 11092
129 Ga0207687_10069966 3300025927 Bacteria 2504
130 Ga0207700_10076882 3300025928 Bacteria 2592
131 Ga0207690_10007354 3300025932 Bacteria 6536
132 Ga0207690_10153535 3300025932 Bacteria 1709
133 Ga0207690_10196549 3300025932 Bacteria 1529
134 Ga0207706_10041530 3300025933 Bacteria 4077
135 Ga0207686_10010749 3300025934 Bacteria 4987
136 Ga0207686_10088930 3300025934 Bacteria 2034
137 Ga0207670_10103666 3300025936 Bacteria 2036
138 Ga0207670_10299820 3300025936 Bacteria 1258
139 Ga0207669_10026210 3300025937 Bacteria 3167
140 Ga0207704_10069171 3300025938 Bacteria 2229
141 Ga0207691_10043120 3300025940 Bacteria 4158
142 Ga0207691_10057087 3300025940 Bacteria 3554
143 Ga0207691_10113270 3300025940 Bacteria 2410
144 Ga0207711_10012901 3300025941 Bacteria 6939
145 Ga0207711_10056453 3300025941 Bacteria 3374
146 Ga0207711_10133226 3300025941 Unclassified 2230
147 Ga0207711_10272670 3300025941 Bacteria 1557
148 Ga0207711_10306677 3300025941 Bacteria 1465
149 Ga0207661_10053200 3300025944 Bacteria 3239
150 Ga0207679_10241940 3300025945 Bacteria 1529
151 Ga0207667_10158017 3300025949 Bacteria 2332
152 Ga0207651_10104580 3300025960 Bacteria 2110
153 Ga0207668_10075980 3300025972 Bacteria 2417
154 Ga0207640_10073544 3300025981 Bacteria 2310
155 Ga0207703_10183302 3300026035 Unclassified 1849
156 Ga0207641_10001164 3300026088 Bacteria 26455
157 Ga0207648_10115142 3300026089 Bacteria 2362
158 Ga0207676_10014816 3300026095 Bacteria 5617
159 Ga0207676_10785830 3300026095 Bacteria 928
160 Ga0207675_100009675 3300026118 Bacteria 9021
161 Ga0207683_10148330 3300026121 Bacteria 2116
162 Ga0268266_10004231 3300028379 Bacteria 13821
163 Ga0268266_10201091 3300028379 Bacteria 1823
164 Ga0268265_10275224 3300028380 Bacteria 1504
165 Ga0268264_10156014 3300028381 Bacteria 2051
166 Ga0268264_10379137 3300028381 Bacteria 1354
167 Ga0268264_10651079 3300028381 Bacteria 1043
168 Ga0316579_10072520 3300031691 Bacteria 1633
169 Ga0316577_10017448 3300031733 Bacteria 3963
170 Ga0373958_0012465 3300034819 Bacteria 1454
171 Ga0373959_0003225 3300034820 Bacteria 2594
172 Ga0373928_0000258 3300035084 Bacteria 10500
173 Ga0373929_0000270 3300035085 Bacteria 9587
174 Ga0373949_0001590 3300035090 Bacteria 6402
175 Ga0373951_0005293 3300035091 Bacteria 3004
176 Ga0373939_0014237 3300035114 Bacteria 2060
177 Ga0373941_0042562 3300035115 Bacteria 1411
178 Ga0373960_0015825 3300035121 Bacteria 1931
179 Ga0373942_0002435 3300035207 Bacteria 4521
180 Ga0373961_0021736 3300035241 Bacteria 1709
181 Ga0373924_0012463 3300035410 Archaea 3177
182 Ga0373931_0001629 3300035691 Bacteria 9710
183 Ga0373927_0201122 3300035695 Bacteria 1308
184 Ga0373937_0058239 3300036401 Bacteria 3549
185 Ga0373937_0321642 3300036401 Unclassified 1464
186 Ga0316582_0265857 3300036647 Bacteria 1176
187 Ga0316584_0003683 3300036712 Bacteria 10027
188 Ga0373925_0015515 3300037068 Bacteria 5510
189 Ga0466963_0088926 3300044694 Bacteria 2101
190 Ga0495582_0011700 3300046473 Unclassified 4836
191 Ga0495645_0032779 3300046543 Bacteria 3790
192 Ga0495647_0005521 3300046681 Unclassified 4147
193 Ga0495658_0010081 3300046683 Bacteria 4720
194 Ga0495581_0254587 3300047315 Bacteria 1027
195 Ga0495674_0351380 3300047319 Unclassified 1197
196 Ga0495680_0138214 3300047322 Bacteria 1785
197 Ga0495684_0397008 3300047471 Bacteria 969
198 Ga0496102_0195579 3300048905 Bacteria 1906
199 Ga0496104_0009851 3300048907 Bacteria 8527
200 Ga0496108_0027665 3300048911 Bacteria 4687
201 Ga0496110_0266666 3300048913 Bacteria 1559
202 Ga0496112_0458930 3300048915 Bacteria 1211
203 Ga0496113_0226089 3300048916 Bacteria 1492
204 Ga0496115_0365903 3300048918 Bacteria 1174
205 Ga0501072_0180109 3300049588 Bacteria 1686
206 nmdc:mga05p37_121277_c1 3300050507 Bacteria 3212
207 nmdc:mga05p37_26054_c1 3300050507 Bacteria 7110
208 nmdc:mga05p37_996100_c1 3300050507 Unclassified 891
209 nmdc:mga08y16_434443_c1 3300050511 Bacteria 1341
210 nmdc:mga08y16_47289_c1 3300050511 Bacteria 4503
211 nmdc:mga0n895_45763_c1 3300050512 Unclassified 4272
212 nmdc:mga0n895_459125_c1 3300050512 Bacteria 1286
213 nmdc:mga0rr50_11528_c1 3300050513 Bacteria 5665
214 nmdc:mga0rr50_199088_c1 3300050513 Bacteria 1645
215 nmdc:mga0rr50_34527_c1 3300050513 Bacteria 3623
216 nmdc:mga08x19_23270_c1 3300050514 Bacteria 3843
217 nmdc:mga0a205_98588_c1 3300050515 Unclassified 2821
218 Ga0495619_0166822 3300053085 Unclassified 1522
219 Ga0501082_0048076 3300060353 Bacteria 3677
220 Ga0373930_0034663
221 Ga0070658_10041899
222 Ga0070676_10011244
223 Ga0070690_100028537
224 Ga0070666_10032029
225 Ga0070666_10071702
226 Ga0070680_100273557
227 Ga0070660_100005841
228 Ga0070689_100118848
229 Ga0070691_10002038
230 Ga0070661_100115157
231 Ga0070669_100016932
232 Ga0070669_100109712
233 Ga0070669_100132470
234 Ga0070675_100006173
235 Ga0070675_100335050
236 Ga0070671_100032906
237 Ga0070673_100305408
238 Ga0070659_100013935
239 Ga0070659_100093560
240 Ga0070667_100313373
241 Ga0070714_100033018
242 Ga0070713_100109868
243 Ga0070705_100010209
244 Ga0070705_100014502
245 Ga0070708_100025490
246 Ga0070678_100132659
247 Ga0070678_100522451
248 Ga0070662_100049430
249 Ga0068867_100054311
250 Ga0068867_100075148
251 Ga0070707_100296935
252 Ga0070707_100400164
253 Ga0070698_100061189
254 Ga0070698_100276753
255 Ga0070699_100260615
256 Ga0070679_100051964
257 Ga0070679_100127242
258 Ga0070679_100333162
259 Ga0070684_100260106
260 Ga0070697_100020164
261 Ga0070697_100137623
262 Ga0070697_100204191
263 Ga0070672_100050284
264 Ga0070672_100060026
265 Ga0070686_100091000
266 Ga0070686_100231750
267 Ga0070695_100014055
268 Ga0070695_100163180
269 Ga0070693_100066814
270 Ga0070693_100122557
271 Ga0070665_100004997
272 Ga0070665_100012795
273 Ga0068855_100048456
274 Ga0068855_100415072
275 Ga0070664_100087170
276 Ga0068854_100017835
277 Ga0068864_100010022
278 Ga0068863_100008228
279 Ga0068858_100001341
280 Ga0068858_100006021
281 Ga0068858_100195365
282 Ga0068858_100225954
283 Ga0068858_100485337
284 Ga0068860_100085186
285 Ga0068860_100174790
286 Ga0068862_100009306
287 Ga0068862_100130711
288 Ga0075367_10059187
289 Ga0097621_100043239
290 Ga0097621_100231732
291 Ga0097621_100273544
292 Ga0068871_100011894
293 Ga0068871_100014030
294 Ga0075433_10289539
295 Ga0075434_100060970
296 Ga0075434_100101330
297 Ga0075429_100410615
298 Ga0075429_100428005
299 Ga0068865_100026688
300 Ga0068865_100119889
301 Ga0075436_100011962
302 Ga0075436_100086229
303 Ga0075436_100115834
304 Ga0075435_100012822
305 Ga0075435_100036260
306 Ga0075435_100037589
307 Ga0105240_10066788
308 Ga0105240_10469469
309 Ga0111539_10003468
310 Ga0111539_10058512
311 Ga0111539_10637767
312 Ga0105245_10281193
313 Ga0105245_10501935
314 Ga0114129_10003301
315 Ga0114129_10311955
316 Ga0105243_10215758
317 Ga0105241_10555116
318 Ga0105242_10018876
319 Ga0105242_10058604
320 Ga0105248_10016893
321 Ga0105248_10040754
322 Ga0105248_10240930
323 Ga0105248_10561816
324 Ga0105248_10664788
325 Ga0105238_10366486
326 Ga0105249_10581593
327 Ga0105249_10755676
328 Ga0157374_10003656
329 Ga0163162_10113164
330 Ga0163163_10052341
331 Ga0157376_10018554
332 Ga0157376_10156281
333 Ga0206353_10166717
334 Ga0207680_10244249
335 Ga0207705_10047032
336 Ga0207684_10188328
337 Ga0207707_10161628
338 Ga0207695_10121118
339 Ga0207660_10229925
340 Ga0207657_10011114
341 Ga0207652_10039625
342 Ga0207652_10060991
343 Ga0207646_10249804
344 Ga0207681_10009628
345 Ga0207681_10172346
346 Ga0207650_10439183
347 Ga0207659_10002433
348 Ga0207687_10069966
349 Ga0207700_10076882
350 Ga0207690_10007354
351 Ga0207690_10153535
352 Ga0207690_10196549
353 Ga0207706_10041530
354 Ga0207686_10010749
355 Ga0207686_10088930
356 Ga0207670_10103666
357 Ga0207670_10299820
358 Ga0207669_10026210
359 Ga0207704_10069171
360 Ga0207691_10043120
361 Ga0207691_10057087
362 Ga0207691_10113270
363 Ga0207711_10012901
364 Ga0207711_10056453
365 Ga0207711_10133226
366 Ga0207711_10272670
367 Ga0207711_10306677
368 Ga0207661_10053200
369 Ga0207679_10241940
370 Ga0207667_10158017
371 Ga0207651_10104580
372 Ga0207668_10075980
373 Ga0207640_10073544
374 Ga0207703_10183302
375 Ga0207641_10001164
376 Ga0207648_10115142
377 Ga0207676_10014816
378 Ga0207676_10785830
379 Ga0207675_100009675
380 Ga0207683_10148330
381 Ga0268266_10004231
382 Ga0268266_10201091
383 Ga0268265_10275224
384 Ga0268264_10156014
385 Ga0268264_10379137
386 Ga0268264_10651079
387 Ga0316579_10072520
388 Ga0316577_10017448
389 Ga0373958_0012465
390 Ga0373959_0003225
391 Ga0373928_0000258
392 Ga0373929_0000270
393 Ga0373949_0001590
394 Ga0373951_0005293
395 Ga0373939_0014237
396 Ga0373941_0042562
397 Ga0373960_0015825
398 Ga0373942_0002435
399 Ga0373961_0021736
400 Ga0373924_0012463
401 Ga0373931_0001629
402 Ga0373927_0201122
403 Ga0373937_0058239
404 Ga0373937_0321642
405 Ga0316582_0265857
406 Ga0316584_0003683
407 Ga0373925_0015515
408 Ga0466963_0088926
409 Ga0495582_0011700
410 Ga0495645_0032779
411 Ga0495647_0005521
412 Ga0495658_0010081
413 Ga0495581_0254587
414 Ga0495674_0351380
415 Ga0495680_0138214
416 Ga0495684_0397008
417 Ga0496102_0195579
418 Ga0496104_0009851
419 Ga0496108_0027665
420 Ga0496110_0266666
421 Ga0496112_0458930
422 Ga0496113_0226089
423 Ga0496115_0365903
424 Ga0501072_0180109
425 nmdc:mga05p37_121277_c1
426 nmdc:mga05p37_26054_c1
427 nmdc:mga05p37_996100_c1
428 nmdc:mga08y16_434443_c1
429 nmdc:mga08y16_47289_c1
430 nmdc:mga0n895_45763_c1
431 nmdc:mga0n895_459125_c1
432 nmdc:mga0rr50_11528_c1
433 nmdc:mga0rr50_199088_c1
434 nmdc:mga0rr50_34527_c1
435 nmdc:mga08x19_23270_c1
436 nmdc:mga0a205_98588_c1
437 Ga0495619_0166822
438 Ga0501082_0048076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

39

290

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7873 23 284
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7416 23 284
3foo-assembly1.cif.gz_C a triangular cytochrome b562 superstructure mediated by ni coordination - monoclinic form 0.7219 206 272
6wz1-assembly1.cif.gz_B mn-bound structure of an engineered protein trimer, tricyt3 0.6851 206 273
8dz8-assembly2.cif.gz_B neoleukin 4, a de novo designed il-4 mimetic 0.6717 170 273
ID Description Score Start End Superfamily
af_F1LVF4_308_442_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9165 164 285 1.20.120.550
af_Q12887_331_443_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8948 184 285 1.20.1070.10
af_K8ES01_244_397_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8941 163 284 1.20.120.550
af_P0AEA5_183_296_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8882 186 286 1.20.1070.10
af_Q4DK79_238_388_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8859 169 286 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A534TWM3-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9674 145 286 GO:0005886
GO:0006783
GO:0008495
AF-A0A7Y4TFG4-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.961 151 284 GO:0005886
GO:0006783
GO:0008495
AF-A0A7C2LAC4-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9599 164 286 GO:0006784
GO:0008495
GO:0016020
AF-A0A357F415-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9565 149 284 GO:0006784
GO:0008495
GO:0016020
AF-A0A351ZYX4-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9555 145 286 GO:0006783
GO:0008495
GO:0016020

Map