F330840

General Info

Members Datasets Scaffolds Average Seq Length
219 140 438 403

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100046949|Ga0070699_1000469492
Length 482
Sequence MDAMLKLHQYLRPATGLARKQLACVTWNEILGRHSNTSLIQSVCQRTIKMILQVAKIVNAACFPVKYCCLPRYLILLGLTLLLIPTTGCRMTEKTEKLPATPQENSKTDNAIAIHRRAIAIDMHADTTQRLVDEKVDIQERLPDGHFDSVRAREGELDAQFFSIWVEPQLFGGGGPGAMKRADDQIAAVRELTEKHPDTWQFATSAADVRRIVSEGKMAALTGLEGGYAVDEKLENVERYYRLGVRYMSPAWSVSTSWAGSSGDSTGQTRGLNEFGKNVIREMNRLGMMVDVSHVSDKTFWDIVNNSTKPVIATHSGCRAIANVPRNLTDDMIRALAKTGGVVNVIFYPEHLEPGWSEKKKRVDAEIAPLVERASEEEQRDAVHKKIAGDRVRTEEYANRLPRVTVSRLVDHIDHVVKLVGIEHVGIGSDFDGVQSTLSDLXXXXELPNLTRELVKRGYSESDIDKILGGNMLRVMEAVERK

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
134 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
135 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
136 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100046949 3300005518 Bacteria 3736
2 JGI24748J21848_1000002 3300002074 Bacteria 426946
3 JGI24034J26672_10000004 3300002239 Bacteria 426946
4 JGI25406J46586_10001998 3300003203 Bacteria 9630
5 JGI25406J46586_10008511 3300003203 Bacteria 4641
6 Ga0065715_10105749 3300005293 Bacteria 2874
7 Ga0065715_10106168 3300005293 Bacteria 2846
8 Ga0065715_10116780 3300005293 Bacteria 2369
9 Ga0065715_10123874 3300005293 Unclassified 2163
10 Ga0070690_100001912 3300005330 Bacteria 11054
11 Ga0070670_100004969 3300005331 Bacteria 11184
12 Ga0070670_100056298 3300005331 Unclassified 3374
13 Ga0068869_100146826 3300005334 Bacteria 1826
14 Ga0070666_10072383 3300005335 Bacteria 2347
15 Ga0070680_100001278 3300005336 Bacteria 18191
16 Ga0070680_100036229 3300005336 Bacteria 3985
17 Ga0070689_100058889 3300005340 Bacteria 2984
18 Ga0070661_100038296 3300005344 Bacteria 3490
19 Ga0070668_100157955 3300005347 Bacteria 1838
20 Ga0070669_100003433 3300005353 Bacteria 11416
21 Ga0070669_100009968 3300005353 Bacteria 6757
22 Ga0070675_100059132 3300005354 Bacteria 3161
23 Ga0070675_100108181 3300005354 Bacteria 2348
24 Ga0070671_100107114 3300005355 Bacteria 2347
25 Ga0070671_100139504 3300005355 Bacteria 2045
26 Ga0070674_100066545 3300005356 Unclassified 2532
27 Ga0070673_100049174 3300005364 Bacteria 3292
28 Ga0070673_100055452 3300005364 Bacteria 3123
29 Ga0070688_100074629 3300005365 Bacteria 2178
30 Ga0070659_100003624 3300005366 Bacteria 10995
31 Ga0070667_100026642 3300005367 Bacteria 4809
32 Ga0070700_100004329 3300005441 Bacteria 7406
33 Ga0070700_100020332 3300005441 Bacteria 3844
34 Ga0070694_100024271 3300005444 Bacteria 3913
35 Ga0070694_100163634 3300005444 Bacteria 1634
36 Ga0070708_100074093 3300005445 Bacteria 3070
37 Ga0070678_100029552 3300005456 Bacteria 3755
38 Ga0070662_100043358 3300005457 Bacteria 3219
39 Ga0070681_10000089 3300005458 Bacteria 68795
40 Ga0070681_10001309 3300005458 Bacteria 21729
41 Ga0068867_100036669 3300005459 Bacteria 3561
42 Ga0068867_100111079 3300005459 Bacteria 2106
43 Ga0070685_10030852 3300005466 Bacteria 2990
44 Ga0070706_100000555 3300005467 Bacteria 43489
45 Ga0070707_100089437 3300005468 Unclassified 2980
46 Ga0070707_100144254 3300005468 Bacteria 2317
47 Ga0070698_100008555 3300005471 Bacteria 11046
48 Ga0070698_100012899 3300005471 Bacteria 8850
49 Ga0070698_100017660 3300005471 Bacteria 7515
50 Ga0070698_100032323 3300005471 Bacteria 5421
51 Ga0070698_100272250 3300005471 Bacteria 1625
52 Ga0070679_100000014 3300005530 Bacteria 150481
53 Ga0070697_100000229 3300005536 Bacteria 45809
54 Ga0070686_100004448 3300005544 Bacteria 7732
55 Ga0070686_100035601 3300005544 Unclassified 3076
56 Ga0070695_100100213 3300005545 Bacteria 1950
57 Ga0070696_100129809 3300005546 Bacteria 1833
58 Ga0070693_100121415 3300005547 Unclassified 1621
59 Ga0070704_100004376 3300005549 Bacteria 8157
60 Ga0070704_100038886 3300005549 Bacteria 3262
61 Ga0070704_100060806 3300005549 Bacteria 2700
62 Ga0070704_100094816 3300005549 Bacteria 2234
63 Ga0070664_100001461 3300005564 Bacteria 18822
64 Ga0070664_100111793 3300005564 Bacteria 2385
65 Ga0068857_100007545 3300005577 Bacteria 9362
66 Ga0068857_100048328 3300005577 Bacteria 3777
67 Ga0070702_100076346 3300005615 Bacteria 1994
68 Ga0068859_100039875 3300005617 Bacteria 4713
69 Ga0068859_100058581 3300005617 Bacteria 3880
70 Ga0068859_100061685 3300005617 Bacteria 3778
71 Ga0068859_100068993 3300005617 Bacteria 3570
72 Ga0068864_100019884 3300005618 Bacteria 5614
73 Ga0068864_100024403 3300005618 Bacteria 5087
74 Ga0068864_100186010 3300005618 Bacteria 1901
75 Ga0068866_10015514 3300005718 Unclassified 3385
76 Ga0068861_100026992 3300005719 Bacteria 4179
77 Ga0068858_100000067 3300005842 Bacteria 106455
78 Ga0068858_100030627 3300005842 Bacteria 4996
79 Ga0068860_100006275 3300005843 Bacteria 11939
80 Ga0068862_100015533 3300005844 Bacteria 6323
81 Ga0068862_100015730 3300005844 Bacteria 6288
82 Ga0068862_100036463 3300005844 Bacteria 4168
83 Ga0081539_10000502 3300005985 Bacteria 82098
84 Ga0081539_10000681 3300005985 Bacteria 68157
85 Ga0081539_10001231 3300005985 Bacteria 45721
86 Ga0081539_10002474 3300005985 Bacteria 25999
87 Ga0070716_100076927 3300006173 Bacteria 1979
88 Ga0097621_100012990 3300006237 Bacteria 6189
89 Ga0097621_100015060 3300006237 Bacteria 5806
90 Ga0068871_100106815 3300006358 Bacteria 2350
91 Ga0075430_100009542 3300006846 Bacteria 8200
92 Ga0075431_100118905 3300006847 Bacteria 2727
93 Ga0075433_10054150 3300006852 Bacteria 3500
94 Ga0075433_10070139 3300006852 Bacteria 3080
95 Ga0075434_100114922 3300006871 Bacteria 2704
96 Ga0075434_100140849 3300006871 Bacteria 2431
97 Ga0075429_100045815 3300006880 Bacteria 3805
98 Ga0075436_100003151 3300006914 Bacteria 11311
99 Ga0097620_100039874 3300006931 Bacteria 4713
100 Ga0097620_100058581 3300006931 Bacteria 3880
101 Ga0097620_100061684 3300006931 Bacteria 3778
102 Ga0097620_100068995 3300006931 Bacteria 3570
103 Ga0097620_100121873 3300006931 Bacteria 2674
104 Ga0075435_100045622 3300007076 Bacteria 3514
105 Ga0105240_10049384 3300009093 Bacteria 5310
106 Ga0111539_10002599 3300009094 Bacteria 23915
107 Ga0105247_10000005 3300009101 Bacteria 426989
108 Ga0114129_10002464 3300009147 Bacteria 25702
109 Ga0105241_10031601 3300009174 Bacteria 3964
110 Ga0105242_10003019 3300009176 Bacteria 13155
111 Ga0105242_10023919 3300009176 Bacteria 4821
112 Ga0105242_10149278 3300009176 Bacteria 2037
113 Ga0105248_10011949 3300009177 Bacteria 9576
114 Ga0105248_10024677 3300009177 Bacteria 6686
115 Ga0105248_10043006 3300009177 Bacteria 5066
116 Ga0105237_10056226 3300009545 Bacteria 3939
117 Ga0105238_10052159 3300009551 Bacteria 4113
118 Ga0105249_10020743 3300009553 Bacteria 5876
119 Ga0105249_10028941 3300009553 Bacteria 5001
120 Ga0105239_10227031 3300010375 Bacteria 2095
121 Ga0157373_10024481 3300013100 Bacteria 4372
122 Ga0157374_10160699 3300013296 Bacteria 2188
123 Ga0157378_10001471 3300013297 Bacteria 21265
124 Ga0157378_10002220 3300013297 Bacteria 17217
125 Ga0157378_10019613 3300013297 Bacteria 5943
126 Ga0163162_10004769 3300013306 Bacteria 13086
127 Ga0163162_10025506 3300013306 Bacteria 5841
128 Ga0163162_10096062 3300013306 Bacteria 3051
129 Ga0157372_10059621 3300013307 Bacteria 4269
130 Ga0157375_10012209 3300013308 Bacteria 7615
131 Ga0157375_10027405 3300013308 Bacteria 5325
132 Ga0157375_10030170 3300013308 Bacteria 5110
133 Ga0163163_10001238 3300014325 Bacteria 21569
134 Ga0163163_10049383 3300014325 Bacteria 4141
135 Ga0157380_10008210 3300014326 Bacteria 7440
136 Ga0157380_10013827 3300014326 Bacteria 5895
137 Ga0157380_10028500 3300014326 Bacteria 4258
138 Ga0157380_10043460 3300014326 Bacteria 3519
139 Ga0157376_10011605 3300014969 Bacteria 6504
140 Ga0163161_10056930 3300017792 Unclassified 2840
141 Ga0207672_1000026 3300025223 Bacteria 18650
142 Ga0207653_10000026 3300025885 Bacteria 114420
143 Ga0207653_10004337 3300025885 Bacteria 4457
144 Ga0207642_10010410 3300025899 Unclassified 3277
145 Ga0207642_10037260 3300025899 Bacteria 2094
146 Ga0207710_10000004 3300025900 Bacteria 846540
147 Ga0207647_10004263 3300025904 Bacteria 10604
148 Ga0207647_10045245 3300025904 Bacteria 2746
149 Ga0207643_10003978 3300025908 Bacteria 7959
150 Ga0207684_10000085 3300025910 Bacteria 175922
151 Ga0207684_10011652 3300025910 Bacteria 7676
152 Ga0207654_10016433 3300025911 Bacteria 3854
153 Ga0207707_10000016 3300025912 Bacteria 256002
154 Ga0207662_10066226 3300025918 Bacteria 2176
155 Ga0207652_10000126 3300025921 Bacteria 82522
156 Ga0207652_10111667 3300025921 Bacteria 2424
157 Ga0207646_10000403 3300025922 Bacteria 57913
158 Ga0207646_10085632 3300025922 Bacteria 2819
159 Ga0207681_10011622 3300025923 Bacteria 5411
160 Ga0207681_10058752 3300025923 Bacteria 2634
161 Ga0207650_10011248 3300025925 Bacteria 6156
162 Ga0207644_10011795 3300025931 Bacteria 5787
163 Ga0207686_10008321 3300025934 Bacteria 5596
164 Ga0207686_10046816 3300025934 Bacteria 2670
165 Ga0207709_10000642 3300025935 Bacteria 28466
166 Ga0207670_10001382 3300025936 Bacteria 12758
167 Ga0207704_10095003 3300025938 Bacteria 1970
168 Ga0207665_10032142 3300025939 Bacteria 3475
169 Ga0207691_10028832 3300025940 Bacteria 5195
170 Ga0207711_10070994 3300025941 Bacteria 3021
171 Ga0207711_10075250 3300025941 Bacteria 2938
172 Ga0207711_10167178 3300025941 Unclassified 1994
173 Ga0207689_10013530 3300025942 Bacteria 6966
174 Ga0207689_10020896 3300025942 Bacteria 5504
175 Ga0207689_10064639 3300025942 Bacteria 3010
176 Ga0207689_10158915 3300025942 Bacteria 1863
177 Ga0207679_10077733 3300025945 Bacteria 2526
178 Ga0207651_10033992 3300025960 Bacteria 3296
179 Ga0207651_10034964 3300025960 Bacteria 3261
180 Ga0207651_10080381 3300025960 Bacteria 2346
181 Ga0207712_10109229 3300025961 Bacteria 2071
182 Ga0207658_10112320 3300025986 Bacteria 2156
183 Ga0207703_10000360 3300026035 Bacteria 48744
184 Ga0207708_10004754 3300026075 Bacteria 9994
185 Ga0207708_10010061 3300026075 Bacteria 7021
186 Ga0207708_10049037 3300026075 Bacteria 3215
187 Ga0207708_10072269 3300026075 Bacteria 2643
188 Ga0207648_10005665 3300026089 Bacteria 12538
189 Ga0207676_10044524 3300026095 Bacteria 3424
190 Ga0207675_100018870 3300026118 Bacteria 6436
191 Ga0207675_100022374 3300026118 Bacteria 5887
192 Ga0207675_100224136 3300026118 Bacteria 1812
193 Ga0207683_10021495 3300026121 Bacteria 5526
194 Ga0268265_10048402 3300028380 Bacteria 3191
195 Ga0268264_10072197 3300028381 Bacteria 2926
196 Ga0307405_10045823 3300031731 Unclassified 2682
197 Ga0373941_0005516 3300035115 Bacteria 2982
198 Ga0439458_0003062 3300042157 Bacteria 3986
199 Ga0439434_0008904 3300042435 Bacteria 2950
200 Ga0453683_0013185 3300044673 Bacteria 5402
201 Ga0451576_0280079 3300045051 Unclassified 1744
202 Ga0495630_0062775 3300046517 Unclassified 2791
203 Ga0495632_0061966 3300046519 Unclassified 1814
204 Ga0496104_0047278 3300048907 Bacteria 4056
205 Ga0496106_0050269 3300048909 Bacteria 3142
206 Ga0496110_0060316 3300048913 Bacteria 3345
207 Ga0501038_0012113 3300049574 Bacteria 7877
208 Ga0501233_004284 3300049668 Unclassified 2606
209 Ga0501233_004757 3300049668 Bacteria 2504
210 Ga0501260_001915 3300049689 Bacteria 1757
211 Ga0501225_0003086 3300049705 Bacteria 5088
212 Ga0501234_004712 3300049707 Bacteria 2139
213 Ga0501270_001665 3300049767 Bacteria 2174
214 Ga0501279_001659 3300049775 Bacteria 2926
215 Ga0501212_001437 3300049851 Bacteria 2686
216 nmdc:mga05p37_54600_c1 3300050507 Bacteria 4914
217 nmdc:mga08x19_5094_c1 3300050514 Bacteria 7771
218 nmdc:mga0a205_25664_c1 3300050515 Bacteria 5616
219 Ga0530510_0023754 3300061734 Bacteria 4370
220 Ga0070699_100046949
221 JGI24748J21848_1000002
222 JGI24034J26672_10000004
223 JGI25406J46586_10001998
224 JGI25406J46586_10008511
225 Ga0065715_10105749
226 Ga0065715_10106168
227 Ga0065715_10116780
228 Ga0065715_10123874
229 Ga0070690_100001912
230 Ga0070670_100004969
231 Ga0070670_100056298
232 Ga0068869_100146826
233 Ga0070666_10072383
234 Ga0070680_100001278
235 Ga0070680_100036229
236 Ga0070689_100058889
237 Ga0070661_100038296
238 Ga0070668_100157955
239 Ga0070669_100003433
240 Ga0070669_100009968
241 Ga0070675_100059132
242 Ga0070675_100108181
243 Ga0070671_100107114
244 Ga0070671_100139504
245 Ga0070674_100066545
246 Ga0070673_100049174
247 Ga0070673_100055452
248 Ga0070688_100074629
249 Ga0070659_100003624
250 Ga0070667_100026642
251 Ga0070700_100004329
252 Ga0070700_100020332
253 Ga0070694_100024271
254 Ga0070694_100163634
255 Ga0070708_100074093
256 Ga0070678_100029552
257 Ga0070662_100043358
258 Ga0070681_10000089
259 Ga0070681_10001309
260 Ga0068867_100036669
261 Ga0068867_100111079
262 Ga0070685_10030852
263 Ga0070706_100000555
264 Ga0070707_100089437
265 Ga0070707_100144254
266 Ga0070698_100008555
267 Ga0070698_100012899
268 Ga0070698_100017660
269 Ga0070698_100032323
270 Ga0070698_100272250
271 Ga0070679_100000014
272 Ga0070697_100000229
273 Ga0070686_100004448
274 Ga0070686_100035601
275 Ga0070695_100100213
276 Ga0070696_100129809
277 Ga0070693_100121415
278 Ga0070704_100004376
279 Ga0070704_100038886
280 Ga0070704_100060806
281 Ga0070704_100094816
282 Ga0070664_100001461
283 Ga0070664_100111793
284 Ga0068857_100007545
285 Ga0068857_100048328
286 Ga0070702_100076346
287 Ga0068859_100039875
288 Ga0068859_100058581
289 Ga0068859_100061685
290 Ga0068859_100068993
291 Ga0068864_100019884
292 Ga0068864_100024403
293 Ga0068864_100186010
294 Ga0068866_10015514
295 Ga0068861_100026992
296 Ga0068858_100000067
297 Ga0068858_100030627
298 Ga0068860_100006275
299 Ga0068862_100015533
300 Ga0068862_100015730
301 Ga0068862_100036463
302 Ga0081539_10000502
303 Ga0081539_10000681
304 Ga0081539_10001231
305 Ga0081539_10002474
306 Ga0070716_100076927
307 Ga0097621_100012990
308 Ga0097621_100015060
309 Ga0068871_100106815
310 Ga0075430_100009542
311 Ga0075431_100118905
312 Ga0075433_10054150
313 Ga0075433_10070139
314 Ga0075434_100114922
315 Ga0075434_100140849
316 Ga0075429_100045815
317 Ga0075436_100003151
318 Ga0097620_100039874
319 Ga0097620_100058581
320 Ga0097620_100061684
321 Ga0097620_100068995
322 Ga0097620_100121873
323 Ga0075435_100045622
324 Ga0105240_10049384
325 Ga0111539_10002599
326 Ga0105247_10000005
327 Ga0114129_10002464
328 Ga0105241_10031601
329 Ga0105242_10003019
330 Ga0105242_10023919
331 Ga0105242_10149278
332 Ga0105248_10011949
333 Ga0105248_10024677
334 Ga0105248_10043006
335 Ga0105237_10056226
336 Ga0105238_10052159
337 Ga0105249_10020743
338 Ga0105249_10028941
339 Ga0105239_10227031
340 Ga0157373_10024481
341 Ga0157374_10160699
342 Ga0157378_10001471
343 Ga0157378_10002220
344 Ga0157378_10019613
345 Ga0163162_10004769
346 Ga0163162_10025506
347 Ga0163162_10096062
348 Ga0157372_10059621
349 Ga0157375_10012209
350 Ga0157375_10027405
351 Ga0157375_10030170
352 Ga0163163_10001238
353 Ga0163163_10049383
354 Ga0157380_10008210
355 Ga0157380_10013827
356 Ga0157380_10028500
357 Ga0157380_10043460
358 Ga0157376_10011605
359 Ga0163161_10056930
360 Ga0207672_1000026
361 Ga0207653_10000026
362 Ga0207653_10004337
363 Ga0207642_10010410
364 Ga0207642_10037260
365 Ga0207710_10000004
366 Ga0207647_10004263
367 Ga0207647_10045245
368 Ga0207643_10003978
369 Ga0207684_10000085
370 Ga0207684_10011652
371 Ga0207654_10016433
372 Ga0207707_10000016
373 Ga0207662_10066226
374 Ga0207652_10000126
375 Ga0207652_10111667
376 Ga0207646_10000403
377 Ga0207646_10085632
378 Ga0207681_10011622
379 Ga0207681_10058752
380 Ga0207650_10011248
381 Ga0207644_10011795
382 Ga0207686_10008321
383 Ga0207686_10046816
384 Ga0207709_10000642
385 Ga0207670_10001382
386 Ga0207704_10095003
387 Ga0207665_10032142
388 Ga0207691_10028832
389 Ga0207711_10070994
390 Ga0207711_10075250
391 Ga0207711_10167178
392 Ga0207689_10013530
393 Ga0207689_10020896
394 Ga0207689_10064639
395 Ga0207689_10158915
396 Ga0207679_10077733
397 Ga0207651_10033992
398 Ga0207651_10034964
399 Ga0207651_10080381
400 Ga0207712_10109229
401 Ga0207658_10112320
402 Ga0207703_10000360
403 Ga0207708_10004754
404 Ga0207708_10010061
405 Ga0207708_10049037
406 Ga0207708_10072269
407 Ga0207648_10005665
408 Ga0207676_10044524
409 Ga0207675_100018870
410 Ga0207675_100022374
411 Ga0207675_100224136
412 Ga0207683_10021495
413 Ga0268265_10048402
414 Ga0268264_10072197
415 Ga0307405_10045823
416 Ga0373941_0005516
417 Ga0439458_0003062
418 Ga0439434_0008904
419 Ga0453683_0013185
420 Ga0451576_0280079
421 Ga0495630_0062775
422 Ga0495632_0061966
423 Ga0496104_0047278
424 Ga0496106_0050269
425 Ga0496110_0060316
426 Ga0501038_0012113
427 Ga0501233_004284
428 Ga0501233_004757
429 Ga0501260_001915
430 Ga0501225_0003086
431 Ga0501234_004712
432 Ga0501270_001665
433 Ga0501279_001659
434 Ga0501212_001437
435 nmdc:mga05p37_54600_c1
436 nmdc:mga08x19_5094_c1
437 nmdc:mga0a205_25664_c1
438 Ga0530510_0023754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01244

Peptidase_M19

Membrane dipeptidase (Peptidase family M19)

113

478

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1itq-assembly1.cif.gz_A human renal dipeptidase 0.8692 39 389
3neh-assembly2.cif.gz_B crystal structure of the protein lmo2462 from listeria monocytogenes complexed with zn and phosphonate mimic of dipeptide l-leu-d-ala 0.8652 46 384
3lu2-assembly1.cif.gz_A structure of lmo2462, a listeria monocytogenes amidohydrolase family putative dipeptidase 0.8595 46 384
3neh-assembly2.cif.gz_B crystal structure of the protein lmo2462 from listeria monocytogenes complexed with zn and phosphonate mimic of dipeptide l-leu-d-ala 0.8545 46 384
3id7-assembly1.cif.gz_A crystal structure of renal dipeptidase from streptomyces coelicolor a3(2) 0.854 39 389
ID Description Score Start End Superfamily
af_F1QFU9_23_390_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.874 39 389 3.20.20.140
af_E7FBC7_31_399_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8705 39 389 3.20.20.140
3nehA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8554 46 384 3.20.20.140
3k5xA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8533 39 389 3.20.20.140
af_Q9VPG0_118_451_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8485 40 389 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7R9IUE5-F1-model_v4 Dipeptidase (EC 3.4.13.19) 0.9799 185 261 GO:0006508
GO:0046872
GO:0070573
GO:0098552
AF-A0A7W0XEI6-F1-model_v4 Membrane dipeptidase 0.9686 98 191 GO:0006508
GO:0070573
AF-A0A256WMH3-F1-model_v4 Membrane dipeptidase 0.9647 86 251 GO:0006508
GO:0070573
AF-A0A6N9W1D9-F1-model_v4 deleted 0.9633 87 389
AF-X1GQR5-F1-model_v4 Membrane dipeptidase 0.9631 124 387 GO:0006508
GO:0070573

Map