F328919

General Info

Members Datasets Scaffolds Average Seq Length
217 160 434 429

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10002659|Ga0265314_1000265912
Length 452
Sequence MNDQTQQPLDSAAYGPFVSRRKPISRRQLLRGAGIAMALPFLDSMIKPFGRLAKAASPLSPDATPRRMFGICNNLGVLHEPFFPKDTGRNYTLSPYLEFLKEHRNDFTVMSGVSHPYVDGGHPTDIAFLTAAPHPASSSFRNSISLDQHIAERIGTLTRFPSLTLSVNGGARGLSWTGTGVAIPPEEKASSVFNQLFLQGTPEEVQTQIRALDTGKSILDVVADQASALQRNLGTRDRGRLDQYFSSVRDLEHRLQESKGWESKPKPVVNEAPPVDPTSPAQYMAKVKVMYDLVRLSFETDSTRAITLMLNSVATPVVQIDGETLTDSYHNLSHHGMAPDKLSQLKILDEWHMKLLAELFTHLKGVREGDETLMERTMILFGSNLGDANAHSTVNMPMLFAGGGFRHGQHLAFDTSNNYPLPNLFVSMLQRMGIEEDKFASSTGTMRGLDVA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.38
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 13.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10002659 3300031711 Bacteria 17925
2 JGI25406J46586_10008420 3300003203 Bacteria 4674
3 rootL2_10010896 3300003322 Bacteria 3387
4 Ga0070658_10001434 3300005327 Bacteria 20321
5 Ga0070658_10223218 3300005327 Bacteria 1594
6 Ga0070683_100053139 3300005329 Unclassified 3754
7 Ga0070690_100023418 3300005330 Bacteria 3787
8 Ga0070690_100105050 3300005330 Bacteria 1877
9 Ga0070677_10006054 3300005333 Bacteria 4009
10 Ga0070666_10069589 3300005335 Unclassified 2393
11 Ga0070682_100040311 3300005337 Bacteria 2873
12 Ga0070689_100014108 3300005340 Bacteria 5796
13 Ga0070689_100025175 3300005340 Bacteria 4469
14 Ga0070675_100008156 3300005354 Bacteria 8116
15 Ga0070673_100034671 3300005364 Bacteria 3821
16 Ga0070688_100074659 3300005365 Bacteria 2178
17 Ga0070667_100178701 3300005367 Bacteria 1876
18 Ga0070711_100050951 3300005439 Bacteria 2841
19 Ga0070705_100012582 3300005440 Bacteria 4305
20 Ga0070694_100013635 3300005444 Bacteria 5078
21 Ga0070678_100016004 3300005456 Unclassified 4782
22 Ga0070678_100127632 3300005456 Bacteria 2016
23 Ga0070678_100158990 3300005456 Bacteria 1828
24 Ga0070681_10024781 3300005458 Bacteria 6035
25 Ga0068867_100111965 3300005459 Bacteria 2098
26 Ga0068867_100161524 3300005459 Bacteria 1767
27 Ga0070684_100038569 3300005535 Bacteria 4104
28 Ga0070684_100074331 3300005535 Bacteria 2996
29 Ga0068853_100083622 3300005539 Unclassified 2797
30 Ga0070686_100005668 3300005544 Bacteria 6917
31 Ga0070695_100075544 3300005545 Bacteria 2217
32 Ga0070693_100181893 3300005547 Unclassified 1354
33 Ga0068855_100009653 3300005563 Bacteria 11646
34 Ga0068855_100033995 3300005563 Bacteria 6082
35 Ga0070664_100073977 3300005564 Bacteria 2924
36 Ga0068857_100101921 3300005577 Bacteria 2576
37 Ga0068856_100026522 3300005614 Bacteria 5649
38 Ga0070702_100015852 3300005615 Bacteria 3856
39 Ga0068864_100074767 3300005618 Bacteria 2956
40 Ga0068861_100012656 3300005719 Bacteria 5887
41 Ga0068861_100050765 3300005719 Bacteria 3146
42 Ga0068870_10004435 3300005840 Bacteria 6044
43 Ga0068863_100110066 3300005841 Bacteria 2623
44 Ga0068860_100254167 3300005843 Bacteria 1712
45 Ga0081455_10001948 3300005937 Bacteria 24801
46 Ga0081539_10020347 3300005985 Bacteria 4492
47 Ga0068871_100023968 3300006358 Bacteria 4728
48 Ga0068865_100001406 3300006881 Bacteria 14017
49 Ga0068865_100049602 3300006881 Bacteria 2895
50 Ga0105240_10024756 3300009093 Bacteria 7906
51 Ga0105240_10128438 3300009093 Bacteria 3043
52 Ga0111539_10276437 3300009094 Bacteria 1954
53 Ga0105245_10011256 3300009098 Bacteria 7788
54 Ga0105243_10141705 3300009148 Bacteria 2052
55 Ga0105243_10150337 3300009148 Bacteria 1997
56 Ga0105243_10436837 3300009148 Bacteria 1225
57 Ga0105241_10062392 3300009174 Bacteria 2873
58 Ga0105242_10068938 3300009176 Bacteria 2928
59 Ga0105242_10200411 3300009176 Bacteria 1773
60 Ga0105248_10073787 3300009177 Unclassified 3835
61 Ga0105237_10010196 3300009545 Bacteria 10011
62 Ga0105237_10046965 3300009545 Unclassified 4341
63 Ga0105238_10207581 3300009551 Bacteria 1935
64 Ga0105239_10035709 3300010375 Bacteria 5457
65 Ga0105239_10035972 3300010375 Bacteria 5436
66 Ga0105246_10278432 3300011119 Bacteria 1341
67 Ga0157371_10102282 3300013102 Bacteria 2033
68 Ga0157369_10010847 3300013105 Bacteria 10378
69 Ga0157369_10038844 3300013105 Bacteria 5204
70 Ga0157369_10049052 3300013105 Unclassified 4578
71 Ga0157378_10017683 3300013297 Bacteria 6259
72 Ga0163162_10034108 3300013306 Bacteria 5063
73 Ga0157372_10037002 3300013307 Bacteria 5381
74 Ga0157372_10085190 3300013307 Bacteria 3584
75 Ga0157372_10542251 3300013307 Unclassified 1356
76 Ga0157375_10046384 3300013308 Bacteria 4236
77 Ga0157380_10027840 3300014326 Bacteria 4303
78 Ga0157380_10036132 3300014326 Bacteria 3821
79 Ga0157377_10041788 3300014745 Bacteria 2544
80 Ga0157379_10121130 3300014968 Bacteria 2353
81 Ga0163161_10122236 3300017792 Bacteria 1957
82 Ga0213875_10000203 3300021388 Bacteria 60838
83 Ga0207682_10000354 3300025893 Bacteria 21053
84 Ga0207682_10003714 3300025893 Bacteria 6575
85 Ga0207692_10126634 3300025898 Bacteria 1437
86 Ga0207645_10098261 3300025907 Bacteria 1887
87 Ga0207705_10006413 3300025909 Bacteria 8717
88 Ga0207654_10024683 3300025911 Unclassified 3235
89 Ga0207707_10036553 3300025912 Bacteria 4293
90 Ga0207695_10000112 3300025913 Bacteria 248037
91 Ga0207695_10036907 3300025913 Bacteria 5277
92 Ga0207671_10036536 3300025914 Unclassified 3643
93 Ga0207671_10050234 3300025914 Bacteria 3088
94 Ga0207663_10010946 3300025916 Bacteria 4848
95 Ga0207657_10089482 3300025919 Bacteria 2571
96 Ga0207694_10015268 3300025924 Bacteria 5794
97 Ga0207694_10016954 3300025924 Bacteria 5503
98 Ga0207659_10161360 3300025926 Unclassified 1760
99 Ga0207687_10002524 3300025927 Bacteria 12418
100 Ga0207644_10145234 3300025931 Bacteria 1831
101 Ga0207686_10027686 3300025934 Unclassified 3321
102 Ga0207686_10124887 3300025934 Bacteria 1757
103 Ga0207709_10037327 3300025935 Bacteria 2886
104 Ga0207670_10012477 3300025936 Bacteria 4976
105 Ga0207704_10002217 3300025938 Bacteria 8715
106 Ga0207691_10017371 3300025940 Bacteria 6825
107 Ga0207691_10055110 3300025940 Bacteria 3625
108 Ga0207711_10025627 3300025941 Unclassified 4946
109 Ga0207689_10139141 3300025942 Bacteria 2000
110 Ga0207661_10043572 3300025944 Unclassified 3542
111 Ga0207679_10092488 3300025945 Bacteria 2343
112 Ga0207667_10016432 3300025949 Bacteria 8363
113 Ga0207667_10053922 3300025949 Bacteria 4230
114 Ga0207651_10108332 3300025960 Bacteria 2079
115 Ga0207712_10034707 3300025961 Bacteria 3420
116 Ga0207708_10002377 3300026075 Bacteria 13826
117 Ga0207708_10087609 3300026075 Unclassified 2398
118 Ga0207708_10105510 3300026075 Bacteria 2184
119 Ga0207641_10048101 3300026088 Bacteria 3599
120 Ga0207641_10058103 3300026088 Bacteria 3291
121 Ga0207648_10005152 3300026089 Bacteria 13237
122 Ga0207648_10138006 3300026089 Unclassified 2148
123 Ga0207648_10158818 3300026089 Bacteria 1996
124 Ga0207676_10072479 3300026095 Bacteria 2769
125 Ga0207674_10168076 3300026116 Bacteria 2147
126 Ga0207675_100011935 3300026118 Bacteria 8117
127 Ga0207675_100023218 3300026118 Bacteria 5768
128 Ga0207675_100054002 3300026118 Bacteria 3748
129 Ga0207675_100349992 3300026118 Bacteria 1448
130 Ga0268266_10075030 3300028379 Bacteria 2937
131 Ga0268265_10055073 3300028380 Bacteria 3021
132 Ga0268264_10059770 3300028381 Bacteria 3194
133 Ga0265319_1002513 3300028563 Bacteria 9941
134 Ga0265319_1002590 3300028563 Bacteria 9751
135 Ga0265319_1012242 3300028563 Bacteria 3476
136 Ga0265318_10029296 3300028577 Bacteria 2148
137 Ga0265338_10004122 3300028800 Bacteria 19907
138 Ga0265338_10021770 3300028800 Bacteria 6664
139 Ga0265332_10010059 3300031238 Bacteria 4212
140 Ga0265320_10019732 3300031240 Bacteria 3675
141 Ga0265327_10001676 3300031251 Bacteria 26576
142 Ga0265316_10103044 3300031344 Bacteria 2167
143 Ga0265313_10001725 3300031595 Bacteria 20140
144 Ga0307405_10023341 3300031731 Bacteria 3515
145 Ga0307410_10002592 3300031852 Bacteria 8781
146 Ga0307406_10034039 3300031901 Bacteria 3123
147 Ga0307407_10007588 3300031903 Bacteria 4921
148 Ga0307409_100031897 3300031995 Bacteria 3811
149 Ga0307416_100212667 3300032002 Bacteria 1846
150 Ga0307411_10000354 3300032005 Bacteria 15495
151 Ga0307411_10004609 3300032005 Bacteria 6634
152 Ga0307415_100022156 3300032126 Bacteria 3917
153 Ga0373934_0000903 3300035086 Bacteria 10725
154 Ga0373923_0008846 3300035111 Bacteria 3611
155 Ga0373955_0011819 3300035172 Unclassified 4177
156 Ga0373927_0001947 3300035695 Bacteria 15255
157 Ga0373947_0074597 3300035725 Unclassified 2088
158 Ga0373937_0083062 3300036401 Bacteria 2963
159 Ga0436364_0966658 3300037853 Bacteria 266758
160 Ga0436365_1108354 3300039437 Bacteria 1602
161 Ga0436365_1542606 3300039437 Bacteria 1941
162 Ga0451791_1662627 3300041451 Bacteria 2803
163 Ga0451576_0102376 3300045051 Unclassified 2979
164 Ga0451576_0403732 3300045051 Unclassified 1433
165 Ga0495592_0018396 3300046454 Bacteria 5314
166 Ga0495651_0065762 3300046462 Bacteria 2768
167 Ga0495608_0057555 3300046511 Bacteria 2565
168 Ga0495608_0109952 3300046511 Bacteria 1772
169 Ga0495616_0001019 3300046513 Bacteria 20036
170 Ga0495628_0031010 3300046516 Bacteria 4325
171 Ga0495630_0003874 3300046517 Bacteria 10454
172 Ga0495630_0017095 3300046517 Bacteria 5309
173 Ga0495630_0030476 3300046517 Bacteria 4013
174 Ga0495652_0022001 3300046529 Bacteria 5665
175 Ga0495652_0080617 3300046529 Bacteria 2688
176 Ga0495640_0102549 3300046533 Unclassified 1877
177 Ga0495587_0070271 3300046536 Bacteria 2038
178 Ga0495667_0002747 3300046559 Bacteria 11759
179 Ga0495634_0042848 3300046642 Bacteria 3069
180 Ga0495634_0121789 3300046642 Bacteria 1670
181 Ga0495635_0103579 3300046663 Bacteria 1945
182 Ga0495613_0061721 3300046689 Bacteria 2744
183 Ga0495624_0072309 3300046690 Bacteria 2145
184 Ga0495581_0021428 3300047315 Bacteria 3747
185 Ga0495604_0017411 3300047317 Bacteria 5752
186 Ga0495674_0004547 3300047319 Bacteria 13346
187 Ga0495674_0025303 3300047319 Bacteria 5444
188 Ga0495674_0152362 3300047319 Unclassified 1938
189 Ga0495675_0002870 3300047444 Bacteria 10338
190 Ga0495675_0069848 3300047444 Unclassified 2217
191 Ga0495684_0000804 3300047471 Bacteria 25487
192 Ga0495684_0005180 3300047471 Bacteria 10161
193 Ga0495684_0049155 3300047471 Unclassified 3223
194 Ga0496112_0097431 3300048915 Bacteria 2912
195 Ga0496114_0238399 3300048917 Bacteria 1599
196 Ga0501033_0001258 3300049570 Bacteria 22660
197 Ga0501034_0001872 3300049571 Bacteria 26699
198 Ga0501034_0019969 3300049571 Bacteria 6842
199 Ga0501046_0001750 3300049580 Bacteria 20736
200 Ga0501048_0102863 3300049582 Unclassified 2016
201 Ga0501067_0015271 3300049583 Bacteria 4251
202 Ga0501070_0031952 3300049586 Bacteria 4409
203 Ga0501070_0092498 3300049586 Bacteria 2503
204 Ga0501071_0005612 3300049587 Bacteria 8086
205 Ga0501071_0053325 3300049587 Unclassified 2917
206 Ga0501073_0007942 3300049589 Bacteria 7872
207 Ga0501074_0020203 3300049590 Bacteria 4840
208 Ga0501074_0108380 3300049590 Unclassified 1988
209 Ga0501076_0207312 3300049592 Unclassified 1601
210 Ga0501077_0002359 3300049593 Bacteria 11373
211 Ga0501079_0000342 3300049741 Bacteria 29539
212 Ga0501080_0000180 3300049742 Bacteria 46199
213 Ga0501080_0052579 3300049742 Unclassified 3791
214 Ga0501083_0006958 3300049744 Bacteria 8024
215 Ga0501044_0058234 3300049823 Bacteria 3962
216 Ga0500644_0006430 3300053088 Bacteria 3012
217 Ga0501084_0009020 3300054114 Bacteria 8253
218 Ga0265314_10002659
219 JGI25406J46586_10008420
220 rootL2_10010896
221 Ga0070658_10001434
222 Ga0070658_10223218
223 Ga0070683_100053139
224 Ga0070690_100023418
225 Ga0070690_100105050
226 Ga0070677_10006054
227 Ga0070666_10069589
228 Ga0070682_100040311
229 Ga0070689_100014108
230 Ga0070689_100025175
231 Ga0070675_100008156
232 Ga0070673_100034671
233 Ga0070688_100074659
234 Ga0070667_100178701
235 Ga0070711_100050951
236 Ga0070705_100012582
237 Ga0070694_100013635
238 Ga0070678_100016004
239 Ga0070678_100127632
240 Ga0070678_100158990
241 Ga0070681_10024781
242 Ga0068867_100111965
243 Ga0068867_100161524
244 Ga0070684_100038569
245 Ga0070684_100074331
246 Ga0068853_100083622
247 Ga0070686_100005668
248 Ga0070695_100075544
249 Ga0070693_100181893
250 Ga0068855_100009653
251 Ga0068855_100033995
252 Ga0070664_100073977
253 Ga0068857_100101921
254 Ga0068856_100026522
255 Ga0070702_100015852
256 Ga0068864_100074767
257 Ga0068861_100012656
258 Ga0068861_100050765
259 Ga0068870_10004435
260 Ga0068863_100110066
261 Ga0068860_100254167
262 Ga0081455_10001948
263 Ga0081539_10020347
264 Ga0068871_100023968
265 Ga0068865_100001406
266 Ga0068865_100049602
267 Ga0105240_10024756
268 Ga0105240_10128438
269 Ga0111539_10276437
270 Ga0105245_10011256
271 Ga0105243_10141705
272 Ga0105243_10150337
273 Ga0105243_10436837
274 Ga0105241_10062392
275 Ga0105242_10068938
276 Ga0105242_10200411
277 Ga0105248_10073787
278 Ga0105237_10010196
279 Ga0105237_10046965
280 Ga0105238_10207581
281 Ga0105239_10035709
282 Ga0105239_10035972
283 Ga0105246_10278432
284 Ga0157371_10102282
285 Ga0157369_10010847
286 Ga0157369_10038844
287 Ga0157369_10049052
288 Ga0157378_10017683
289 Ga0163162_10034108
290 Ga0157372_10037002
291 Ga0157372_10085190
292 Ga0157372_10542251
293 Ga0157375_10046384
294 Ga0157380_10027840
295 Ga0157380_10036132
296 Ga0157377_10041788
297 Ga0157379_10121130
298 Ga0163161_10122236
299 Ga0213875_10000203
300 Ga0207682_10000354
301 Ga0207682_10003714
302 Ga0207692_10126634
303 Ga0207645_10098261
304 Ga0207705_10006413
305 Ga0207654_10024683
306 Ga0207707_10036553
307 Ga0207695_10000112
308 Ga0207695_10036907
309 Ga0207671_10036536
310 Ga0207671_10050234
311 Ga0207663_10010946
312 Ga0207657_10089482
313 Ga0207694_10015268
314 Ga0207694_10016954
315 Ga0207659_10161360
316 Ga0207687_10002524
317 Ga0207644_10145234
318 Ga0207686_10027686
319 Ga0207686_10124887
320 Ga0207709_10037327
321 Ga0207670_10012477
322 Ga0207704_10002217
323 Ga0207691_10017371
324 Ga0207691_10055110
325 Ga0207711_10025627
326 Ga0207689_10139141
327 Ga0207661_10043572
328 Ga0207679_10092488
329 Ga0207667_10016432
330 Ga0207667_10053922
331 Ga0207651_10108332
332 Ga0207712_10034707
333 Ga0207708_10002377
334 Ga0207708_10087609
335 Ga0207708_10105510
336 Ga0207641_10048101
337 Ga0207641_10058103
338 Ga0207648_10005152
339 Ga0207648_10138006
340 Ga0207648_10158818
341 Ga0207676_10072479
342 Ga0207674_10168076
343 Ga0207675_100011935
344 Ga0207675_100023218
345 Ga0207675_100054002
346 Ga0207675_100349992
347 Ga0268266_10075030
348 Ga0268265_10055073
349 Ga0268264_10059770
350 Ga0265319_1002513
351 Ga0265319_1002590
352 Ga0265319_1012242
353 Ga0265318_10029296
354 Ga0265338_10004122
355 Ga0265338_10021770
356 Ga0265332_10010059
357 Ga0265320_10019732
358 Ga0265327_10001676
359 Ga0265316_10103044
360 Ga0265313_10001725
361 Ga0307405_10023341
362 Ga0307410_10002592
363 Ga0307406_10034039
364 Ga0307407_10007588
365 Ga0307409_100031897
366 Ga0307416_100212667
367 Ga0307411_10000354
368 Ga0307411_10004609
369 Ga0307415_100022156
370 Ga0373934_0000903
371 Ga0373923_0008846
372 Ga0373955_0011819
373 Ga0373927_0001947
374 Ga0373947_0074597
375 Ga0373937_0083062
376 Ga0436364_0966658
377 Ga0436365_1108354
378 Ga0436365_1542606
379 Ga0451791_1662627
380 Ga0451576_0102376
381 Ga0451576_0403732
382 Ga0495592_0018396
383 Ga0495651_0065762
384 Ga0495608_0057555
385 Ga0495608_0109952
386 Ga0495616_0001019
387 Ga0495628_0031010
388 Ga0495630_0003874
389 Ga0495630_0017095
390 Ga0495630_0030476
391 Ga0495652_0022001
392 Ga0495652_0080617
393 Ga0495640_0102549
394 Ga0495587_0070271
395 Ga0495667_0002747
396 Ga0495634_0042848
397 Ga0495634_0121789
398 Ga0495635_0103579
399 Ga0495613_0061721
400 Ga0495624_0072309
401 Ga0495581_0021428
402 Ga0495604_0017411
403 Ga0495674_0004547
404 Ga0495674_0025303
405 Ga0495674_0152362
406 Ga0495675_0002870
407 Ga0495675_0069848
408 Ga0495684_0000804
409 Ga0495684_0005180
410 Ga0495684_0049155
411 Ga0496112_0097431
412 Ga0496114_0238399
413 Ga0501033_0001258
414 Ga0501034_0001872
415 Ga0501034_0019969
416 Ga0501046_0001750
417 Ga0501048_0102863
418 Ga0501067_0015271
419 Ga0501070_0031952
420 Ga0501070_0092498
421 Ga0501071_0005612
422 Ga0501071_0053325
423 Ga0501073_0007942
424 Ga0501074_0020203
425 Ga0501074_0108380
426 Ga0501076_0207312
427 Ga0501077_0002359
428 Ga0501079_0000342
429 Ga0501080_0000180
430 Ga0501080_0052579
431 Ga0501083_0006958
432 Ga0501044_0058234
433 Ga0500644_0006430
434 Ga0501084_0009020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07586

HXXSHH

Protein of unknown function (DUF1552)

67

357

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zr3-assembly2.cif.gz_B crystal structure of the macro-domain of human core histone variant macroh2a1.1 (form b) 0.6549 249 280
3waw-assembly1.cif.gz_A crystal structure of autotaxin in complex with 2boa 0.5855 250 352
4zg7-assembly1.cif.gz_A structural basis for inhibition of human autotaxin by four novel compounds 0.5503 250 352
5kgm-assembly1.cif.gz_B 2.95a resolution structure of apo independent phosphoglycerate mutase from c. elegans (monoclinic form) 0.5438 227 412
1us3-assembly1.cif.gz_A native xylanase10c from cellvibrio japonicus 0.5394 241 276
ID Description Score Start End Superfamily
af_Q66H63_1_228_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.6812 249 280 3.40.220.10
af_Q54YH9_643_888_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.6766 249 281 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.6273 249 277 3.40.220.10
af_B7EM62_22_162_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5912 252 292 3.80.10.10
af_Q24238_51_548_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5646 248 352 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A355GB79-F1-model_v4 DUF1552 domain-containing protein 0.9421 238 416
AF-A0A517YF69-F1-model_v4 DUF1552 domain-containing protein 0.935 235 415
AF-A0A2D5SAE3-F1-model_v4 DUF1552 domain-containing protein 0.934 256 415
AF-A0A355GB79-F1-model_v4 DUF1552 domain-containing protein 0.9272 238 416
AF-A0A3C1USZ2-F1-model_v4 DUF1552 domain-containing protein 0.9219 249 415

Map