F327528

General Info

Members Datasets Scaffolds Average Seq Length
216 160 211 252

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10700685|Ga0111539_107006852
Length 290
Sequence MRSSRRQKAETRGEKPLPVIRGRHTIRPRLNPMASNSKQTWNPEGYALHARFVSDLGMPVVELLAPQAGERILDLGCGDGVLTKKLQDLGCELVGVDGSAAQVEASQSLGLDARVMDGYELSFENEFDAVFSNAVLHWMKRADVVVAGVWRALKPGGRFVAECGGHGCIAKIEKALLDTLQRRGIDGRAFHPWYFPATEEYRQYLEAQGFQVNYIALFPRPTPLPGDILGWLETFAQSFTAALPVQERPGFLNEVAEALRPRLCDAAGQWTADYVRLRFAAQKPGLPLQR

Samples

Sample ID Description Type Environment
1 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
2 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
3 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
4 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
5 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
159 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 7.87
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1002078 3300003751 Bacteria 3210
2 Ga0070658_10217210 3300005327 Bacteria 1616
3 Ga0070690_100349689 3300005330 Unclassified 1072
4 Ga0070682_100637037 3300005337 Unclassified 847
5 Ga0070689_100166104 3300005340 Unclassified 1786
6 Ga0070689_100275423 3300005340 Bacteria 1394
7 Ga0070669_100501117 3300005353 Bacteria 1007
8 Ga0070675_100152094 3300005354 Bacteria 1985
9 Ga0070675_100369382 3300005354 Bacteria 1275
10 Ga0070674_100024692 3300005356 Bacteria 3904
11 Ga0070674_100555671 3300005356 Bacteria 964
12 Ga0070673_100154706 3300005364 Bacteria 1945
13 Ga0070688_100272796 3300005365 Bacteria 1212
14 Ga0070667_100151117 3300005367 Bacteria 2040
15 Ga0070667_100663978 3300005367 Bacteria 963
16 Ga0070709_10233589 3300005434 Bacteria 1317
17 Ga0070713_100021555 3300005436 Bacteria 4959
18 Ga0070713_100082326 3300005436 Bacteria 2748
19 Ga0070705_100079232 3300005440 Bacteria 2012
20 Ga0070700_100478383 3300005441 Bacteria 953
21 Ga0070708_100018681 3300005445 Bacteria 5803
22 Ga0070663_100047321 3300005455 Bacteria 3047
23 Ga0070663_100387147 3300005455 Bacteria 1140
24 Ga0070678_100004066 3300005456 Bacteria 8236
25 Ga0070681_10383423 3300005458 Bacteria 1316
26 Ga0070681_10600959 3300005458 Unclassified 1014
27 Ga0068867_100003257 3300005459 Bacteria 11440
28 Ga0070706_100249158 3300005467 Bacteria 1658
29 Ga0070706_100432190 3300005467 Bacteria 1225
30 Ga0070707_100041056 3300005468 Bacteria 4427
31 Ga0070707_100280574 3300005468 Bacteria 1619
32 Ga0070707_100408062 3300005468 Bacteria 1319
33 Ga0070697_100209716 3300005536 Bacteria 1658
34 Ga0070697_100562713 3300005536 Bacteria 1000
35 Ga0070672_100068094 3300005543 Bacteria 2823
36 Ga0070672_100438893 3300005543 Bacteria 1123
37 Ga0070686_100009326 3300005544 Bacteria 5512
38 Ga0070665_100075770 3300005548 Bacteria 3371
39 Ga0068852_100403405 3300005616 Unclassified 1345
40 Ga0068859_100013202 3300005617 Bacteria 8292
41 Ga0068864_100292533 3300005618 Bacteria 1523
42 Ga0068866_10033678 3300005718 Bacteria 2488
43 Ga0068861_100010121 3300005719 Bacteria 6539
44 Ga0068870_10114456 3300005840 Bacteria 1545
45 Ga0068863_100009383 3300005841 Bacteria 9548
46 Ga0068863_100075267 3300005841 Bacteria 3195
47 Ga0068858_100162825 3300005842 Bacteria 2101
48 Ga0068858_100233665 3300005842 Unclassified 1743
49 Ga0068858_100398879 3300005842 Bacteria 1321
50 Ga0068858_100552437 3300005842 Bacteria 1115
51 Ga0068860_100465820 3300005843 Unclassified 1258
52 Ga0068862_100258618 3300005844 Bacteria 1588
53 Ga0075364_10053370 3300006051 Bacteria 2643
54 Ga0070716_100023354 3300006173 Bacteria 3278
55 Ga0070712_100000299 3300006175 Bacteria 27866
56 Ga0097621_100206294 3300006237 Bacteria 1708
57 Ga0075428_100034008 3300006844 Bacteria 5623
58 Ga0075431_100257569 3300006847 Bacteria 1771
59 Ga0075434_100026415 3300006871 Bacteria 5688
60 Ga0097620_100013202 3300006931 Bacteria 8292
61 Ga0075435_100123174 3300007076 Bacteria 2165
62 Ga0105240_10075537 3300009093 Bacteria 4156
63 Ga0111539_10600218 3300009094 Bacteria 1282
64 Ga0111539_10700685 3300009094 Bacteria 1179
65 Ga0105243_10251457 3300009148 Bacteria 1578
66 Ga0105241_10159268 3300009174 Unclassified 1854
67 Ga0105242_10242279 3300009176 Bacteria 1622
68 Ga0105248_10110664 3300009177 Bacteria 3097
69 Ga0105248_10119969 3300009177 Unclassified 2967
70 Ga0105248_10123843 3300009177 Bacteria 2916
71 Ga0105248_10189172 3300009177 Bacteria 2319
72 Ga0105237_10015533 3300009545 Bacteria 7921
73 Ga0105238_10016715 3300009551 Bacteria 7435
74 Ga0105249_10066941 3300009553 Bacteria 3308
75 Ga0157378_10056312 3300013297 Bacteria 3503
76 Ga0163162_10444111 3300013306 Bacteria 1429
77 Ga0157372_10402967 3300013307 Bacteria 1594
78 Ga0157375_10025973 3300013308 Bacteria 5452
79 Ga0157375_10114731 3300013308 Bacteria 2796
80 Ga0157375_10631780 3300013308 Unclassified 1228
81 Ga0157375_10992000 3300013308 Bacteria 980
82 Ga0163163_10588910 3300014325 Bacteria 1175
83 Ga0157380_10543162 3300014326 Bacteria 1138
84 Ga0157379_10154368 3300014968 Bacteria 2071
85 Ga0157376_10000008 3300014969 Bacteria 351192
86 Ga0157376_10000785 3300014969 Bacteria 20749
87 Ga0157376_10021863 3300014969 Bacteria 4974
88 Ga0157376_10693544 3300014969 Bacteria 1023
89 Ga0163161_10196716 3300017792 Bacteria 1552
90 Ga0209784_100038 3300025224 Bacteria 253212
91 Ga0207710_10073468 3300025900 Bacteria 1572
92 Ga0207699_10106730 3300025906 Bacteria 1788
93 Ga0207643_10142566 3300025908 Bacteria 1432
94 Ga0207705_10263823 3300025909 Bacteria 1316
95 Ga0207684_10268811 3300025910 Bacteria 1471
96 Ga0207684_10319173 3300025910 Bacteria 1339
97 Ga0207707_10506757 3300025912 Unclassified 1029
98 Ga0207695_10043922 3300025913 Bacteria 4758
99 Ga0207671_10032292 3300025914 Bacteria 3898
100 Ga0207693_10000091 3300025915 Bacteria 80207
101 Ga0207646_10001321 3300025922 Bacteria 30747
102 Ga0207646_10092915 3300025922 Bacteria 2701
103 Ga0207700_10001606 3300025928 Bacteria 12823
104 Ga0207706_10288596 3300025933 Bacteria 1430
105 Ga0207686_10143691 3300025934 Bacteria 1652
106 Ga0207709_10495878 3300025935 Bacteria 952
107 Ga0207669_10032554 3300025937 Bacteria 2930
108 Ga0207704_10012599 3300025938 Bacteria 4201
109 Ga0207665_10018789 3300025939 Bacteria 4542
110 Ga0207665_10224356 3300025939 Unclassified 1378
111 Ga0207691_10248274 3300025940 Bacteria 1537
112 Ga0207711_10014725 3300025941 Bacteria 6498
113 Ga0207711_10475888 3300025941 Unclassified 1163
114 Ga0207711_10580889 3300025941 Bacteria 1045
115 Ga0207689_10047263 3300025942 Bacteria 3555
116 Ga0207668_10042424 3300025972 Bacteria 3081
117 Ga0207677_10200749 3300026023 Bacteria 1585
118 Ga0207703_10037771 3300026035 Bacteria 3849
119 Ga0207703_10205957 3300026035 Bacteria 1751
120 Ga0207703_10247525 3300026035 Bacteria 1605
121 Ga0207703_10504648 3300026035 Bacteria 1136
122 Ga0207641_10004838 3300026088 Bacteria 11602
123 Ga0207675_100332096 3300026118 Bacteria 1486
124 Ga0207683_10001676 3300026121 Bacteria 19839
125 Ga0207683_10169717 3300026121 Bacteria 1976
126 Ga0268264_10032324 3300028381 Bacteria 4293
127 Ga0265329_10012155 3300031242 Bacteria 3105
128 Ga0265339_10103825 3300031249 Bacteria 1476
129 Ga0307411_10026851 3300032005 Bacteria 3473
130 Ga0307415_100216619 3300032126 Bacteria 1532
131 Ga0373955_0166077 3300035172 Bacteria 1305
132 Ga0373955_0271211 3300035172 Bacteria 1020
133 Ga0373931_0253957 3300035691 Unclassified 1070
134 Ga0373935_0118738 3300035692 Bacteria 1764
135 Ga0373933_0198302 3300035724 Bacteria 1284
136 Ga0373937_0013095 3300036401 Bacteria 7305
137 Ga0373937_0083099 3300036401 Bacteria 2963
138 Ga0373937_0383001 3300036401 Bacteria 1334
139 Ga0395900_0000541 3300037418 Bacteria 52877
140 Ga0436364_0077807 3300037853 Bacteria 973
141 Ga0451807_1720538 3300041486 Bacteria 1281
142 Ga0495603_0072016 3300046455 Unclassified 2031
143 Ga0495629_0024433 3300046459 Bacteria 4303
144 Ga0495629_0305687 3300046459 Bacteria 1089
145 Ga0495629_0379887 3300046459 Unclassified 961
146 Ga0495651_0263190 3300046462 Unclassified 1173
147 Ga0495580_0001052 3300046472 Bacteria 24258
148 Ga0495580_0014625 3300046472 Bacteria 5948
149 Ga0495582_0000848 3300046473 Bacteria 16927
150 Ga0495662_0034015 3300046476 Bacteria 2462
151 Ga0495664_0100918 3300046477 Bacteria 1739
152 Ga0495594_0028451 3300046499 Bacteria 3016
153 Ga0495594_0236722 3300046499 Bacteria 1041
154 Ga0495628_0102783 3300046516 Bacteria 2204
155 Ga0495628_0112707 3300046516 Bacteria 2091
156 Ga0495630_0035446 3300046517 Bacteria 3728
157 Ga0495586_0070538 3300046535 Bacteria 1908
158 Ga0495587_0128792 3300046536 Bacteria 1447
159 Ga0495634_0185077 3300046642 Unclassified 1302
160 Ga0495646_0310822 3300046680 Bacteria 832
161 Ga0495647_0003217 3300046681 Bacteria 5227
162 Ga0495658_0181348 3300046683 Bacteria 1307
163 Ga0495613_0099268 3300046689 Bacteria 2103
164 Ga0495624_0101617 3300046690 Bacteria 1770
165 Ga0495581_0056223 3300047315 Bacteria 2271
166 Ga0495604_0031801 3300047317 Unclassified 4185
167 Ga0495604_0147305 3300047317 Bacteria 1677
168 Ga0495674_0037765 3300047319 Bacteria 4339
169 Ga0495674_0107719 3300047319 Bacteria 2365
170 Ga0495676_0008033 3300047321 Bacteria 9673
171 Ga0495680_0332453 3300047322 Bacteria 1061
172 Ga0495680_0461965 3300047322 Unclassified 867
173 Ga0495675_0146852 3300047444 Bacteria 1459
174 Ga0495602_0283215 3300048088 Bacteria 1220
175 Ga0496101_0002866 3300048904 Bacteria 10601
176 Ga0496102_0337669 3300048905 Unclassified 1419
177 Ga0496102_0603841 3300048905 Unclassified 1020
178 Ga0496104_0177322 3300048907 Bacteria 2041
179 Ga0496104_1007059 3300048907 Unclassified 737
180 Ga0496105_0421537 3300048908 Bacteria 1057
181 Ga0496106_0373187 3300048909 Unclassified 1146
182 Ga0496109_0166150 3300048912 Unclassified 2069
183 Ga0496112_0678094 3300048915 Unclassified 959
184 Ga0496114_0016660 3300048917 Bacteria 5927
185 Ga0496114_0019042 3300048917 Bacteria 5562
186 Ga0496114_0076112 3300048917 Bacteria 2828
187 Ga0496115_0005544 3300048918 Bacteria 9183
188 Ga0496115_0012165 3300048918 Bacteria 6470
189 Ga0496115_0023433 3300048918 Bacteria 4791
190 Ga0496115_0044329 3300048918 Bacteria 3547
191 Ga0501034_0014277 3300049571 Bacteria 8185
192 Ga0501047_0010737 3300049581 Bacteria 8658
193 Ga0501047_0314543 3300049581 Bacteria 1406
194 Ga0501077_0147066 3300049593 Bacteria 1495
195 Ga0501083_0366243 3300049744 Bacteria 937
196 Ga0501035_0289020 3300049822 Bacteria 1384
197 Ga0501044_0034128 3300049823 Bacteria 5340
198 nmdc:mga05p37_58348_c1 3300050507 Bacteria 4753
199 nmdc:mga06r32_561976_c1 3300050510 Bacteria 1114
200 nmdc:mga06r32_64294_c1 3300050510 Bacteria 3538
201 nmdc:mga08y16_168742_c1 3300050511 Unclassified 2273
202 nmdc:mga0n895_17728_c1 3300050512 Bacteria 6570
203 nmdc:mga0rr50_370119_c1 3300050513 Bacteria 1207
204 nmdc:mga0rr50_50137_c1 3300050513 Bacteria 3092
205 nmdc:mga0a205_48065_c1 3300050515 Bacteria 4117
206 Ga0495601_0055956 3300053077 Bacteria 2498
207 Ga0495595_0279294 3300053084 Bacteria 838
208 Ga0495619_0011481 3300053085 Bacteria 5584
209 Ga0500646_0008966 3300053090 Bacteria 2561
210 Ga0500597_007095 3300053120 Bacteria 3773
211 Ga0590071_008744 3300059421 Bacteria 2380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100021555 Ga0070713_1000215555 195
2 3300006175 Ga0070712_100000299 Ga0070712_10000029927 195
3 3300025915 Ga0207693_10000091 Ga0207693_1000009150 195
4 3300025928 Ga0207700_10001606 Ga0207700_100016062 195
5 3300025939 Ga0207665_10018789 Ga0207665_100187891 195
6 3300048907 Ga0496104_1007059 Ga0496104_1007059_21_713 195
7 3300048918 Ga0496115_0023433 Ga0496115_0023433_2937_3629 195
8 3300005434 Ga0070709_10233589 Ga0070709_102335892 220
9 3300025906 Ga0207699_10106730 Ga0207699_101067303 220
10 3300046459 Ga0495629_0305687 Ga0495629_0305687_182_958 229
11 3300046642 Ga0495634_0185077 Ga0495634_0185077_205_966 232
12 3300009177 Ga0105248_10189172 Ga0105248_101891722 233
13 3300025941 Ga0207711_10475888 Ga0207711_104758882 233
14 3300005618 Ga0068864_100292533 Ga0068864_1002925332 234
15 3300046499 Ga0495594_0236722 Ga0495594_0236722_261_1019 239
16 3300046683 Ga0495658_0181348 Ga0495658_0181348_32_775 239
17 3300005367 Ga0070667_100151117 Ga0070667_1001511173 240
18 3300005458 Ga0070681_10383423 Ga0070681_103834232 240
19 3300005455 Ga0070663_100047321 Ga0070663_1000473212 241
20 3300005842 Ga0068858_100233665 Ga0068858_1002336653 241
21 3300009174 Ga0105241_10159268 Ga0105241_101592683 241
22 3300014968 Ga0157379_10154368 Ga0157379_101543682 241
23 3300026035 Ga0207703_10247525 Ga0207703_102475252 241
24 3300035691 Ga0373931_0253957 Ga0373931_0253957_36_812 241
25 3300048905 Ga0496102_0337669 Ga0496102_0337669_486_1262 241
26 3300049744 Ga0501083_0366243 Ga0501083_0366243_134_907 241
27 iso_pu_bacteria 2857609550 2857612503 241
28 3300005337 Ga0070682_100637037 Ga0070682_1006370371 243
29 3300005353 Ga0070669_100501117 Ga0070669_1005011172 243
30 3300005356 Ga0070674_100555671 Ga0070674_1005556711 243
31 3300005364 Ga0070673_100154706 Ga0070673_1001547062 243
32 3300005365 Ga0070688_100272796 Ga0070688_1002727962 243
33 3300005441 Ga0070700_100478383 Ga0070700_1004783831 243
34 3300005455 Ga0070663_100387147 Ga0070663_1003871471 243
35 3300005456 Ga0070678_100004066 Ga0070678_1000040668 243
36 3300005543 Ga0070672_100068094 Ga0070672_1000680943 243
37 3300005548 Ga0070665_100075770 Ga0070665_1000757703 243
38 3300005616 Ga0068852_100403405 Ga0068852_1004034052 243
39 3300005840 Ga0068870_10114456 Ga0068870_101144562 243
40 3300006237 Ga0097621_100206294 Ga0097621_1002062942 243
41 3300009177 Ga0105248_10110664 Ga0105248_101106641 243
42 3300025908 Ga0207643_10142566 Ga0207643_101425661 243
43 3300025937 Ga0207669_10032554 Ga0207669_100325542 243
44 3300025940 Ga0207691_10248274 Ga0207691_102482742 243
45 3300025941 Ga0207711_10580889 Ga0207711_105808891 243
46 3300026121 Ga0207683_10001676 Ga0207683_1000167622 243
47 3300032126 Ga0307415_100216619 Ga0307415_1002166193 243
48 3300036401 Ga0373937_0013095 Ga0373937_0013095_603_1367 243
49 3300046459 Ga0495629_0379887 Ga0495629_0379887_178_942 243
50 3300048088 Ga0495602_0283215 Ga0495602_0283215_105_869 243
51 3300025910 Ga0207684_10319173 Ga0207684_103191732 245
52 3300032005 Ga0307411_10026851 Ga0307411_100268513 245
53 3300035724 Ga0373933_0198302 Ga0373933_0198302_379_1131 245
54 3300005354 Ga0070675_100369382 Ga0070675_1003693822 246
55 3300005543 Ga0070672_100438893 Ga0070672_1004388932 246
56 3300013308 Ga0157375_10992000 Ga0157375_109920001 246
57 3300014325 Ga0163163_10588910 Ga0163163_105889102 246
58 3300014969 Ga0157376_10693544 Ga0157376_106935442 246
59 3300017792 Ga0163161_10196716 Ga0163161_101967162 246
60 3300035172 Ga0373955_0271211 Ga0373955_0271211_59_835 246
61 3300035692 Ga0373935_0118738 Ga0373935_0118738_868_1641 246
62 3300036401 Ga0373937_0083099 Ga0373937_0083099_1027_1800 246
63 3300046462 Ga0495651_0263190 Ga0495651_0263190_241_1110 246
64 3300046516 Ga0495628_0102783 Ga0495628_0102783_372_1148 246
65 3300046516 Ga0495628_0112707 Ga0495628_0112707_1101_1853 246
66 3300046536 Ga0495587_0128792 Ga0495587_0128792_189_1061 246
67 3300047317 Ga0495604_0147305 Ga0495604_0147305_30_806 246
68 3300047444 Ga0495675_0146852 Ga0495675_0146852_124_900 246
69 3300049571 Ga0501034_0014277 Ga0501034_0014277_7010_7789 246
70 3300049581 Ga0501047_0010737 Ga0501047_0010737_6731_7510 246
71 3300049822 Ga0501035_0289020 Ga0501035_0289020_293_1072 246
72 3300049823 Ga0501044_0034128 Ga0501044_0034128_4064_4843 246
73 3300053077 Ga0495601_0055956 Ga0495601_0055956_921_1694 246
74 3300053084 Ga0495595_0279294 Ga0495595_0279294_51_827 246
75 3300053085 Ga0495619_0011481 Ga0495619_0011481_2711_3574 246
76 3300059421 Ga0590071_008744 Ga0590071_008744_671_1429 246
77 3300005468 Ga0070707_100280574 Ga0070707_1002805741 247
78 3300005842 Ga0068858_100552437 Ga0068858_1005524371 247
79 3300026035 Ga0207703_10205957 Ga0207703_102059572 247
80 3300026035 Ga0207703_10504648 Ga0207703_105046481 247
81 3300053120 Ga0500597_007095 Ga0500597_007095_680_1429 247
82 3300005330 Ga0070690_100349689 Ga0070690_1003496891 248
83 3300005340 Ga0070689_100166104 Ga0070689_1001661041 248
84 3300005340 Ga0070689_100275423 Ga0070689_1002754232 248
85 3300005354 Ga0070675_100152094 Ga0070675_1001520942 248
86 3300005356 Ga0070674_100024692 Ga0070674_1000246922 248
87 3300005367 Ga0070667_100663978 Ga0070667_1006639782 248
88 3300005440 Ga0070705_100079232 Ga0070705_1000792322 248
89 3300005445 Ga0070708_100018681 Ga0070708_1000186812 248
90 3300005458 Ga0070681_10600959 Ga0070681_106009591 248
91 3300005459 Ga0068867_100003257 Ga0068867_1000032571 248
92 3300005536 Ga0070697_100562713 Ga0070697_1005627131 248
93 3300005544 Ga0070686_100009326 Ga0070686_1000093263 248
94 3300005617 Ga0068859_100013202 Ga0068859_1000132026 248
95 3300005718 Ga0068866_10033678 Ga0068866_100336782 248
96 3300005719 Ga0068861_100010121 Ga0068861_1000101214 248
97 3300005841 Ga0068863_100075267 Ga0068863_1000752673 248
98 3300005842 Ga0068858_100398879 Ga0068858_1003988792 248
99 3300005843 Ga0068860_100465820 Ga0068860_1004658202 248
100 3300005844 Ga0068862_100258618 Ga0068862_1002586182 248
101 3300006051 Ga0075364_10053370 Ga0075364_100533702 248
102 3300006844 Ga0075428_100034008 Ga0075428_1000340084 248
103 3300006847 Ga0075431_100257569 Ga0075431_1002575692 248
104 3300006931 Ga0097620_100013202 Ga0097620_1000132022 248
105 3300009093 Ga0105240_10075537 Ga0105240_100755372 248
106 3300009094 Ga0111539_10600218 Ga0111539_106002182 248
107 3300009094 Ga0111539_10700685 Ga0111539_107006852 248
108 3300009148 Ga0105243_10251457 Ga0105243_102514572 248
109 3300009177 Ga0105248_10119969 Ga0105248_101199692 248
110 3300009177 Ga0105248_10123843 Ga0105248_101238432 248
111 3300009545 Ga0105237_10015533 Ga0105237_100155331 248
112 3300009551 Ga0105238_10016715 Ga0105238_1001671510 248
113 3300009553 Ga0105249_10066941 Ga0105249_100669412 248
114 3300013306 Ga0163162_10444111 Ga0163162_104441112 248
115 3300013308 Ga0157375_10114731 Ga0157375_101147312 248
116 3300014326 Ga0157380_10543162 Ga0157380_105431621 248
117 3300014969 Ga0157376_10021863 Ga0157376_100218631 248
118 3300025900 Ga0207710_10073468 Ga0207710_100734681 248
119 3300025912 Ga0207707_10506757 Ga0207707_105067572 248
120 3300025913 Ga0207695_10043922 Ga0207695_100439221 248
121 3300025914 Ga0207671_10032292 Ga0207671_100322921 248
122 3300025933 Ga0207706_10288596 Ga0207706_102885962 248
123 3300025935 Ga0207709_10495878 Ga0207709_104958781 248
124 3300025938 Ga0207704_10012599 Ga0207704_100125991 248
125 3300025941 Ga0207711_10014725 Ga0207711_100147252 248
126 3300025942 Ga0207689_10047263 Ga0207689_100472631 248
127 3300025972 Ga0207668_10042424 Ga0207668_100424242 248
128 3300026023 Ga0207677_10200749 Ga0207677_102007492 248
129 3300026118 Ga0207675_100332096 Ga0207675_1003320962 248
130 3300026121 Ga0207683_10169717 Ga0207683_101697172 248
131 3300028381 Ga0268264_10032324 Ga0268264_100323241 248
132 3300031242 Ga0265329_10012155 Ga0265329_100121552 248
133 3300031249 Ga0265339_10103825 Ga0265339_101038251 248
134 3300035172 Ga0373955_0166077 Ga0373955_0166077_149_907 248
135 3300036401 Ga0373937_0383001 Ga0373937_0383001_474_1232 248
136 3300037853 Ga0436364_0077807 Ga0436364_0077807_100_861 248
137 3300047317 Ga0495604_0031801 Ga0495604_0031801_2218_2988 248
138 3300047322 Ga0495680_0461965 Ga0495680_0461965_94_852 248
139 3300048904 Ga0496101_0002866 Ga0496101_0002866_132_890 248
140 3300048905 Ga0496102_0603841 Ga0496102_0603841_159_917 248
141 3300048907 Ga0496104_0177322 Ga0496104_0177322_651_1409 248
142 3300048909 Ga0496106_0373187 Ga0496106_0373187_47_805 248
143 3300048912 Ga0496109_0166150 Ga0496109_0166150_1013_1771 248
144 3300048915 Ga0496112_0678094 Ga0496112_0678094_93_851 248
145 3300048917 Ga0496114_0019042 Ga0496114_0019042_4777_5535 248
146 3300048918 Ga0496115_0005544 Ga0496115_0005544_7805_8563 248
147 3300049581 Ga0501047_0314543 Ga0501047_0314543_312_1073 248
148 3300049593 Ga0501077_0147066 Ga0501077_0147066_711_1475 248
149 3300050507 nmdc:mga05p37_58348_c1 nmdc:mga05p37_58348_c1_3281_4030 248
150 3300050510 nmdc:mga06r32_561976_c1 nmdc:mga06r32_561976_c1_173_922 248
151 3300050510 nmdc:mga06r32_64294_c1 nmdc:mga06r32_64294_c1_1295_2044 248
152 3300050511 nmdc:mga08y16_168742_c1 nmdc:mga08y16_168742_c1_505_1266 248
153 3300050513 nmdc:mga0rr50_370119_c1 nmdc:mga0rr50_370119_c1_194_961 248
154 3300053090 Ga0500646_0008966 Ga0500646_0008966_747_1505 248
155 3300013307 Ga0157372_10402967 Ga0157372_104029672 249
156 3300037418 Ga0395900_0000541 Ga0395900_0000541_4604_5356 249
157 iso_pu_bacteria 2808606364 2808871416 249
158 3300005327 Ga0070658_10217210 Ga0070658_102172102 250
159 3300025909 Ga0207705_10263823 Ga0207705_102638232 250
160 3300041486 Ga0451807_1720538 Ga0451807_1720538_347_1117 251
161 3300005436 Ga0070713_100082326 Ga0070713_1000823262 252
162 3300014969 Ga0157376_10000008 Ga0157376_10000008150 252
163 3300046517 Ga0495630_0035446 Ga0495630_0035446_2461_3240 252
164 3300047319 Ga0495674_0037765 Ga0495674_0037765_1838_2617 252
165 3300048917 Ga0496114_0016660 Ga0496114_0016660_4370_5134 252
166 3300048918 Ga0496115_0012165 Ga0496115_0012165_4328_5092 252
167 3300005467 Ga0070706_100249158 Ga0070706_1002491582 253
168 3300005467 Ga0070706_100432190 Ga0070706_1004321902 253
169 3300005468 Ga0070707_100041056 Ga0070707_1000410564 253
170 3300005468 Ga0070707_100408062 Ga0070707_1004080622 253
171 3300005536 Ga0070697_100209716 Ga0070697_1002097162 253
172 3300005841 Ga0068863_100009383 Ga0068863_1000093835 253
173 3300005842 Ga0068858_100162825 Ga0068858_1001628253 253
174 3300006173 Ga0070716_100023354 Ga0070716_1000233542 253
175 3300006871 Ga0075434_100026415 Ga0075434_1000264152 253
176 3300007076 Ga0075435_100123174 Ga0075435_1001231742 253
177 3300009176 Ga0105242_10242279 Ga0105242_102422792 253
178 3300013297 Ga0157378_10056312 Ga0157378_100563123 253
179 3300013308 Ga0157375_10025973 Ga0157375_100259733 253
180 3300013308 Ga0157375_10631780 Ga0157375_106317801 253
181 3300014969 Ga0157376_10000785 Ga0157376_1000078513 253
182 3300025910 Ga0207684_10268811 Ga0207684_102688111 253
183 3300025922 Ga0207646_10001321 Ga0207646_1000132116 253
184 3300025922 Ga0207646_10092915 Ga0207646_100929151 253
185 3300025934 Ga0207686_10143691 Ga0207686_101436912 253
186 3300025939 Ga0207665_10224356 Ga0207665_102243561 253
187 3300026035 Ga0207703_10037771 Ga0207703_100377712 253
188 3300026088 Ga0207641_10004838 Ga0207641_100048382 253
189 3300046455 Ga0495603_0072016 Ga0495603_0072016_342_1109 253
190 3300046459 Ga0495629_0024433 Ga0495629_0024433_408_1217 253
191 3300046472 Ga0495580_0001052 Ga0495580_0001052_18499_19266 253
192 3300046472 Ga0495580_0014625 Ga0495580_0014625_3899_4708 253
193 3300046473 Ga0495582_0000848 Ga0495582_0000848_10543_11310 253
194 3300046476 Ga0495662_0034015 Ga0495662_0034015_1110_1919 253
195 3300046477 Ga0495664_0100918 Ga0495664_0100918_636_1445 253
196 3300046499 Ga0495594_0028451 Ga0495594_0028451_757_1566 253
197 3300046535 Ga0495586_0070538 Ga0495586_0070538_162_971 253
198 3300046680 Ga0495646_0310822 Ga0495646_0310822_11_820 253
199 3300046681 Ga0495647_0003217 Ga0495647_0003217_3321_4130 253
200 3300046689 Ga0495613_0099268 Ga0495613_0099268_79_888 253
201 3300046690 Ga0495624_0101617 Ga0495624_0101617_451_1260 253
202 3300047315 Ga0495581_0056223 Ga0495581_0056223_1147_1956 253
203 3300047319 Ga0495674_0107719 Ga0495674_0107719_554_1363 253
204 3300047321 Ga0495676_0008033 Ga0495676_0008033_8486_9295 253
205 3300047322 Ga0495680_0332453 Ga0495680_0332453_38_805 253
206 3300048908 Ga0496105_0421537 Ga0496105_0421537_252_1019 253
207 3300048917 Ga0496114_0076112 Ga0496114_0076112_1661_2470 253
208 3300048918 Ga0496115_0044329 Ga0496115_0044329_1165_1974 253
209 3300050512 nmdc:mga0n895_17728_c1 nmdc:mga0n895_17728_c1_1626_2393 253
210 3300050513 nmdc:mga0rr50_50137_c1 nmdc:mga0rr50_50137_c1_2211_2978 253
211 3300050515 nmdc:mga0a205_48065_c1 nmdc:mga0a205_48065_c1_50_817 253
212 3300003751 Ga0055538_1002078 Ga0055538_10020781 254
213 3300025224 Ga0209784_100038 Ga0209784_100038178 254
214 iso_pu_bacteria 2643221543 2643738983 254
215 iso_pu_bacteria 2885526491 2885533194 254
216 iso_pu_bacteria 2904162308 2904162575 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

73

161

0.93

PF13649

Methyltransf_25

Methyltransferase domain

72

157

0.92

PF13847

Methyltransf_31

Methyltransferase domain

66

207

0.9

PF13489

Methyltransf_23

Methyltransferase domain

46

215

0.85

PF08242

Methyltransf_12

Methyltransferase domain

73

159

0.84

PF05175

MTS

Methyltransferase small domain

54

166

0.78

PF07021

MetW

Methionine biosynthesis protein MetW

58

164

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9641 16 252
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9562 16 252
3px2-assembly1.cif.gz_D structure of tylm1 from streptomyces fradiae h123n mutant in complex with sah and dtdp-quip3n 0.847 9 130
4oqe-assembly1.cif.gz_A crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme 0.8321 13 130
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.8277 13 130
ID Description Score Start End Superfamily
3ccfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.966 20 251 3.40.50.150
3ccfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9263 20 251 3.40.50.150
af_O74529_17_260_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9145 16 252 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9098 24 126 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9094 24 66 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A329M3R9-F1-model_v4 SAM-dependent methyltransferase 0.9828 4 251 GO:0008168
GO:0032259
AF-A0A0F9GGA4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9719 86 252
AF-A0A7X3ZDF0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9685 87 252 GO:0008757
GO:0032259
AF-A0A0F9GGA4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9662 86 252
AF-A0A329M3R9-F1-model_v4 SAM-dependent methyltransferase 0.9636 4 251 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.52 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map