F325169

General Info

Members Datasets Scaffolds Average Seq Length
214 135 207 385

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10001865|Ga0105249_100018652
Length 435
Sequence LTKKSDLKTERHLFNEIDKGISFISMKKPRQEWTRRKFISTVTGAGATTVFASLMPWTIREDDPRVAAIVANTIGIDTHNHIDVPLNAAELPGPKVDLAGEMIKSGLSAICMTFAVDYQQLRNPGEAYDRFINGLSAMDKMLTGNNMQRSLNLADLNKAHNKHIPTVIQSVEGAHFLEGHLDRLEAAYGKGVRHLTLLHDHDASVPLGDVFTNPAQWKGLTSFGADVIRECNKLGILVDLSHASNETVNAALKVAIHPVLISHTGLDTQLGQNENMAKMMRPRLISKEQAKIVANTGGVIGVWTHLADTPLEYARNIRAMVDVAGIEHVCIGTDTKLTPAYKSPGDFGPKPGTSPQQSSNPGNHKDSNXXXXPGGDNNRNRFGNGTNQTWPDQKTGFYFTVVDALLKTGFTEKEIGKIGGANFCRVFDAATAGHQ

Samples

Sample ID Description Type Environment
1 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2739367663 Pedobacter sp. YR510 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
135 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.75
Nodule 0
Rhizoplane 0.93
Rhizosphere 79.91
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001638 3300002773 Bacteria 9337
2 JGI25150J39212_1000003 3300002774 Bacteria 508651
3 JGI25151J46595_10000002 3300003187 Bacteria 731381
4 JGI25153J46596_10000030 3300003215 Bacteria 200879
5 rootH1_10054049 3300003323 Bacteria 3132
6 JGI25160J50197_1000727 3300003354 Bacteria 18060
7 Ga0065714_10091067 3300005288 Bacteria 1922
8 Ga0070658_10055984 3300005327 Unclassified 3204
9 Ga0070676_10010816 3300005328 Bacteria 4951
10 Ga0070676_10032327 3300005328 Unclassified 2997
11 Ga0068869_100092734 3300005334 Bacteria 2274
12 Ga0070666_10001906 3300005335 Bacteria 12681
13 Ga0070666_10007594 3300005335 Bacteria 6690
14 Ga0070666_10119610 3300005335 Unclassified 1826
15 Ga0068868_100000964 3300005338 Bacteria 19618
16 Ga0070668_100022671 3300005347 Bacteria 4747
17 Ga0070668_100099499 3300005347 Unclassified 2302
18 Ga0070669_100046979 3300005353 Bacteria 3148
19 Ga0070669_100257598 3300005353 Unclassified 1391
20 Ga0070675_100252455 3300005354 Unclassified 1544
21 Ga0070671_100044547 3300005355 Bacteria 3687
22 Ga0070674_100089070 3300005356 Unclassified 2222
23 Ga0070673_100206167 3300005364 Unclassified 1695
24 Ga0070673_100229235 3300005364 Unclassified 1611
25 Ga0070667_100107039 3300005367 Bacteria 2421
26 Ga0070667_100163196 3300005367 Unclassified 1964
27 Ga0070678_100138283 3300005456 Unclassified 1945
28 Ga0070662_100126727 3300005457 Bacteria 1963
29 Ga0068853_100005944 3300005539 Bacteria 9639
30 Ga0068853_100039519 3300005539 Bacteria 4024
31 Ga0070672_100030546 3300005543 Bacteria 4049
32 Ga0070665_100000002 3300005548 Bacteria 849037
33 Ga0070665_100000012 3300005548 Bacteria 508937
34 Ga0070665_100007305 3300005548 Bacteria 11241
35 Ga0070665_100078622 3300005548 Unclassified 3305
36 Ga0068859_100000030 3300005617 Bacteria 175435
37 Ga0068859_100332060 3300005617 Bacteria 1614
38 Ga0068864_100021448 3300005618 Bacteria 5412
39 Ga0068864_100025951 3300005618 Bacteria 4938
40 Ga0068851_10012315 3300005834 Bacteria 4029
41 Ga0068870_10097880 3300005840 Unclassified 1652
42 Ga0068863_100006488 3300005841 Bacteria 11472
43 Ga0068863_100048715 3300005841 Bacteria 4017
44 Ga0068858_100005831 3300005842 Bacteria 12032
45 Ga0068860_100000003 3300005843 Bacteria 575741
46 Ga0068860_100004551 3300005843 Bacteria 14155
47 Ga0068860_100004931 3300005843 Bacteria 13602
48 Ga0068860_100105095 3300005843 Unclassified 2696
49 Ga0070717_10036170 3300006028 Bacteria 4003
50 Ga0075367_10104302 3300006178 Bacteria 1736
51 Ga0068871_100034801 3300006358 Unclassified 3999
52 Ga0068871_100129843 3300006358 Unclassified 2136
53 Ga0068865_100079086 3300006881 Unclassified 2354
54 Ga0097620_100000030 3300006931 Bacteria 175435
55 Ga0097620_100332063 3300006931 Bacteria 1614
56 Ga0105240_10018696 3300009093 Bacteria 9286
57 Ga0105240_10045357 3300009093 Bacteria 5577
58 Ga0105240_10108631 3300009093 Unclassified 3360
59 Ga0105247_10003248 3300009101 Bacteria 10675
60 Ga0105243_10123976 3300009148 Unclassified 2183
61 Ga0105241_10000568 3300009174 Bacteria 27758
62 Ga0105242_10190062 3300009176 Bacteria 1817
63 Ga0105248_10060643 3300009177 Bacteria 4247
64 Ga0105237_10003016 3300009545 Bacteria 20311
65 Ga0105237_10041911 3300009545 Bacteria 4617
66 Ga0105238_10011931 3300009551 Bacteria 8756
67 Ga0105238_10259559 3300009551 Bacteria 1717
68 Ga0105249_10001865 3300009553 Bacteria 18291
69 Ga0105239_10002272 3300010375 Bacteria 24542
70 Ga0105239_10012799 3300010375 Bacteria 9333
71 Ga0105239_10319032 3300010375 Unclassified 1752
72 Ga0105246_10018613 3300011119 Bacteria 4429
73 Ga0105246_10050303 3300011119 Unclassified 2858
74 Ga0157373_10002209 3300013100 Bacteria 14730
75 Ga0157374_10000003 3300013296 Bacteria 854471
76 Ga0157374_10080307 3300013296 Bacteria 3093
77 Ga0157378_10105166 3300013297 Unclassified 2581
78 Ga0157378_10338590 3300013297 Unclassified 1466
79 Ga0163162_10000366 3300013306 Bacteria 40923
80 Ga0163162_10001040 3300013306 Bacteria 25805
81 Ga0163162_10001220 3300013306 Bacteria 24025
82 Ga0163162_10003489 3300013306 Bacteria 15038
83 Ga0163162_10003741 3300013306 Bacteria 14572
84 Ga0163162_10015843 3300013306 Bacteria 7367
85 Ga0163162_10055297 3300013306 Bacteria 3995
86 Ga0163162_10477402 3300013306 Bacteria 1378
87 Ga0157375_10019076 3300013308 Bacteria 6229
88 Ga0157375_10255074 3300013308 Unclassified 1915
89 Ga0157376_10001285 3300014969 Bacteria 16529
90 Ga0157376_10023370 3300014969 Unclassified 4837
91 Ga0157376_10028832 3300014969 Bacteria 4416
92 Ga0163161_10000341 3300017792 Bacteria 39792
93 Ga0207425_1000003 3300025245 Bacteria 1145342
94 Ga0209129_1000014 3300025258 Bacteria 509018
95 Ga0209025_1000007 3300025294 Bacteria 1145109
96 Ga0209758_1000012 3300025297 Bacteria 949866
97 Ga0207426_1000026 3300025302 Bacteria 515228
98 Ga0207710_10002411 3300025900 Bacteria 8709
99 Ga0207680_10000702 3300025903 Bacteria 15702
100 Ga0207680_10069005 3300025903 Unclassified 2183
101 Ga0207645_10016055 3300025907 Bacteria 4960
102 Ga0207645_10077740 3300025907 Unclassified 2126
103 Ga0207705_10227321 3300025909 Bacteria 1418
104 Ga0207654_10001785 3300025911 Bacteria 11171
105 Ga0207695_10006837 3300025913 Bacteria 14685
106 Ga0207695_10027118 3300025913 Bacteria 6380
107 Ga0207671_10001505 3300025914 Bacteria 26868
108 Ga0207671_10010842 3300025914 Bacteria 7477
109 Ga0207681_10062196 3300025923 Bacteria 2569
110 Ga0207694_10053997 3300025924 Bacteria 3117
111 Ga0207670_10059699 3300025936 Bacteria 2595
112 Ga0207691_10033553 3300025940 Unclassified 4779
113 Ga0207711_10080328 3300025941 Bacteria 2848
114 Ga0207689_10008800 3300025942 Bacteria 8776
115 Ga0207689_10177483 3300025942 Unclassified 1757
116 Ga0207667_10053394 3300025949 Bacteria 4253
117 Ga0207651_10153360 3300025960 Unclassified 1796
118 Ga0207651_10208643 3300025960 Unclassified 1571
119 Ga0207668_10001832 3300025972 Bacteria 12404
120 Ga0207658_10001482 3300025986 Bacteria 18222
121 Ga0207658_10203274 3300025986 Bacteria 1655
122 Ga0207677_10284764 3300026023 Unclassified 1358
123 Ga0207703_10001187 3300026035 Bacteria 24503
124 Ga0207639_10016520 3300026041 Bacteria 5225
125 Ga0207639_10047599 3300026041 Unclassified 3242
126 Ga0207641_10000891 3300026088 Bacteria 31180
127 Ga0207641_10106595 3300026088 Unclassified 2477
128 Ga0207648_10014597 3300026089 Bacteria 7253
129 Ga0207648_10016428 3300026089 Bacteria 6761
130 Ga0207683_10111556 3300026121 Unclassified 2449
131 Ga0207683_10240877 3300026121 Bacteria 1650
132 Ga0268266_10000039 3300028379 Bacteria 324579
133 Ga0268266_10000073 3300028379 Bacteria 232074
134 Ga0268266_10004312 3300028379 Bacteria 13682
135 Ga0268266_10072372 3300028379 Bacteria 2989
136 Ga0268264_10000063 3300028381 Bacteria 301702
137 Ga0268264_10007096 3300028381 Bacteria 9388
138 Ga0268264_10012036 3300028381 Bacteria 7123
139 Ga0268264_10136501 3300028381 Unclassified 2181
140 Ga0307517_10006765 3300028786 Bacteria 16871
141 Ga0307515_10000003 3300028794 Bacteria 891317
142 Ga0307515_10000493 3300028794 Bacteria 94441
143 Ga0307515_10001092 3300028794 Bacteria 62178
144 Ga0307515_10004328 3300028794 Bacteria 29443
145 Ga0307511_10000033 3300030521 Bacteria 104421
146 Ga0265327_10000208 3300031251 Bacteria 123034
147 Ga0265327_10090318 3300031251 Bacteria 1495
148 Ga0307509_10145967 3300031507 Bacteria 2292
149 Ga0307508_10089448 3300031616 Bacteria 2664
150 Ga0307516_10046443 3300031730 Bacteria 4285
151 Ga0307510_10000766 3300033180 Bacteria 33227
152 Ga0436365_0286041 3300039437 Unclassified 4246
153 Ga0436363_1016713 3300039450 Bacteria 2437
154 Ga0495638_0000005 3300046460 Bacteria 680627
155 Ga0495638_0020029 3300046460 Bacteria 4421
156 Ga0495650_0000011 3300046471 Bacteria 615329
157 Ga0495650_0000023 3300046471 Bacteria 527763
158 Ga0495585_0000191 3300046492 Bacteria 65147
159 Ga0495585_0005119 3300046492 Bacteria 8342
160 Ga0495583_0037544 3300046506 Bacteria 2296
161 Ga0495606_0000060 3300046507 Bacteria 185907
162 Ga0495606_0004223 3300046507 Bacteria 14543
163 Ga0495606_0028233 3300046507 Bacteria 3963
164 Ga0495610_0007291 3300046512 Bacteria 7401
165 Ga0495616_0000540 3300046513 Bacteria 28554
166 Ga0495616_0019380 3300046513 Bacteria 3713
167 Ga0495631_0000952 3300046518 Bacteria 18022
168 Ga0495632_0075324 3300046519 Bacteria 1615
169 Ga0495643_0000354 3300046522 Bacteria 62431
170 Ga0495648_0008089 3300046524 Bacteria 8314
171 Ga0495648_0013718 3300046524 Bacteria 5972
172 Ga0495654_0023661 3300046530 Bacteria 3180
173 Ga0495609_0000130 3300046538 Bacteria 81359
174 Ga0495609_0001316 3300046538 Bacteria 16887
175 Ga0495609_0015574 3300046538 Bacteria 3557
176 Ga0495633_0000008 3300046558 Bacteria 301830
177 Ga0495633_0000518 3300046558 Bacteria 38686
178 Ga0495633_0019712 3300046558 Bacteria 3406
179 Ga0495668_0000576 3300046616 Bacteria 44790
180 Ga0495625_0000018 3300046660 Bacteria 299567
181 Ga0495625_0002259 3300046660 Bacteria 21183
182 Ga0495625_0003881 3300046660 Bacteria 14432
183 Ga0495625_0006563 3300046660 Bacteria 10331
184 Ga0495625_0096189 3300046660 Bacteria 2040
185 Ga0495625_0122712 3300046660 Unclassified 1766
186 Ga0495661_0000189 3300046665 Bacteria 71154
187 Ga0495661_0010747 3300046665 Bacteria 6232
188 Ga0495649_0000111 3300046694 Bacteria 71877
189 Ga0495649_0072934 3300046694 Bacteria 1840
190 Ga0495683_0084413 3300047323 Unclassified 1545
191 Ga0495686_0000324 3300047472 Bacteria 79635
192 Ga0495686_0010072 3300047472 Bacteria 6752
193 Ga0496109_0066497 3300048912 Unclassified 3301
194 Ga0496115_0011650 3300048918 Bacteria 6599
195 Ga0495682_0028124 3300049460 Bacteria 2085
196 Ga0500578_0037618 3300053086 Bacteria 3108
197 Ga0500644_0087664 3300053088 Bacteria 1158
198 Ga0500583_0002162 3300053092 Bacteria 5839
199 Ga0500554_008516 3300053102 Bacteria 2415
200 Ga0500594_0029130 3300053118 Unclassified 1442
201 Ga0500608_003726 3300053122 Bacteria 5775
202 Ga0500618_005628 3300053125 Bacteria 3780
203 Ga0500618_015416 3300053125 Bacteria 1932
204 Ga0500658_0006919 3300053134 Bacteria 4197
205 Ga0500616_0000003 3300053153 Bacteria 1220687
206 Ga0500622_0003769 3300053156 Bacteria 9902
207 Ga0500624_000187 3300053157 Bacteria 24423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0286041 Ga0436365_0286041_2537_3604 342
2 3300039450 Ga0436363_1016713 Ga0436363_1016713_1225_2292 342
3 3300013297 Ga0157378_10338590 Ga0157378_103385901 346
4 3300013306 Ga0163162_10001040 Ga0163162_100010405 350
5 3300025903 Ga0207680_10069005 Ga0207680_100690052 350
6 3300046519 Ga0495632_0075324 Ga0495632_0075324_84_1244 351
7 3300006358 Ga0068871_100034801 Ga0068871_1000348011 354
8 3300046660 Ga0495625_0122712 Ga0495625_0122712_126_1196 355
9 3300005327 Ga0070658_10055984 Ga0070658_100559841 356
10 3300005328 Ga0070676_10010816 Ga0070676_100108162 356
11 3300005335 Ga0070666_10007594 Ga0070666_100075943 356
12 3300005338 Ga0068868_100000964 Ga0068868_1000009644 356
13 3300005347 Ga0070668_100022671 Ga0070668_1000226713 356
14 3300005364 Ga0070673_100206167 Ga0070673_1002061672 356
15 3300005539 Ga0068853_100039519 Ga0068853_1000395191 356
16 3300005548 Ga0070665_100007305 Ga0070665_1000073053 356
17 3300005618 Ga0068864_100025951 Ga0068864_1000259513 356
18 3300005834 Ga0068851_10012315 Ga0068851_100123154 356
19 3300005841 Ga0068863_100048715 Ga0068863_1000487152 356
20 3300025907 Ga0207645_10016055 Ga0207645_100160553 356
21 3300025960 Ga0207651_10153360 Ga0207651_101533602 356
22 3300025972 Ga0207668_10001832 Ga0207668_100018321 356
23 3300025986 Ga0207658_10001482 Ga0207658_100014829 356
24 3300026041 Ga0207639_10016520 Ga0207639_100165204 356
25 3300026088 Ga0207641_10106595 Ga0207641_101065952 356
26 3300026089 Ga0207648_10016428 Ga0207648_100164285 356
27 3300028379 Ga0268266_10004312 Ga0268266_100043122 356
28 3300053088 Ga0500644_0087664 Ga0500644_0087664_48_1121 356
29 3300013308 Ga0157375_10255074 Ga0157375_102550743 359
30 3300031251 Ga0265327_10090318 Ga0265327_100903181 360
31 3300005843 Ga0068860_100004551 Ga0068860_1000045519 361
32 3300028381 Ga0268264_10012036 Ga0268264_100120368 361
33 3300046471 Ga0495650_0000011 Ga0495650_0000011_327812_328900 361
34 3300046460 Ga0495638_0000005 Ga0495638_0000005_218946_220040 362
35 3300013306 Ga0163162_10055297 Ga0163162_100552971 363
36 3300053125 Ga0500618_015416 Ga0500618_015416_500_1606 365
37 3300031616 Ga0307508_10089448 Ga0307508_100894482 366
38 3300053157 Ga0500624_000187 Ga0500624_000187_22572_23750 366
39 3300006178 Ga0075367_10104302 Ga0075367_101043022 367
40 3300053092 Ga0500583_0002162 Ga0500583_0002162_1206_2378 367
41 3300009551 Ga0105238_10259559 Ga0105238_102595592 368
42 3300006028 Ga0070717_10036170 Ga0070717_100361703 369
43 3300009093 Ga0105240_10045357 Ga0105240_100453572 369
44 3300013306 Ga0163162_10000366 Ga0163162_1000036621 369
45 3300005288 Ga0065714_10091067 Ga0065714_100910672 370
46 3300046665 Ga0495661_0000189 Ga0495661_0000189_7235_8449 370
47 3300053086 Ga0500578_0037618 Ga0500578_0037618_1051_2163 370
48 3300005457 Ga0070662_100126727 Ga0070662_1001267272 372
49 3300005843 Ga0068860_100000003 Ga0068860_100000003216 372
50 3300013100 Ga0157373_10002209 Ga0157373_1000220911 372
51 3300013296 Ga0157374_10080307 Ga0157374_100803072 372
52 3300013306 Ga0163162_10477402 Ga0163162_104774021 372
53 3300026121 Ga0207683_10240877 Ga0207683_102408771 372
54 3300028381 Ga0268264_10000063 Ga0268264_10000063134 372
55 3300030521 Ga0307511_10000033 Ga0307511_1000003340 372
56 3300005328 Ga0070676_10032327 Ga0070676_100323273 373
57 3300005335 Ga0070666_10119610 Ga0070666_101196103 373
58 3300005347 Ga0070668_100099499 Ga0070668_1000994992 373
59 3300005353 Ga0070669_100257598 Ga0070669_1002575981 373
60 3300005354 Ga0070675_100252455 Ga0070675_1002524552 373
61 3300005356 Ga0070674_100089070 Ga0070674_1000890703 373
62 3300005364 Ga0070673_100229235 Ga0070673_1002292351 373
63 3300005367 Ga0070667_100163196 Ga0070667_1001631963 373
64 3300005456 Ga0070678_100138283 Ga0070678_1001382831 373
65 3300005543 Ga0070672_100030546 Ga0070672_1000305462 373
66 3300005840 Ga0068870_10097880 Ga0068870_100978802 373
67 3300005843 Ga0068860_100105095 Ga0068860_1001050953 373
68 3300006358 Ga0068871_100129843 Ga0068871_1001298433 373
69 3300006881 Ga0068865_100079086 Ga0068865_1000790864 373
70 3300009176 Ga0105242_10190062 Ga0105242_101900621 373
71 3300011119 Ga0105246_10050303 Ga0105246_100503034 373
72 3300025907 Ga0207645_10077740 Ga0207645_100777402 373
73 3300025940 Ga0207691_10033553 Ga0207691_100335535 373
74 3300025942 Ga0207689_10177483 Ga0207689_101774832 373
75 3300025960 Ga0207651_10208643 Ga0207651_102086432 373
76 3300026023 Ga0207677_10284764 Ga0207677_102847641 373
77 3300026089 Ga0207648_10014597 Ga0207648_100145972 373
78 3300026121 Ga0207683_10111556 Ga0207683_101115564 373
79 3300028379 Ga0268266_10072372 Ga0268266_100723724 373
80 3300028381 Ga0268264_10136501 Ga0268264_101365013 373
81 3300046558 Ga0495633_0000008 Ga0495633_0000008_242468_243652 373
82 3300053102 Ga0500554_008516 Ga0500554_008516_694_1821 373
83 iso_pu_bacteria 2818991442 2819575485 373
84 3300053125 Ga0500618_005628 Ga0500618_005628_2196_3323 374
85 3300009551 Ga0105238_10011931 Ga0105238_100119313 376
86 3300025924 Ga0207694_10053997 Ga0207694_100539974 376
87 3300046507 Ga0495606_0028233 Ga0495606_0028233_1743_2993 376
88 3300005353 Ga0070669_100046979 Ga0070669_1000469793 377
89 3300013306 Ga0163162_10003741 Ga0163162_100037417 377
90 3300014969 Ga0157376_10028832 Ga0157376_100288322 377
91 3300017792 Ga0163161_10000341 Ga0163161_1000034129 377
92 3300025923 Ga0207681_10062196 Ga0207681_100621963 377
93 3300005548 Ga0070665_100000002 Ga0070665_100000002597 378
94 3300028379 Ga0268266_10000073 Ga0268266_10000073163 378
95 3300028794 Ga0307515_10001092 Ga0307515_1000109219 378
96 3300046460 Ga0495638_0020029 Ga0495638_0020029_1055_2353 378
97 3300046524 Ga0495648_0008089 Ga0495648_0008089_6347_7489 378
98 3300046538 Ga0495609_0000130 Ga0495609_0000130_33372_34550 378
99 3300053134 Ga0500658_0006919 Ga0500658_0006919_2734_3975 378
100 3300053156 Ga0500622_0003769 Ga0500622_0003769_7643_8941 378
101 3300009093 Ga0105240_10108631 Ga0105240_101086314 379
102 3300009177 Ga0105248_10060643 Ga0105248_100606434 379
103 3300010375 Ga0105239_10319032 Ga0105239_103190322 379
104 3300013296 Ga0157374_10000003 Ga0157374_10000003585 379
105 3300013297 Ga0157378_10105166 Ga0157378_101051662 379
106 3300014969 Ga0157376_10001285 Ga0157376_1000128515 379
107 3300014969 Ga0157376_10023370 Ga0157376_100233702 379
108 3300025909 Ga0207705_10227321 Ga0207705_102273212 379
109 3300025941 Ga0207711_10080328 Ga0207711_100803282 379
110 3300046513 Ga0495616_0019380 Ga0495616_0019380_1437_2684 379
111 3300046524 Ga0495648_0013718 Ga0495648_0013718_2258_3520 379
112 3300046530 Ga0495654_0023661 Ga0495654_0023661_513_1775 379
113 3300046538 Ga0495609_0001316 Ga0495609_0001316_12362_13624 379
114 3300046616 Ga0495668_0000576 Ga0495668_0000576_31636_32898 379
115 3300046660 Ga0495625_0002259 Ga0495625_0002259_12519_13781 379
116 3300046660 Ga0495625_0006563 Ga0495625_0006563_80_1324 379
117 3300048912 Ga0496109_0066497 Ga0496109_0066497_2031_3272 379
118 3300049460 Ga0495682_0028124 Ga0495682_0028124_476_1738 379
119 3300009545 Ga0105237_10003016 Ga0105237_100030168 380
120 3300025914 Ga0207671_10001505 Ga0207671_1000150511 380
121 3300028794 Ga0307515_10000003 Ga0307515_10000003323 380
122 3300028794 Ga0307515_10004328 Ga0307515_1000432820 380
123 3300046522 Ga0495643_0000354 Ga0495643_0000354_54966_56213 380
124 3300005539 Ga0068853_100005944 Ga0068853_1000059446 381
125 3300005548 Ga0070665_100000012 Ga0070665_100000012360 381
126 3300009148 Ga0105243_10123976 Ga0105243_101239762 381
127 3300025913 Ga0207695_10006837 Ga0207695_1000683714 381
128 3300026041 Ga0207639_10047599 Ga0207639_100475991 381
129 3300028379 Ga0268266_10000039 Ga0268266_10000039110 381
130 3300031251 Ga0265327_10000208 Ga0265327_1000020878 381
131 3300005617 Ga0068859_100332060 Ga0068859_1003320602 382
132 3300006931 Ga0097620_100332063 Ga0097620_1003320632 382
133 3300013306 Ga0163162_10001220 Ga0163162_100012204 382
134 3300003354 JGI25160J50197_1000727 JGI25160J50197_10007278 383
135 3300025302 Ga0207426_1000026 Ga0207426_1000026408 383
136 3300046660 Ga0495625_0096189 Ga0495625_0096189_248_1492 383
137 3300031730 Ga0307516_10046443 Ga0307516_100464436 384
138 3300046492 Ga0495585_0000191 Ga0495585_0000191_58456_59751 384
139 3300053153 Ga0500616_0000003 Ga0500616_0000003_756019_757179 384
140 3300047472 Ga0495686_0010072 Ga0495686_0010072_1190_2437 385
141 iso_pu_bacteria 2958512119 2958515411 385
142 3300046507 Ga0495606_0000060 Ga0495606_0000060_169236_170510 386
143 3300013306 Ga0163162_10015843 Ga0163162_100158434 387
144 3300025914 Ga0207671_10010842 Ga0207671_100108426 387
145 3300046492 Ga0495585_0005119 Ga0495585_0005119_5639_6901 387
146 3300046558 Ga0495633_0000518 Ga0495633_0000518_29858_31120 387
147 3300009545 Ga0105237_10041911 Ga0105237_100419112 388
148 3300003323 rootH1_10054049 rootH1_100540492 389
149 3300046506 Ga0495583_0037544 Ga0495583_0037544_327_1625 389
150 3300046512 Ga0495610_0007291 Ga0495610_0007291_2273_3571 389
151 3300028794 Ga0307515_10000493 Ga0307515_1000049357 390
152 3300033180 Ga0307510_10000766 Ga0307510_1000076622 390
153 3300046558 Ga0495633_0019712 Ga0495633_0019712_2055_3353 390
154 3300047323 Ga0495683_0084413 Ga0495683_0084413_70_1368 390
155 3300048918 Ga0496115_0011650 Ga0496115_0011650_5185_6417 390
156 iso_pu_bacteria 2585428115 2587942846 390
157 iso_pu_bacteria 2929239360 2929239453 390
158 3300046665 Ga0495661_0010747 Ga0495661_0010747_4314_5612 391
159 3300009093 Ga0105240_10018696 Ga0105240_100186965 392
160 3300010375 Ga0105239_10012799 Ga0105239_100127999 392
161 3300025913 Ga0207695_10027118 Ga0207695_100271185 392
162 3300025949 Ga0207667_10053394 Ga0207667_100533942 392
163 3300046471 Ga0495650_0000023 Ga0495650_0000023_488938_490212 392
164 3300046513 Ga0495616_0000540 Ga0495616_0000540_20836_22110 392
165 3300046538 Ga0495609_0015574 Ga0495609_0015574_1235_2509 392
166 3300046660 Ga0495625_0000018 Ga0495625_0000018_54243_55517 392
167 3300046694 Ga0495649_0000111 Ga0495649_0000111_16233_17507 392
168 3300046694 Ga0495649_0072934 Ga0495649_0072934_435_1676 392
169 3300028786 Ga0307517_10006765 Ga0307517_1000676510 393
170 3300046507 Ga0495606_0004223 Ga0495606_0004223_3622_4833 393
171 3300046518 Ga0495631_0000952 Ga0495631_0000952_2769_4010 393
172 3300005355 Ga0070671_100044547 Ga0070671_1000445472 394
173 3300005617 Ga0068859_100000030 Ga0068859_10000003049 394
174 3300005842 Ga0068858_100005831 Ga0068858_1000058319 394
175 3300006931 Ga0097620_100000030 Ga0097620_10000003096 394
176 3300009101 Ga0105247_10003248 Ga0105247_100032487 394
177 3300009174 Ga0105241_10000568 Ga0105241_1000056810 394
178 3300013308 Ga0157375_10019076 Ga0157375_100190761 394
179 3300025900 Ga0207710_10002411 Ga0207710_100024112 394
180 3300025911 Ga0207654_10001785 Ga0207654_100017857 394
181 3300025936 Ga0207670_10059699 Ga0207670_100596992 394
182 3300026035 Ga0207703_10001187 Ga0207703_100011878 394
183 3300010375 Ga0105239_10002272 Ga0105239_1000227223 396
184 3300005548 Ga0070665_100078622 Ga0070665_1000786222 397
185 iso_pu_bacteria 2738541278 2738731686 397
186 3300053118 Ga0500594_0029130 Ga0500594_0029130_166_1383 398
187 3300046660 Ga0495625_0003881 Ga0495625_0003881_12045_13301 399
188 3300053122 Ga0500608_003726 Ga0500608_003726_3139_4380 399
189 iso_pu_bacteria 8003151029 8003153377 400
190 iso_pu_bacteria 2739367663 2739644380 402
191 3300005334 Ga0068869_100092734 Ga0068869_1000927342 404
192 3300005335 Ga0070666_10001906 Ga0070666_100019064 404
193 3300005367 Ga0070667_100107039 Ga0070667_1001070392 404
194 3300005618 Ga0068864_100021448 Ga0068864_1000214484 404
195 3300005841 Ga0068863_100006488 Ga0068863_1000064885 404
196 3300005843 Ga0068860_100004931 Ga0068860_10000493111 404
197 3300009553 Ga0105249_10001865 Ga0105249_100018652 404
198 3300011119 Ga0105246_10018613 Ga0105246_100186136 404
199 3300013306 Ga0163162_10003489 Ga0163162_1000348913 404
200 3300025903 Ga0207680_10000702 Ga0207680_1000070213 404
201 3300025942 Ga0207689_10008800 Ga0207689_100088004 404
202 3300025986 Ga0207658_10203274 Ga0207658_102032741 404
203 3300026088 Ga0207641_10000891 Ga0207641_100008915 404
204 3300028381 Ga0268264_10007096 Ga0268264_100070966 404
205 3300047472 Ga0495686_0000324 Ga0495686_0000324_44166_45395 405
206 3300031507 Ga0307509_10145967 Ga0307509_101459672 409
207 3300002773 JGI25152J39213_1001638 JGI25152J39213_100163810 424
208 3300002774 JGI25150J39212_1000003 JGI25150J39212_100000336 424
209 3300003187 JGI25151J46595_10000002 JGI25151J46595_1000000236 424
210 3300003215 JGI25153J46596_10000030 JGI25153J46596_1000003026 424
211 3300025245 Ga0207425_1000003 Ga0207425_1000003800 424
212 3300025258 Ga0209129_1000014 Ga0209129_100001433 424
213 3300025294 Ga0209025_1000007 Ga0209025_1000007799 424
214 3300025297 Ga0209758_1000012 Ga0209758_1000012800 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01244

Peptidase_M19

Membrane dipeptidase (Peptidase family M19)

68

429

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5g-assembly1.cif.gz_B crystal strcuture of amidohydrolase from pseudomonas aeruginosa 0.8143 42 423
2i5g-assembly1.cif.gz_B crystal strcuture of amidohydrolase from pseudomonas aeruginosa 0.8071 42 423
5lx1-assembly1.cif.gz_A-2 cys-gly dipeptidase glij mutant d304a 0.8018 41 420
5lwz-assembly2.cif.gz_C cys-gly dipeptidase glij (space group c2) 0.7988 41 420
5lx7-assembly1.cif.gz_A-2 cys-gly dipeptidase glij mutant d38n 0.795 41 420
ID Description Score Start End Superfamily
af_Q9VPG0_118_451_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8127 41 420 3.20.20.140
2i5gB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8035 42 423 3.20.20.140
af_F1QFU9_23_390_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8009 34 420 3.20.20.140
2i5gB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7963 42 423 3.20.20.140
3b40A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.796 41 421 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3D3CW21-F1-model_v4 Peptidase M19 0.9725 96 422 GO:0006508
GO:0070573
AF-A0A3D3CW21-F1-model_v4 Peptidase M19 0.9454 96 422 GO:0006508
GO:0070573
AF-F6IL57-F1-model_v4 Peptidase M19 renal dipeptidase 0.9447 78 420 GO:0006508
GO:0070573
AF-A0A7V0XFJ2-F1-model_v4 Membrane dipeptidase 0.9261 76 265 GO:0006508
GO:0070573
AF-A0A3P0XJ76-F1-model_v4 Peptidase M19 0.9214 20 422 GO:0006508
GO:0070573

Feature Viewer

pLDDT pTM Quality
80.95 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map