F325066

General Info

Members Datasets Scaffolds Average Seq Length
214 145 214 164

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100630456|Ga0070712_1006304562
Length 181
Sequence MEPVAVQDRSSGRARKVAVEFLKALETSGFSVWVRESGSLWSFPGILLVHTYGMGIMVGVILAVDLSILGFVPALPLAPLQKFFPIVWTAFWLNAITGTILLAADATTKLTNPDFGVKMAFIVLAVINQRMIQKRLFGGSPSTSSTVAGAHGKTLAWMSIVCWLGAITAGRLLAYVGTAVK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.27
Rhizosphere 95.33
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10134480 3300005293 Bacteria 1954
2 Ga0070683_100065242 3300005329 Bacteria 3390
3 Ga0070690_100859262 3300005330 Bacteria 707
4 Ga0068869_100480260 3300005334 Unclassified 1035
5 Ga0070666_10231225 3300005335 Bacteria 1306
6 Ga0070666_10702089 3300005335 Unclassified 742
7 Ga0070680_100532624 3300005336 Bacteria 1006
8 Ga0070692_10375943 3300005345 Unclassified 890
9 Ga0070692_10421137 3300005345 Bacteria 848
10 Ga0070669_100281671 3300005353 Unclassified 1332
11 Ga0070675_100164181 3300005354 Bacteria 1912
12 Ga0070673_101253912 3300005364 Unclassified 695
13 Ga0070709_10027476 3300005434 Unclassified 3383
14 Ga0070713_100057718 3300005436 Bacteria 3234
15 Ga0070713_100129452 3300005436 Unclassified 2224
16 Ga0070713_100381758 3300005436 Unclassified 1313
17 Ga0070700_100857244 3300005441 Unclassified 736
18 Ga0070694_100000711 3300005444 Bacteria 18524
19 Ga0070678_101304651 3300005456 Bacteria 675
20 Ga0070662_100987565 3300005457 Unclassified 720
21 Ga0070681_10365520 3300005458 Bacteria 1353
22 Ga0070707_100005708 3300005468 Bacteria 11608
23 Ga0070707_100064348 3300005468 Bacteria 3521
24 Ga0070707_100143060 3300005468 Unclassified 2328
25 Ga0070698_100520362 3300005471 Bacteria 1128
26 Ga0070699_100145909 3300005518 Bacteria 2091
27 Ga0070679_100226803 3300005530 Bacteria 1828
28 Ga0070679_100391950 3300005530 Bacteria 1335
29 Ga0070684_100105628 3300005535 Bacteria 2520
30 Ga0070672_100384335 3300005543 Bacteria 1201
31 Ga0070686_100070092 3300005544 Unclassified 2292
32 Ga0070686_101004347 3300005544 Bacteria 684
33 Ga0070695_100044174 3300005545 Bacteria 2835
34 Ga0070696_100360574 3300005546 Bacteria 1128
35 Ga0070693_100483778 3300005547 Bacteria 875
36 Ga0070665_100838228 3300005548 Unclassified 932
37 Ga0070704_100409327 3300005549 Unclassified 1159
38 Ga0070664_100282056 3300005564 Bacteria 1498
39 Ga0070664_101460988 3300005564 Bacteria 647
40 Ga0068854_100026281 3300005578 Bacteria 4000
41 Ga0070702_100435513 3300005615 Bacteria 947
42 Ga0068859_100504565 3300005617 Bacteria 1305
43 Ga0068859_101652480 3300005617 Bacteria 707
44 Ga0068866_10296246 3300005718 Unclassified 1008
45 Ga0068858_100073383 3300005842 Unclassified 3176
46 Ga0081455_10079150 3300005937 Bacteria 2699
47 Ga0070717_10140940 3300006028 Unclassified 2079
48 Ga0070715_10095917 3300006163 Bacteria 1374
49 Ga0070715_10147768 3300006163 Bacteria 1148
50 Ga0070712_100630456 3300006175 Bacteria 909
51 Ga0097621_100006560 3300006237 Bacteria 8265
52 Ga0097621_100011720 3300006237 Bacteria 6473
53 Ga0097621_100016220 3300006237 Bacteria 5626
54 Ga0068871_100043231 3300006358 Unclassified 3619
55 Ga0068871_100387392 3300006358 Bacteria 1243
56 Ga0068871_100514733 3300006358 Unclassified 1080
57 Ga0075428_100999990 3300006844 Unclassified 885
58 Ga0075433_10305907 3300006852 Bacteria 1407
59 Ga0075434_100006627 3300006871 Bacteria 10625
60 Ga0075434_100059840 3300006871 Bacteria 3788
61 Ga0075434_100274227 3300006871 Bacteria 1706
62 Ga0075434_100948259 3300006871 Unclassified 875
63 Ga0068865_101527357 3300006881 Bacteria 599
64 Ga0097620_100504552 3300006931 Bacteria 1305
65 Ga0097620_101652505 3300006931 Bacteria 707
66 Ga0075435_100027217 3300007076 Bacteria 4469
67 Ga0075435_100065011 3300007076 Bacteria 2965
68 Ga0075435_100135034 3300007076 Bacteria 2066
69 Ga0099794_10390835 3300007265 Unclassified 726
70 Ga0111539_10313773 3300009094 Unclassified 1825
71 Ga0105245_10643437 3300009098 Bacteria 1090
72 Ga0105247_10143612 3300009101 Unclassified 1566
73 Ga0114129_10004572 3300009147 Bacteria 19515
74 Ga0114129_10071541 3300009147 Bacteria 4836
75 Ga0114129_10091121 3300009147 Bacteria 4225
76 Ga0105243_10833115 3300009148 Unclassified 912
77 Ga0105242_11084438 3300009176 Unclassified 814
78 Ga0105242_11443190 3300009176 Unclassified 717
79 Ga0105248_10042713 3300009177 Bacteria 5084
80 Ga0105248_10078029 3300009177 Bacteria 3724
81 Ga0105248_10099995 3300009177 Bacteria 3267
82 Ga0105238_11445198 3300009551 Unclassified 715
83 Ga0157378_10002294 3300013297 Bacteria 17000
84 Ga0157375_10839858 3300013308 Unclassified 1066
85 Ga0157375_11231299 3300013308 Unclassified 879
86 Ga0163163_10354528 3300014325 Bacteria 1523
87 Ga0157380_10342291 3300014326 Bacteria 1395
88 Ga0157376_10101654 3300014969 Bacteria 2513
89 Ga0157376_10149583 3300014969 Unclassified 2104
90 Ga0157376_10347331 3300014969 Unclassified 1419
91 Ga0213876_10210333 3300021384 Unclassified 1034
92 Ga0207685_10052324 3300025905 Bacteria 1582
93 Ga0207685_10232455 3300025905 Bacteria 883
94 Ga0207699_10167858 3300025906 Bacteria 1466
95 Ga0207699_10251381 3300025906 Unclassified 1218
96 Ga0207693_10401008 3300025915 Unclassified 1072
97 Ga0207660_10292749 3300025917 Bacteria 1295
98 Ga0207652_10631796 3300025921 Bacteria 958
99 Ga0207646_10014929 3300025922 Bacteria 7354
100 Ga0207646_10077609 3300025922 Bacteria 2968
101 Ga0207646_10251839 3300025922 Unclassified 1596
102 Ga0207681_10755189 3300025923 Unclassified 811
103 Ga0207700_10078047 3300025928 Bacteria 2574
104 Ga0207700_10311545 3300025928 Bacteria 1362
105 Ga0207665_11075212 3300025939 Bacteria 641
106 Ga0207711_10051538 3300025941 Bacteria 3525
107 Ga0207711_10516621 3300025941 Bacteria 1113
108 Ga0207661_10316963 3300025944 Unclassified 1401
109 Ga0207661_10371644 3300025944 Unclassified 1293
110 Ga0207679_10138596 3300025945 Bacteria 1963
111 Ga0207679_11158076 3300025945 Unclassified 710
112 Ga0207640_10255607 3300025981 Unclassified 1362
113 Ga0207677_10985772 3300026023 Unclassified 763
114 Ga0207703_10944900 3300026035 Unclassified 826
115 Ga0265318_10125647 3300028577 Archaea 943
116 Ga0265330_10220634 3300031235 Unclassified 800
117 Ga0265332_10017475 3300031238 Unclassified 3166
118 Ga0265329_10095751 3300031242 Unclassified 943
119 Ga0265331_10070504 3300031250 Bacteria 1636
120 Ga0265313_10013440 3300031595 Bacteria 4913
121 Ga0265314_10069376 3300031711 Unclassified 2366
122 Ga0265314_10376309 3300031711 Unclassified 774
123 Ga0265342_10313994 3300031712 Unclassified 823
124 Ga0373948_0184974 3300034817 Unclassified 537
125 Ga0373934_0469776 3300035086 Unclassified 528
126 Ga0373923_0058094 3300035111 Bacteria 1637
127 Ga0373936_0020800 3300035113 Bacteria 2551
128 Ga0373945_0048676 3300035116 Bacteria 1554
129 Ga0373956_0063531 3300035119 Bacteria 1675
130 Ga0373956_0064833 3300035119 Unclassified 1659
131 Ga0373960_0005430 3300035121 Bacteria 2954
132 Ga0373960_0371377 3300035121 Unclassified 546
133 Ga0373943_0002591 3300035170 Bacteria 8219
134 Ga0373943_0440082 3300035170 Bacteria 756
135 Ga0373946_0253386 3300035171 Unclassified 859
136 Ga0373955_0051972 3300035172 Bacteria 2234
137 Ga0373955_0181262 3300035172 Bacteria 1250
138 Ga0373962_0184373 3300035242 Bacteria 699
139 Ga0373935_0029176 3300035692 Bacteria 3414
140 Ga0373935_0437289 3300035692 Bacteria 943
141 Ga0373927_0626339 3300035695 Unclassified 711
142 Ga0373947_0088717 3300035725 Bacteria 1925
143 Ga0373947_0206857 3300035725 Unclassified 1286
144 Ga0373937_0411652 3300036401 Bacteria 1283
145 Ga0373937_0509598 3300036401 Bacteria 1143
146 Ga0373937_0850676 3300036401 Unclassified 861
147 Ga0373925_0052463 3300037068 Bacteria 3047
148 Ga0373925_0281051 3300037068 Unclassified 1341
149 Ga0436364_0780652 3300037853 Unclassified 591
150 Ga0436365_1741188 3300039437 Bacteria 2593
151 Ga0436360_0147509 3300039438 Unclassified 823
152 Ga0495580_0034652 3300046472 Bacteria 3633
153 Ga0495580_0047431 3300046472 Bacteria 3045
154 Ga0495580_0057559 3300046472 Unclassified 2736
155 Ga0495580_0576278 3300046472 Bacteria 745
156 Ga0495582_0065598 3300046473 Unclassified 2006
157 Ga0495582_0260406 3300046473 Bacteria 995
158 Ga0495639_0329592 3300046475 Unclassified 764
159 Ga0495664_0469756 3300046477 Bacteria 752
160 Ga0495608_0002111 3300046511 Bacteria 14317
161 Ga0495628_0145848 3300046516 Bacteria 1804
162 Ga0495630_0077226 3300046517 Bacteria 2510
163 Ga0495586_0133214 3300046535 Bacteria 1392
164 Ga0495587_0057822 3300046536 Bacteria 2279
165 Ga0495645_0244508 3300046543 Bacteria 1195
166 Ga0495667_0019922 3300046559 Bacteria 4526
167 Ga0495634_0050690 3300046642 Unclassified 2786
168 Ga0495635_0067561 3300046663 Bacteria 2452
169 Ga0495588_0116405 3300046674 Archaea 1409
170 Ga0495657_0264717 3300046675 Bacteria 1032
171 Ga0495623_0416783 3300046679 Bacteria 720
172 Ga0495647_0028248 3300046681 Unclassified 2067
173 Ga0495647_0115353 3300046681 Bacteria 1125
174 Ga0495658_0029559 3300046683 Unclassified 2969
175 Ga0495658_0036529 3300046683 Bacteria 2711
176 Ga0495669_0379284 3300046684 Unclassified 684
177 Ga0495613_0012611 3300046689 Bacteria 6282
178 Ga0495624_0629760 3300046690 Unclassified 639
179 Ga0495600_0136470 3300046809 Bacteria 1593
180 Ga0495581_0103663 3300047315 Bacteria 1653
181 Ga0495581_0172867 3300047315 Unclassified 1264
182 Ga0495581_0622857 3300047315 Unclassified 624
183 Ga0495604_0205935 3300047317 Bacteria 1361
184 Ga0495674_0017078 3300047319 Bacteria 6760
185 Ga0495674_0071466 3300047319 Bacteria 2995
186 Ga0495676_0875586 3300047321 Bacteria 576
187 Ga0495684_0001723 3300047471 Bacteria 17602
188 Ga0495684_0564575 3300047471 Bacteria 773
189 Ga0495684_0660882 3300047471 Unclassified 698
190 Ga0496100_0018582 3300048903 Unclassified 4126
191 Ga0496101_0007014 3300048904 Bacteria 7279
192 Ga0496104_0001207 3300048907 Bacteria 22238
193 Ga0496105_0473805 3300048908 Bacteria 986
194 Ga0496107_0032785 3300048910 Bacteria 3714
195 Ga0496114_0000574 3300048917 Bacteria 27183
196 Ga0496114_0477856 3300048917 Bacteria 1103
197 nmdc:mga05p37_170688_c1 3300050507 Bacteria 2652
198 nmdc:mga05p37_194837_c1 3300050507 Bacteria 2457
199 nmdc:mga05p37_30976_c1 3300050507 Bacteria 6532
200 nmdc:mga0n895_382598_c1 3300050512 Unclassified 1424
201 nmdc:mga0n895_64687_c1 3300050512 Bacteria 3618
202 nmdc:mga0n895_717019_c1 3300050512 Unclassified 995
203 nmdc:mga0n895_749592_c1 3300050512 Unclassified 970
204 nmdc:mga0rr50_53208_c1 3300050513 Bacteria 3011
205 nmdc:mga0a205_204027_c1 3300050515 Bacteria 1867
206 nmdc:mga0a205_484314_c1 3300050515 Unclassified 1095
207 nmdc:mga0a205_688075_c1 3300050515 Unclassified 873
208 nmdc:mga0a205_825196_c1 3300050515 Bacteria 775
209 Ga0495601_0123876 3300053077 Bacteria 1680
210 Ga0495612_0516239 3300053078 Bacteria 549
211 Ga0495595_0330246 3300053084 Bacteria 768
212 Ga0495619_0011708 3300053085 Bacteria 5526
213 Ga0495619_0092479 3300053085 Bacteria 2049
214 Ga0495619_0384986 3300053085 Bacteria 969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0780652 Ga0436364_0780652_52_528 142
2 3300035695 Ga0373927_0626339 Ga0373927_0626339_16_462 148
3 3300035086 Ga0373934_0469776 Ga0373934_0469776_11_460 149
4 3300035121 Ga0373960_0005430 Ga0373960_0005430_1982_2446 151
5 3300005937 Ga0081455_10079150 Ga0081455_100791504 155
6 3300005434 Ga0070709_10027476 Ga0070709_100274762 156
7 3300005436 Ga0070713_100129452 Ga0070713_1001294522 156
8 3300006028 Ga0070717_10140940 Ga0070717_101409402 156
9 3300006163 Ga0070715_10095917 Ga0070715_100959172 156
10 3300014969 Ga0157376_10149583 Ga0157376_101495832 156
11 3300025905 Ga0207685_10232455 Ga0207685_102324552 156
12 3300025906 Ga0207699_10167858 Ga0207699_101678582 156
13 3300025915 Ga0207693_10401008 Ga0207693_104010082 156
14 3300025928 Ga0207700_10311545 Ga0207700_103115452 156
15 3300039438 Ga0436360_0147509 Ga0436360_0147509_321_800 156
16 3300005617 Ga0068859_101652480 Ga0068859_1016524801 157
17 3300006931 Ga0097620_101652505 Ga0097620_1016525051 157
18 3300025906 Ga0207699_10251381 Ga0207699_102513812 157
19 3300009101 Ga0105247_10143612 Ga0105247_101436122 158
20 3300009147 Ga0114129_10071541 Ga0114129_100715413 158
21 3300025941 Ga0207711_10516621 Ga0207711_105166212 158
22 3300035116 Ga0373945_0048676 Ga0373945_0048676_854_1336 158
23 3300035119 Ga0373956_0063531 Ga0373956_0063531_367_849 158
24 3300035170 Ga0373943_0440082 Ga0373943_0440082_75_557 158
25 3300035692 Ga0373935_0437289 Ga0373935_0437289_18_554 158
26 3300036401 Ga0373937_0509598 Ga0373937_0509598_405_887 158
27 3300046472 Ga0495580_0047431 Ga0495580_0047431_2547_3029 158
28 3300046473 Ga0495582_0260406 Ga0495582_0260406_258_740 158
29 3300046477 Ga0495664_0469756 Ga0495664_0469756_153_635 158
30 3300046511 Ga0495608_0002111 Ga0495608_0002111_2861_3343 158
31 3300046516 Ga0495628_0145848 Ga0495628_0145848_713_1195 158
32 3300046517 Ga0495630_0077226 Ga0495630_0077226_1850_2332 158
33 3300046535 Ga0495586_0133214 Ga0495586_0133214_211_693 158
34 3300046536 Ga0495587_0057822 Ga0495587_0057822_1490_1972 158
35 3300046543 Ga0495645_0244508 Ga0495645_0244508_14_496 158
36 3300046559 Ga0495667_0019922 Ga0495667_0019922_2518_3000 158
37 3300046663 Ga0495635_0067561 Ga0495635_0067561_244_726 158
38 3300046675 Ga0495657_0264717 Ga0495657_0264717_267_749 158
39 3300046679 Ga0495623_0416783 Ga0495623_0416783_138_620 158
40 3300046681 Ga0495647_0115353 Ga0495647_0115353_141_623 158
41 3300046683 Ga0495658_0029559 Ga0495658_0029559_1878_2360 158
42 3300046689 Ga0495613_0012611 Ga0495613_0012611_2742_3224 158
43 3300046690 Ga0495624_0629760 Ga0495624_0629760_20_556 158
44 3300046809 Ga0495600_0136470 Ga0495600_0136470_906_1388 158
45 3300047315 Ga0495581_0103663 Ga0495581_0103663_83_565 158
46 3300047317 Ga0495604_0205935 Ga0495604_0205935_63_545 158
47 3300047319 Ga0495674_0017078 Ga0495674_0017078_4475_4957 158
48 3300047471 Ga0495684_0001723 Ga0495684_0001723_14181_14663 158
49 3300050507 nmdc:mga05p37_194837_c1 nmdc:mga05p37_194837_c1_1206_1691 158
50 3300053077 Ga0495601_0123876 Ga0495601_0123876_454_936 158
51 3300053084 Ga0495595_0330246 Ga0495595_0330246_156_638 158
52 3300053085 Ga0495619_0011708 Ga0495619_0011708_4898_5380 158
53 3300005330 Ga0070690_100859262 Ga0070690_1008592622 159
54 3300005345 Ga0070692_10421137 Ga0070692_104211371 159
55 3300005544 Ga0070686_100070092 Ga0070686_1000700924 159
56 3300005353 Ga0070669_100281671 Ga0070669_1002816712 160
57 3300005364 Ga0070673_101253912 Ga0070673_1012539121 160
58 3300005544 Ga0070686_101004347 Ga0070686_1010043471 160
59 3300005564 Ga0070664_101460988 Ga0070664_1014609881 160
60 3300006175 Ga0070712_100630456 Ga0070712_1006304562 160
61 3300006844 Ga0075428_100999990 Ga0075428_1009999902 160
62 3300006871 Ga0075434_100948259 Ga0075434_1009482591 160
63 3300009094 Ga0111539_10313773 Ga0111539_103137732 160
64 3300009176 Ga0105242_11084438 Ga0105242_110844381 160
65 3300014325 Ga0163163_10354528 Ga0163163_103545281 160
66 3300025945 Ga0207679_11158076 Ga0207679_111580761 160
67 3300035111 Ga0373923_0058094 Ga0373923_0058094_934_1425 160
68 3300035113 Ga0373936_0020800 Ga0373936_0020800_1516_2007 160
69 3300035170 Ga0373943_0002591 Ga0373943_0002591_889_1380 160
70 3300035172 Ga0373955_0051972 Ga0373955_0051972_1590_2081 160
71 3300035692 Ga0373935_0029176 Ga0373935_0029176_881_1372 160
72 3300035725 Ga0373947_0088717 Ga0373947_0088717_975_1466 160
73 3300046472 Ga0495580_0576278 Ga0495580_0576278_23_514 160
74 3300048917 Ga0496114_0477856 Ga0496114_0477856_43_534 160
75 3300053078 Ga0495612_0516239 Ga0495612_0516239_44_535 160
76 3300053085 Ga0495619_0384986 Ga0495619_0384986_335_826 160
77 3300005329 Ga0070683_100065242 Ga0070683_1000652422 161
78 3300005336 Ga0070680_100532624 Ga0070680_1005326241 161
79 3300005436 Ga0070713_100381758 Ga0070713_1003817582 161
80 3300005458 Ga0070681_10365520 Ga0070681_103655202 161
81 3300005530 Ga0070679_100226803 Ga0070679_1002268033 161
82 3300005535 Ga0070684_100105628 Ga0070684_1001056283 161
83 3300005547 Ga0070693_100483778 Ga0070693_1004837781 161
84 3300005718 Ga0068866_10296246 Ga0068866_102962462 161
85 3300006163 Ga0070715_10147768 Ga0070715_101477682 161
86 3300006237 Ga0097621_100006560 Ga0097621_1000065602 161
87 3300006237 Ga0097621_100011720 Ga0097621_1000117204 161
88 3300006237 Ga0097621_100016220 Ga0097621_1000162203 161
89 3300006358 Ga0068871_100043231 Ga0068871_1000432312 161
90 3300006358 Ga0068871_100387392 Ga0068871_1003873922 161
91 3300006358 Ga0068871_100514733 Ga0068871_1005147332 161
92 3300006871 Ga0075434_100274227 Ga0075434_1002742272 161
93 3300007076 Ga0075435_100135034 Ga0075435_1001350342 161
94 3300009098 Ga0105245_10643437 Ga0105245_106434371 161
95 3300013297 Ga0157378_10002294 Ga0157378_100022945 161
96 3300014969 Ga0157376_10101654 Ga0157376_101016542 161
97 3300014969 Ga0157376_10347331 Ga0157376_103473311 161
98 3300021384 Ga0213876_10210333 Ga0213876_102103332 161
99 3300025905 Ga0207685_10052324 Ga0207685_100523242 161
100 3300025917 Ga0207660_10292749 Ga0207660_102927492 161
101 3300025921 Ga0207652_10631796 Ga0207652_106317962 161
102 3300025939 Ga0207665_11075212 Ga0207665_110752121 161
103 3300025944 Ga0207661_10316963 Ga0207661_103169632 161
104 3300025944 Ga0207661_10371644 Ga0207661_103716442 161
105 3300026023 Ga0207677_10985772 Ga0207677_109857721 161
106 3300028577 Ga0265318_10125647 Ga0265318_101256472 161
107 3300031238 Ga0265332_10017475 Ga0265332_100174752 161
108 3300031711 Ga0265314_10069376 Ga0265314_100693762 161
109 3300034817 Ga0373948_0184974 Ga0373948_0184974_34_525 161
110 3300035119 Ga0373956_0064833 Ga0373956_0064833_1107_1601 161
111 3300035121 Ga0373960_0371377 Ga0373960_0371377_30_524 161
112 3300035171 Ga0373946_0253386 Ga0373946_0253386_295_813 161
113 3300035172 Ga0373955_0181262 Ga0373955_0181262_510_1004 161
114 3300035242 Ga0373962_0184373 Ga0373962_0184373_182_673 161
115 3300035725 Ga0373947_0206857 Ga0373947_0206857_507_1025 161
116 3300036401 Ga0373937_0411652 Ga0373937_0411652_181_672 161
117 3300037068 Ga0373925_0281051 Ga0373925_0281051_236_754 161
118 3300039437 Ga0436365_1741188 Ga0436365_1741188_345_836 161
119 3300046472 Ga0495580_0057559 Ga0495580_0057559_847_1341 161
120 3300046475 Ga0495639_0329592 Ga0495639_0329592_29_523 161
121 3300046674 Ga0495588_0116405 Ga0495588_0116405_184_678 161
122 3300046681 Ga0495647_0028248 Ga0495647_0028248_816_1334 161
123 3300046683 Ga0495658_0036529 Ga0495658_0036529_922_1416 161
124 3300046684 Ga0495669_0379284 Ga0495669_0379284_16_507 161
125 3300047315 Ga0495581_0172867 Ga0495581_0172867_300_818 161
126 3300047315 Ga0495581_0622857 Ga0495581_0622857_90_584 161
127 3300047319 Ga0495674_0071466 Ga0495674_0071466_160_678 161
128 3300047321 Ga0495676_0875586 Ga0495676_0875586_42_560 161
129 3300048903 Ga0496100_0018582 Ga0496100_0018582_2518_3012 161
130 3300048904 Ga0496101_0007014 Ga0496101_0007014_5235_5729 161
131 3300048907 Ga0496104_0001207 Ga0496104_0001207_1626_2120 161
132 3300048910 Ga0496107_0032785 Ga0496107_0032785_2859_3353 161
133 3300048917 Ga0496114_0000574 Ga0496114_0000574_21643_22137 161
134 3300053085 Ga0495619_0092479 Ga0495619_0092479_1249_1743 161
135 3300005354 Ga0070675_100164181 Ga0070675_1001641812 162
136 3300005441 Ga0070700_100857244 Ga0070700_1008572441 162
137 3300005456 Ga0070678_101304651 Ga0070678_1013046511 162
138 3300005457 Ga0070662_100987565 Ga0070662_1009875651 162
139 3300005468 Ga0070707_100005708 Ga0070707_1000057084 162
140 3300005530 Ga0070679_100391950 Ga0070679_1003919502 162
141 3300005543 Ga0070672_100384335 Ga0070672_1003843352 162
142 3300006871 Ga0075434_100006627 Ga0075434_1000066277 162
143 3300006871 Ga0075434_100059840 Ga0075434_1000598405 162
144 3300007076 Ga0075435_100065011 Ga0075435_1000650113 162
145 3300009147 Ga0114129_10091121 Ga0114129_100911214 162
146 3300013308 Ga0157375_11231299 Ga0157375_112312992 162
147 3300014326 Ga0157380_10342291 Ga0157380_103422912 162
148 3300025922 Ga0207646_10014929 Ga0207646_100149294 162
149 3300025923 Ga0207681_10755189 Ga0207681_107551892 162
150 3300048908 Ga0496105_0473805 Ga0496105_0473805_14_511 162
151 3300050507 nmdc:mga05p37_170688_c1 nmdc:mga05p37_170688_c1_484_984 162
152 3300050512 nmdc:mga0n895_382598_c1 nmdc:mga0n895_382598_c1_537_1034 162
153 3300050512 nmdc:mga0n895_64687_c1 nmdc:mga0n895_64687_c1_1593_2093 162
154 3300050513 nmdc:mga0rr50_53208_c1 nmdc:mga0rr50_53208_c1_1494_1994 162
155 3300005335 Ga0070666_10231225 Ga0070666_102312252 163
156 3300005436 Ga0070713_100057718 Ga0070713_1000577181 163
157 3300006852 Ga0075433_10305907 Ga0075433_103059072 163
158 3300009176 Ga0105242_11443190 Ga0105242_114431902 163
159 3300009177 Ga0105248_10078029 Ga0105248_100780295 163
160 3300025928 Ga0207700_10078047 Ga0207700_100780472 163
161 3300025941 Ga0207711_10051538 Ga0207711_100515384 163
162 3300036401 Ga0373937_0850676 Ga0373937_0850676_255_761 163
163 3300037068 Ga0373925_0052463 Ga0373925_0052463_1870_2370 163
164 3300046472 Ga0495580_0034652 Ga0495580_0034652_1751_2251 163
165 3300047471 Ga0495684_0564575 Ga0495684_0564575_236_745 163
166 3300047471 Ga0495684_0660882 Ga0495684_0660882_136_636 163
167 3300050512 nmdc:mga0n895_717019_c1 nmdc:mga0n895_717019_c1_130_630 163
168 3300050515 nmdc:mga0a205_484314_c1 nmdc:mga0a205_484314_c1_213_713 163
169 3300005293 Ga0065715_10134480 Ga0065715_101344803 164
170 3300005334 Ga0068869_100480260 Ga0068869_1004802602 164
171 3300005335 Ga0070666_10702089 Ga0070666_107020891 164
172 3300005345 Ga0070692_10375943 Ga0070692_103759431 164
173 3300005444 Ga0070694_100000711 Ga0070694_1000007116 164
174 3300005468 Ga0070707_100064348 Ga0070707_1000643482 164
175 3300005468 Ga0070707_100143060 Ga0070707_1001430602 164
176 3300005471 Ga0070698_100520362 Ga0070698_1005203621 164
177 3300005518 Ga0070699_100145909 Ga0070699_1001459092 164
178 3300005545 Ga0070695_100044174 Ga0070695_1000441744 164
179 3300005546 Ga0070696_100360574 Ga0070696_1003605742 164
180 3300005548 Ga0070665_100838228 Ga0070665_1008382281 164
181 3300005549 Ga0070704_100409327 Ga0070704_1004093271 164
182 3300005564 Ga0070664_100282056 Ga0070664_1002820562 164
183 3300005578 Ga0068854_100026281 Ga0068854_1000262814 164
184 3300005615 Ga0070702_100435513 Ga0070702_1004355132 164
185 3300005617 Ga0068859_100504565 Ga0068859_1005045652 164
186 3300005842 Ga0068858_100073383 Ga0068858_1000733834 164
187 3300006881 Ga0068865_101527357 Ga0068865_1015273571 164
188 3300006931 Ga0097620_100504552 Ga0097620_1005045522 164
189 3300007076 Ga0075435_100027217 Ga0075435_1000272174 164
190 3300007265 Ga0099794_10390835 Ga0099794_103908351 164
191 3300009147 Ga0114129_10004572 Ga0114129_100045721 164
192 3300009148 Ga0105243_10833115 Ga0105243_108331152 164
193 3300009177 Ga0105248_10042713 Ga0105248_100427134 164
194 3300009177 Ga0105248_10099995 Ga0105248_100999952 164
195 3300009551 Ga0105238_11445198 Ga0105238_114451981 164
196 3300013308 Ga0157375_10839858 Ga0157375_108398582 164
197 3300025922 Ga0207646_10077609 Ga0207646_100776092 164
198 3300025922 Ga0207646_10251839 Ga0207646_102518392 164
199 3300025945 Ga0207679_10138596 Ga0207679_101385963 164
200 3300025981 Ga0207640_10255607 Ga0207640_102556072 164
201 3300026035 Ga0207703_10944900 Ga0207703_109449001 164
202 3300031235 Ga0265330_10220634 Ga0265330_102206341 164
203 3300031242 Ga0265329_10095751 Ga0265329_100957511 164
204 3300031250 Ga0265331_10070504 Ga0265331_100705042 164
205 3300031595 Ga0265313_10013440 Ga0265313_100134404 164
206 3300031711 Ga0265314_10376309 Ga0265314_103763091 164
207 3300031712 Ga0265342_10313994 Ga0265342_103139942 164
208 3300046473 Ga0495582_0065598 Ga0495582_0065598_541_1053 164
209 3300046642 Ga0495634_0050690 Ga0495634_0050690_765_1304 164
210 3300050507 nmdc:mga05p37_30976_c1 nmdc:mga05p37_30976_c1_2181_2699 164
211 3300050512 nmdc:mga0n895_749592_c1 nmdc:mga0n895_749592_c1_122_640 164
212 3300050515 nmdc:mga0a205_204027_c1 nmdc:mga0a205_204027_c1_1101_1616 164
213 3300050515 nmdc:mga0a205_688075_c1 nmdc:mga0a205_688075_c1_243_770 164
214 3300050515 nmdc:mga0a205_825196_c1 nmdc:mga0a205_825196_c1_95_613 164

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y5e-assembly1.cif.gz_QL in situ single-pbs-psii-psi-lhcs megacomplex. 0.6589 25 144
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.5569 1 148
1ow8-assembly1.cif.gz_A paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase 0.5455 24 151
4o79-assembly1.cif.gz_A crystal structure of ascorbate-bound cytochrome b561, crystal soaked in 1 m l-ascorbate for 10 minutes 0.5443 2 149
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.5409 5 151
ID Description Score Start End Superfamily
af_Q6Z1Y9_14_236_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6365 29 147 1.20.120.1770
af_Q7JR72_54_280_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6167 29 160 1.20.120.1770
af_Q4CZM6_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6034 20 151 1.20.120.350
af_G5EGK1_1078_1232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6017 2 144 1.20.1420.10
af_P09483_251_364_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5965 87 149 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A2V8F546-F1-model_v4 DUF6644 domain-containing protein 0.9739 1 150 GO:0016020
AF-A0A2V8MA02-F1-model_v4 Uncharacterized protein 0.9605 35 156 GO:0016020
AF-A0A2V8DRR8-F1-model_v4 DUF2214 domain-containing protein 0.9598 2 157 GO:0016020
AF-A0A7V0Y4P0-F1-model_v4 Uncharacterized protein 0.9598 3 152 GO:0016020
AF-A0A2V8NNN7-F1-model_v4 DUF2214 domain-containing protein 0.959 2 157 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.42 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map