F325066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 214 | 145 | 214 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100630456|Ga0070712_1006304562 |
| Length | 181 |
| Sequence | MEPVAVQDRSSGRARKVAVEFLKALETSGFSVWVRESGSLWSFPGILLVHTYGMGIMVGVILAVDLSILGFVPALPLAPLQKFFPIVWTAFWLNAITGTILLAADATTKLTNPDFGVKMAFIVLAVINQRMIQKRLFGGSPSTSSTVAGAHGKTLAWMSIVCWLGAITAGRLLAYVGTAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 82 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 87 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 88 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 89 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 90 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 97 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 105 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.27 |
| Rhizosphere | 95.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10134480 | 3300005293 | Bacteria | 1954 |
| 2 | Ga0070683_100065242 | 3300005329 | Bacteria | 3390 |
| 3 | Ga0070690_100859262 | 3300005330 | Bacteria | 707 |
| 4 | Ga0068869_100480260 | 3300005334 | Unclassified | 1035 |
| 5 | Ga0070666_10231225 | 3300005335 | Bacteria | 1306 |
| 6 | Ga0070666_10702089 | 3300005335 | Unclassified | 742 |
| 7 | Ga0070680_100532624 | 3300005336 | Bacteria | 1006 |
| 8 | Ga0070692_10375943 | 3300005345 | Unclassified | 890 |
| 9 | Ga0070692_10421137 | 3300005345 | Bacteria | 848 |
| 10 | Ga0070669_100281671 | 3300005353 | Unclassified | 1332 |
| 11 | Ga0070675_100164181 | 3300005354 | Bacteria | 1912 |
| 12 | Ga0070673_101253912 | 3300005364 | Unclassified | 695 |
| 13 | Ga0070709_10027476 | 3300005434 | Unclassified | 3383 |
| 14 | Ga0070713_100057718 | 3300005436 | Bacteria | 3234 |
| 15 | Ga0070713_100129452 | 3300005436 | Unclassified | 2224 |
| 16 | Ga0070713_100381758 | 3300005436 | Unclassified | 1313 |
| 17 | Ga0070700_100857244 | 3300005441 | Unclassified | 736 |
| 18 | Ga0070694_100000711 | 3300005444 | Bacteria | 18524 |
| 19 | Ga0070678_101304651 | 3300005456 | Bacteria | 675 |
| 20 | Ga0070662_100987565 | 3300005457 | Unclassified | 720 |
| 21 | Ga0070681_10365520 | 3300005458 | Bacteria | 1353 |
| 22 | Ga0070707_100005708 | 3300005468 | Bacteria | 11608 |
| 23 | Ga0070707_100064348 | 3300005468 | Bacteria | 3521 |
| 24 | Ga0070707_100143060 | 3300005468 | Unclassified | 2328 |
| 25 | Ga0070698_100520362 | 3300005471 | Bacteria | 1128 |
| 26 | Ga0070699_100145909 | 3300005518 | Bacteria | 2091 |
| 27 | Ga0070679_100226803 | 3300005530 | Bacteria | 1828 |
| 28 | Ga0070679_100391950 | 3300005530 | Bacteria | 1335 |
| 29 | Ga0070684_100105628 | 3300005535 | Bacteria | 2520 |
| 30 | Ga0070672_100384335 | 3300005543 | Bacteria | 1201 |
| 31 | Ga0070686_100070092 | 3300005544 | Unclassified | 2292 |
| 32 | Ga0070686_101004347 | 3300005544 | Bacteria | 684 |
| 33 | Ga0070695_100044174 | 3300005545 | Bacteria | 2835 |
| 34 | Ga0070696_100360574 | 3300005546 | Bacteria | 1128 |
| 35 | Ga0070693_100483778 | 3300005547 | Bacteria | 875 |
| 36 | Ga0070665_100838228 | 3300005548 | Unclassified | 932 |
| 37 | Ga0070704_100409327 | 3300005549 | Unclassified | 1159 |
| 38 | Ga0070664_100282056 | 3300005564 | Bacteria | 1498 |
| 39 | Ga0070664_101460988 | 3300005564 | Bacteria | 647 |
| 40 | Ga0068854_100026281 | 3300005578 | Bacteria | 4000 |
| 41 | Ga0070702_100435513 | 3300005615 | Bacteria | 947 |
| 42 | Ga0068859_100504565 | 3300005617 | Bacteria | 1305 |
| 43 | Ga0068859_101652480 | 3300005617 | Bacteria | 707 |
| 44 | Ga0068866_10296246 | 3300005718 | Unclassified | 1008 |
| 45 | Ga0068858_100073383 | 3300005842 | Unclassified | 3176 |
| 46 | Ga0081455_10079150 | 3300005937 | Bacteria | 2699 |
| 47 | Ga0070717_10140940 | 3300006028 | Unclassified | 2079 |
| 48 | Ga0070715_10095917 | 3300006163 | Bacteria | 1374 |
| 49 | Ga0070715_10147768 | 3300006163 | Bacteria | 1148 |
| 50 | Ga0070712_100630456 | 3300006175 | Bacteria | 909 |
| 51 | Ga0097621_100006560 | 3300006237 | Bacteria | 8265 |
| 52 | Ga0097621_100011720 | 3300006237 | Bacteria | 6473 |
| 53 | Ga0097621_100016220 | 3300006237 | Bacteria | 5626 |
| 54 | Ga0068871_100043231 | 3300006358 | Unclassified | 3619 |
| 55 | Ga0068871_100387392 | 3300006358 | Bacteria | 1243 |
| 56 | Ga0068871_100514733 | 3300006358 | Unclassified | 1080 |
| 57 | Ga0075428_100999990 | 3300006844 | Unclassified | 885 |
| 58 | Ga0075433_10305907 | 3300006852 | Bacteria | 1407 |
| 59 | Ga0075434_100006627 | 3300006871 | Bacteria | 10625 |
| 60 | Ga0075434_100059840 | 3300006871 | Bacteria | 3788 |
| 61 | Ga0075434_100274227 | 3300006871 | Bacteria | 1706 |
| 62 | Ga0075434_100948259 | 3300006871 | Unclassified | 875 |
| 63 | Ga0068865_101527357 | 3300006881 | Bacteria | 599 |
| 64 | Ga0097620_100504552 | 3300006931 | Bacteria | 1305 |
| 65 | Ga0097620_101652505 | 3300006931 | Bacteria | 707 |
| 66 | Ga0075435_100027217 | 3300007076 | Bacteria | 4469 |
| 67 | Ga0075435_100065011 | 3300007076 | Bacteria | 2965 |
| 68 | Ga0075435_100135034 | 3300007076 | Bacteria | 2066 |
| 69 | Ga0099794_10390835 | 3300007265 | Unclassified | 726 |
| 70 | Ga0111539_10313773 | 3300009094 | Unclassified | 1825 |
| 71 | Ga0105245_10643437 | 3300009098 | Bacteria | 1090 |
| 72 | Ga0105247_10143612 | 3300009101 | Unclassified | 1566 |
| 73 | Ga0114129_10004572 | 3300009147 | Bacteria | 19515 |
| 74 | Ga0114129_10071541 | 3300009147 | Bacteria | 4836 |
| 75 | Ga0114129_10091121 | 3300009147 | Bacteria | 4225 |
| 76 | Ga0105243_10833115 | 3300009148 | Unclassified | 912 |
| 77 | Ga0105242_11084438 | 3300009176 | Unclassified | 814 |
| 78 | Ga0105242_11443190 | 3300009176 | Unclassified | 717 |
| 79 | Ga0105248_10042713 | 3300009177 | Bacteria | 5084 |
| 80 | Ga0105248_10078029 | 3300009177 | Bacteria | 3724 |
| 81 | Ga0105248_10099995 | 3300009177 | Bacteria | 3267 |
| 82 | Ga0105238_11445198 | 3300009551 | Unclassified | 715 |
| 83 | Ga0157378_10002294 | 3300013297 | Bacteria | 17000 |
| 84 | Ga0157375_10839858 | 3300013308 | Unclassified | 1066 |
| 85 | Ga0157375_11231299 | 3300013308 | Unclassified | 879 |
| 86 | Ga0163163_10354528 | 3300014325 | Bacteria | 1523 |
| 87 | Ga0157380_10342291 | 3300014326 | Bacteria | 1395 |
| 88 | Ga0157376_10101654 | 3300014969 | Bacteria | 2513 |
| 89 | Ga0157376_10149583 | 3300014969 | Unclassified | 2104 |
| 90 | Ga0157376_10347331 | 3300014969 | Unclassified | 1419 |
| 91 | Ga0213876_10210333 | 3300021384 | Unclassified | 1034 |
| 92 | Ga0207685_10052324 | 3300025905 | Bacteria | 1582 |
| 93 | Ga0207685_10232455 | 3300025905 | Bacteria | 883 |
| 94 | Ga0207699_10167858 | 3300025906 | Bacteria | 1466 |
| 95 | Ga0207699_10251381 | 3300025906 | Unclassified | 1218 |
| 96 | Ga0207693_10401008 | 3300025915 | Unclassified | 1072 |
| 97 | Ga0207660_10292749 | 3300025917 | Bacteria | 1295 |
| 98 | Ga0207652_10631796 | 3300025921 | Bacteria | 958 |
| 99 | Ga0207646_10014929 | 3300025922 | Bacteria | 7354 |
| 100 | Ga0207646_10077609 | 3300025922 | Bacteria | 2968 |
| 101 | Ga0207646_10251839 | 3300025922 | Unclassified | 1596 |
| 102 | Ga0207681_10755189 | 3300025923 | Unclassified | 811 |
| 103 | Ga0207700_10078047 | 3300025928 | Bacteria | 2574 |
| 104 | Ga0207700_10311545 | 3300025928 | Bacteria | 1362 |
| 105 | Ga0207665_11075212 | 3300025939 | Bacteria | 641 |
| 106 | Ga0207711_10051538 | 3300025941 | Bacteria | 3525 |
| 107 | Ga0207711_10516621 | 3300025941 | Bacteria | 1113 |
| 108 | Ga0207661_10316963 | 3300025944 | Unclassified | 1401 |
| 109 | Ga0207661_10371644 | 3300025944 | Unclassified | 1293 |
| 110 | Ga0207679_10138596 | 3300025945 | Bacteria | 1963 |
| 111 | Ga0207679_11158076 | 3300025945 | Unclassified | 710 |
| 112 | Ga0207640_10255607 | 3300025981 | Unclassified | 1362 |
| 113 | Ga0207677_10985772 | 3300026023 | Unclassified | 763 |
| 114 | Ga0207703_10944900 | 3300026035 | Unclassified | 826 |
| 115 | Ga0265318_10125647 | 3300028577 | Archaea | 943 |
| 116 | Ga0265330_10220634 | 3300031235 | Unclassified | 800 |
| 117 | Ga0265332_10017475 | 3300031238 | Unclassified | 3166 |
| 118 | Ga0265329_10095751 | 3300031242 | Unclassified | 943 |
| 119 | Ga0265331_10070504 | 3300031250 | Bacteria | 1636 |
| 120 | Ga0265313_10013440 | 3300031595 | Bacteria | 4913 |
| 121 | Ga0265314_10069376 | 3300031711 | Unclassified | 2366 |
| 122 | Ga0265314_10376309 | 3300031711 | Unclassified | 774 |
| 123 | Ga0265342_10313994 | 3300031712 | Unclassified | 823 |
| 124 | Ga0373948_0184974 | 3300034817 | Unclassified | 537 |
| 125 | Ga0373934_0469776 | 3300035086 | Unclassified | 528 |
| 126 | Ga0373923_0058094 | 3300035111 | Bacteria | 1637 |
| 127 | Ga0373936_0020800 | 3300035113 | Bacteria | 2551 |
| 128 | Ga0373945_0048676 | 3300035116 | Bacteria | 1554 |
| 129 | Ga0373956_0063531 | 3300035119 | Bacteria | 1675 |
| 130 | Ga0373956_0064833 | 3300035119 | Unclassified | 1659 |
| 131 | Ga0373960_0005430 | 3300035121 | Bacteria | 2954 |
| 132 | Ga0373960_0371377 | 3300035121 | Unclassified | 546 |
| 133 | Ga0373943_0002591 | 3300035170 | Bacteria | 8219 |
| 134 | Ga0373943_0440082 | 3300035170 | Bacteria | 756 |
| 135 | Ga0373946_0253386 | 3300035171 | Unclassified | 859 |
| 136 | Ga0373955_0051972 | 3300035172 | Bacteria | 2234 |
| 137 | Ga0373955_0181262 | 3300035172 | Bacteria | 1250 |
| 138 | Ga0373962_0184373 | 3300035242 | Bacteria | 699 |
| 139 | Ga0373935_0029176 | 3300035692 | Bacteria | 3414 |
| 140 | Ga0373935_0437289 | 3300035692 | Bacteria | 943 |
| 141 | Ga0373927_0626339 | 3300035695 | Unclassified | 711 |
| 142 | Ga0373947_0088717 | 3300035725 | Bacteria | 1925 |
| 143 | Ga0373947_0206857 | 3300035725 | Unclassified | 1286 |
| 144 | Ga0373937_0411652 | 3300036401 | Bacteria | 1283 |
| 145 | Ga0373937_0509598 | 3300036401 | Bacteria | 1143 |
| 146 | Ga0373937_0850676 | 3300036401 | Unclassified | 861 |
| 147 | Ga0373925_0052463 | 3300037068 | Bacteria | 3047 |
| 148 | Ga0373925_0281051 | 3300037068 | Unclassified | 1341 |
| 149 | Ga0436364_0780652 | 3300037853 | Unclassified | 591 |
| 150 | Ga0436365_1741188 | 3300039437 | Bacteria | 2593 |
| 151 | Ga0436360_0147509 | 3300039438 | Unclassified | 823 |
| 152 | Ga0495580_0034652 | 3300046472 | Bacteria | 3633 |
| 153 | Ga0495580_0047431 | 3300046472 | Bacteria | 3045 |
| 154 | Ga0495580_0057559 | 3300046472 | Unclassified | 2736 |
| 155 | Ga0495580_0576278 | 3300046472 | Bacteria | 745 |
| 156 | Ga0495582_0065598 | 3300046473 | Unclassified | 2006 |
| 157 | Ga0495582_0260406 | 3300046473 | Bacteria | 995 |
| 158 | Ga0495639_0329592 | 3300046475 | Unclassified | 764 |
| 159 | Ga0495664_0469756 | 3300046477 | Bacteria | 752 |
| 160 | Ga0495608_0002111 | 3300046511 | Bacteria | 14317 |
| 161 | Ga0495628_0145848 | 3300046516 | Bacteria | 1804 |
| 162 | Ga0495630_0077226 | 3300046517 | Bacteria | 2510 |
| 163 | Ga0495586_0133214 | 3300046535 | Bacteria | 1392 |
| 164 | Ga0495587_0057822 | 3300046536 | Bacteria | 2279 |
| 165 | Ga0495645_0244508 | 3300046543 | Bacteria | 1195 |
| 166 | Ga0495667_0019922 | 3300046559 | Bacteria | 4526 |
| 167 | Ga0495634_0050690 | 3300046642 | Unclassified | 2786 |
| 168 | Ga0495635_0067561 | 3300046663 | Bacteria | 2452 |
| 169 | Ga0495588_0116405 | 3300046674 | Archaea | 1409 |
| 170 | Ga0495657_0264717 | 3300046675 | Bacteria | 1032 |
| 171 | Ga0495623_0416783 | 3300046679 | Bacteria | 720 |
| 172 | Ga0495647_0028248 | 3300046681 | Unclassified | 2067 |
| 173 | Ga0495647_0115353 | 3300046681 | Bacteria | 1125 |
| 174 | Ga0495658_0029559 | 3300046683 | Unclassified | 2969 |
| 175 | Ga0495658_0036529 | 3300046683 | Bacteria | 2711 |
| 176 | Ga0495669_0379284 | 3300046684 | Unclassified | 684 |
| 177 | Ga0495613_0012611 | 3300046689 | Bacteria | 6282 |
| 178 | Ga0495624_0629760 | 3300046690 | Unclassified | 639 |
| 179 | Ga0495600_0136470 | 3300046809 | Bacteria | 1593 |
| 180 | Ga0495581_0103663 | 3300047315 | Bacteria | 1653 |
| 181 | Ga0495581_0172867 | 3300047315 | Unclassified | 1264 |
| 182 | Ga0495581_0622857 | 3300047315 | Unclassified | 624 |
| 183 | Ga0495604_0205935 | 3300047317 | Bacteria | 1361 |
| 184 | Ga0495674_0017078 | 3300047319 | Bacteria | 6760 |
| 185 | Ga0495674_0071466 | 3300047319 | Bacteria | 2995 |
| 186 | Ga0495676_0875586 | 3300047321 | Bacteria | 576 |
| 187 | Ga0495684_0001723 | 3300047471 | Bacteria | 17602 |
| 188 | Ga0495684_0564575 | 3300047471 | Bacteria | 773 |
| 189 | Ga0495684_0660882 | 3300047471 | Unclassified | 698 |
| 190 | Ga0496100_0018582 | 3300048903 | Unclassified | 4126 |
| 191 | Ga0496101_0007014 | 3300048904 | Bacteria | 7279 |
| 192 | Ga0496104_0001207 | 3300048907 | Bacteria | 22238 |
| 193 | Ga0496105_0473805 | 3300048908 | Bacteria | 986 |
| 194 | Ga0496107_0032785 | 3300048910 | Bacteria | 3714 |
| 195 | Ga0496114_0000574 | 3300048917 | Bacteria | 27183 |
| 196 | Ga0496114_0477856 | 3300048917 | Bacteria | 1103 |
| 197 | nmdc:mga05p37_170688_c1 | 3300050507 | Bacteria | 2652 |
| 198 | nmdc:mga05p37_194837_c1 | 3300050507 | Bacteria | 2457 |
| 199 | nmdc:mga05p37_30976_c1 | 3300050507 | Bacteria | 6532 |
| 200 | nmdc:mga0n895_382598_c1 | 3300050512 | Unclassified | 1424 |
| 201 | nmdc:mga0n895_64687_c1 | 3300050512 | Bacteria | 3618 |
| 202 | nmdc:mga0n895_717019_c1 | 3300050512 | Unclassified | 995 |
| 203 | nmdc:mga0n895_749592_c1 | 3300050512 | Unclassified | 970 |
| 204 | nmdc:mga0rr50_53208_c1 | 3300050513 | Bacteria | 3011 |
| 205 | nmdc:mga0a205_204027_c1 | 3300050515 | Bacteria | 1867 |
| 206 | nmdc:mga0a205_484314_c1 | 3300050515 | Unclassified | 1095 |
| 207 | nmdc:mga0a205_688075_c1 | 3300050515 | Unclassified | 873 |
| 208 | nmdc:mga0a205_825196_c1 | 3300050515 | Bacteria | 775 |
| 209 | Ga0495601_0123876 | 3300053077 | Bacteria | 1680 |
| 210 | Ga0495612_0516239 | 3300053078 | Bacteria | 549 |
| 211 | Ga0495595_0330246 | 3300053084 | Bacteria | 768 |
| 212 | Ga0495619_0011708 | 3300053085 | Bacteria | 5526 |
| 213 | Ga0495619_0092479 | 3300053085 | Bacteria | 2049 |
| 214 | Ga0495619_0384986 | 3300053085 | Bacteria | 969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0780652 | Ga0436364_0780652_52_528 | 142 |
| 2 | 3300035695 | Ga0373927_0626339 | Ga0373927_0626339_16_462 | 148 |
| 3 | 3300035086 | Ga0373934_0469776 | Ga0373934_0469776_11_460 | 149 |
| 4 | 3300035121 | Ga0373960_0005430 | Ga0373960_0005430_1982_2446 | 151 |
| 5 | 3300005937 | Ga0081455_10079150 | Ga0081455_100791504 | 155 |
| 6 | 3300005434 | Ga0070709_10027476 | Ga0070709_100274762 | 156 |
| 7 | 3300005436 | Ga0070713_100129452 | Ga0070713_1001294522 | 156 |
| 8 | 3300006028 | Ga0070717_10140940 | Ga0070717_101409402 | 156 |
| 9 | 3300006163 | Ga0070715_10095917 | Ga0070715_100959172 | 156 |
| 10 | 3300014969 | Ga0157376_10149583 | Ga0157376_101495832 | 156 |
| 11 | 3300025905 | Ga0207685_10232455 | Ga0207685_102324552 | 156 |
| 12 | 3300025906 | Ga0207699_10167858 | Ga0207699_101678582 | 156 |
| 13 | 3300025915 | Ga0207693_10401008 | Ga0207693_104010082 | 156 |
| 14 | 3300025928 | Ga0207700_10311545 | Ga0207700_103115452 | 156 |
| 15 | 3300039438 | Ga0436360_0147509 | Ga0436360_0147509_321_800 | 156 |
| 16 | 3300005617 | Ga0068859_101652480 | Ga0068859_1016524801 | 157 |
| 17 | 3300006931 | Ga0097620_101652505 | Ga0097620_1016525051 | 157 |
| 18 | 3300025906 | Ga0207699_10251381 | Ga0207699_102513812 | 157 |
| 19 | 3300009101 | Ga0105247_10143612 | Ga0105247_101436122 | 158 |
| 20 | 3300009147 | Ga0114129_10071541 | Ga0114129_100715413 | 158 |
| 21 | 3300025941 | Ga0207711_10516621 | Ga0207711_105166212 | 158 |
| 22 | 3300035116 | Ga0373945_0048676 | Ga0373945_0048676_854_1336 | 158 |
| 23 | 3300035119 | Ga0373956_0063531 | Ga0373956_0063531_367_849 | 158 |
| 24 | 3300035170 | Ga0373943_0440082 | Ga0373943_0440082_75_557 | 158 |
| 25 | 3300035692 | Ga0373935_0437289 | Ga0373935_0437289_18_554 | 158 |
| 26 | 3300036401 | Ga0373937_0509598 | Ga0373937_0509598_405_887 | 158 |
| 27 | 3300046472 | Ga0495580_0047431 | Ga0495580_0047431_2547_3029 | 158 |
| 28 | 3300046473 | Ga0495582_0260406 | Ga0495582_0260406_258_740 | 158 |
| 29 | 3300046477 | Ga0495664_0469756 | Ga0495664_0469756_153_635 | 158 |
| 30 | 3300046511 | Ga0495608_0002111 | Ga0495608_0002111_2861_3343 | 158 |
| 31 | 3300046516 | Ga0495628_0145848 | Ga0495628_0145848_713_1195 | 158 |
| 32 | 3300046517 | Ga0495630_0077226 | Ga0495630_0077226_1850_2332 | 158 |
| 33 | 3300046535 | Ga0495586_0133214 | Ga0495586_0133214_211_693 | 158 |
| 34 | 3300046536 | Ga0495587_0057822 | Ga0495587_0057822_1490_1972 | 158 |
| 35 | 3300046543 | Ga0495645_0244508 | Ga0495645_0244508_14_496 | 158 |
| 36 | 3300046559 | Ga0495667_0019922 | Ga0495667_0019922_2518_3000 | 158 |
| 37 | 3300046663 | Ga0495635_0067561 | Ga0495635_0067561_244_726 | 158 |
| 38 | 3300046675 | Ga0495657_0264717 | Ga0495657_0264717_267_749 | 158 |
| 39 | 3300046679 | Ga0495623_0416783 | Ga0495623_0416783_138_620 | 158 |
| 40 | 3300046681 | Ga0495647_0115353 | Ga0495647_0115353_141_623 | 158 |
| 41 | 3300046683 | Ga0495658_0029559 | Ga0495658_0029559_1878_2360 | 158 |
| 42 | 3300046689 | Ga0495613_0012611 | Ga0495613_0012611_2742_3224 | 158 |
| 43 | 3300046690 | Ga0495624_0629760 | Ga0495624_0629760_20_556 | 158 |
| 44 | 3300046809 | Ga0495600_0136470 | Ga0495600_0136470_906_1388 | 158 |
| 45 | 3300047315 | Ga0495581_0103663 | Ga0495581_0103663_83_565 | 158 |
| 46 | 3300047317 | Ga0495604_0205935 | Ga0495604_0205935_63_545 | 158 |
| 47 | 3300047319 | Ga0495674_0017078 | Ga0495674_0017078_4475_4957 | 158 |
| 48 | 3300047471 | Ga0495684_0001723 | Ga0495684_0001723_14181_14663 | 158 |
| 49 | 3300050507 | nmdc:mga05p37_194837_c1 | nmdc:mga05p37_194837_c1_1206_1691 | 158 |
| 50 | 3300053077 | Ga0495601_0123876 | Ga0495601_0123876_454_936 | 158 |
| 51 | 3300053084 | Ga0495595_0330246 | Ga0495595_0330246_156_638 | 158 |
| 52 | 3300053085 | Ga0495619_0011708 | Ga0495619_0011708_4898_5380 | 158 |
| 53 | 3300005330 | Ga0070690_100859262 | Ga0070690_1008592622 | 159 |
| 54 | 3300005345 | Ga0070692_10421137 | Ga0070692_104211371 | 159 |
| 55 | 3300005544 | Ga0070686_100070092 | Ga0070686_1000700924 | 159 |
| 56 | 3300005353 | Ga0070669_100281671 | Ga0070669_1002816712 | 160 |
| 57 | 3300005364 | Ga0070673_101253912 | Ga0070673_1012539121 | 160 |
| 58 | 3300005544 | Ga0070686_101004347 | Ga0070686_1010043471 | 160 |
| 59 | 3300005564 | Ga0070664_101460988 | Ga0070664_1014609881 | 160 |
| 60 | 3300006175 | Ga0070712_100630456 | Ga0070712_1006304562 | 160 |
| 61 | 3300006844 | Ga0075428_100999990 | Ga0075428_1009999902 | 160 |
| 62 | 3300006871 | Ga0075434_100948259 | Ga0075434_1009482591 | 160 |
| 63 | 3300009094 | Ga0111539_10313773 | Ga0111539_103137732 | 160 |
| 64 | 3300009176 | Ga0105242_11084438 | Ga0105242_110844381 | 160 |
| 65 | 3300014325 | Ga0163163_10354528 | Ga0163163_103545281 | 160 |
| 66 | 3300025945 | Ga0207679_11158076 | Ga0207679_111580761 | 160 |
| 67 | 3300035111 | Ga0373923_0058094 | Ga0373923_0058094_934_1425 | 160 |
| 68 | 3300035113 | Ga0373936_0020800 | Ga0373936_0020800_1516_2007 | 160 |
| 69 | 3300035170 | Ga0373943_0002591 | Ga0373943_0002591_889_1380 | 160 |
| 70 | 3300035172 | Ga0373955_0051972 | Ga0373955_0051972_1590_2081 | 160 |
| 71 | 3300035692 | Ga0373935_0029176 | Ga0373935_0029176_881_1372 | 160 |
| 72 | 3300035725 | Ga0373947_0088717 | Ga0373947_0088717_975_1466 | 160 |
| 73 | 3300046472 | Ga0495580_0576278 | Ga0495580_0576278_23_514 | 160 |
| 74 | 3300048917 | Ga0496114_0477856 | Ga0496114_0477856_43_534 | 160 |
| 75 | 3300053078 | Ga0495612_0516239 | Ga0495612_0516239_44_535 | 160 |
| 76 | 3300053085 | Ga0495619_0384986 | Ga0495619_0384986_335_826 | 160 |
| 77 | 3300005329 | Ga0070683_100065242 | Ga0070683_1000652422 | 161 |
| 78 | 3300005336 | Ga0070680_100532624 | Ga0070680_1005326241 | 161 |
| 79 | 3300005436 | Ga0070713_100381758 | Ga0070713_1003817582 | 161 |
| 80 | 3300005458 | Ga0070681_10365520 | Ga0070681_103655202 | 161 |
| 81 | 3300005530 | Ga0070679_100226803 | Ga0070679_1002268033 | 161 |
| 82 | 3300005535 | Ga0070684_100105628 | Ga0070684_1001056283 | 161 |
| 83 | 3300005547 | Ga0070693_100483778 | Ga0070693_1004837781 | 161 |
| 84 | 3300005718 | Ga0068866_10296246 | Ga0068866_102962462 | 161 |
| 85 | 3300006163 | Ga0070715_10147768 | Ga0070715_101477682 | 161 |
| 86 | 3300006237 | Ga0097621_100006560 | Ga0097621_1000065602 | 161 |
| 87 | 3300006237 | Ga0097621_100011720 | Ga0097621_1000117204 | 161 |
| 88 | 3300006237 | Ga0097621_100016220 | Ga0097621_1000162203 | 161 |
| 89 | 3300006358 | Ga0068871_100043231 | Ga0068871_1000432312 | 161 |
| 90 | 3300006358 | Ga0068871_100387392 | Ga0068871_1003873922 | 161 |
| 91 | 3300006358 | Ga0068871_100514733 | Ga0068871_1005147332 | 161 |
| 92 | 3300006871 | Ga0075434_100274227 | Ga0075434_1002742272 | 161 |
| 93 | 3300007076 | Ga0075435_100135034 | Ga0075435_1001350342 | 161 |
| 94 | 3300009098 | Ga0105245_10643437 | Ga0105245_106434371 | 161 |
| 95 | 3300013297 | Ga0157378_10002294 | Ga0157378_100022945 | 161 |
| 96 | 3300014969 | Ga0157376_10101654 | Ga0157376_101016542 | 161 |
| 97 | 3300014969 | Ga0157376_10347331 | Ga0157376_103473311 | 161 |
| 98 | 3300021384 | Ga0213876_10210333 | Ga0213876_102103332 | 161 |
| 99 | 3300025905 | Ga0207685_10052324 | Ga0207685_100523242 | 161 |
| 100 | 3300025917 | Ga0207660_10292749 | Ga0207660_102927492 | 161 |
| 101 | 3300025921 | Ga0207652_10631796 | Ga0207652_106317962 | 161 |
| 102 | 3300025939 | Ga0207665_11075212 | Ga0207665_110752121 | 161 |
| 103 | 3300025944 | Ga0207661_10316963 | Ga0207661_103169632 | 161 |
| 104 | 3300025944 | Ga0207661_10371644 | Ga0207661_103716442 | 161 |
| 105 | 3300026023 | Ga0207677_10985772 | Ga0207677_109857721 | 161 |
| 106 | 3300028577 | Ga0265318_10125647 | Ga0265318_101256472 | 161 |
| 107 | 3300031238 | Ga0265332_10017475 | Ga0265332_100174752 | 161 |
| 108 | 3300031711 | Ga0265314_10069376 | Ga0265314_100693762 | 161 |
| 109 | 3300034817 | Ga0373948_0184974 | Ga0373948_0184974_34_525 | 161 |
| 110 | 3300035119 | Ga0373956_0064833 | Ga0373956_0064833_1107_1601 | 161 |
| 111 | 3300035121 | Ga0373960_0371377 | Ga0373960_0371377_30_524 | 161 |
| 112 | 3300035171 | Ga0373946_0253386 | Ga0373946_0253386_295_813 | 161 |
| 113 | 3300035172 | Ga0373955_0181262 | Ga0373955_0181262_510_1004 | 161 |
| 114 | 3300035242 | Ga0373962_0184373 | Ga0373962_0184373_182_673 | 161 |
| 115 | 3300035725 | Ga0373947_0206857 | Ga0373947_0206857_507_1025 | 161 |
| 116 | 3300036401 | Ga0373937_0411652 | Ga0373937_0411652_181_672 | 161 |
| 117 | 3300037068 | Ga0373925_0281051 | Ga0373925_0281051_236_754 | 161 |
| 118 | 3300039437 | Ga0436365_1741188 | Ga0436365_1741188_345_836 | 161 |
| 119 | 3300046472 | Ga0495580_0057559 | Ga0495580_0057559_847_1341 | 161 |
| 120 | 3300046475 | Ga0495639_0329592 | Ga0495639_0329592_29_523 | 161 |
| 121 | 3300046674 | Ga0495588_0116405 | Ga0495588_0116405_184_678 | 161 |
| 122 | 3300046681 | Ga0495647_0028248 | Ga0495647_0028248_816_1334 | 161 |
| 123 | 3300046683 | Ga0495658_0036529 | Ga0495658_0036529_922_1416 | 161 |
| 124 | 3300046684 | Ga0495669_0379284 | Ga0495669_0379284_16_507 | 161 |
| 125 | 3300047315 | Ga0495581_0172867 | Ga0495581_0172867_300_818 | 161 |
| 126 | 3300047315 | Ga0495581_0622857 | Ga0495581_0622857_90_584 | 161 |
| 127 | 3300047319 | Ga0495674_0071466 | Ga0495674_0071466_160_678 | 161 |
| 128 | 3300047321 | Ga0495676_0875586 | Ga0495676_0875586_42_560 | 161 |
| 129 | 3300048903 | Ga0496100_0018582 | Ga0496100_0018582_2518_3012 | 161 |
| 130 | 3300048904 | Ga0496101_0007014 | Ga0496101_0007014_5235_5729 | 161 |
| 131 | 3300048907 | Ga0496104_0001207 | Ga0496104_0001207_1626_2120 | 161 |
| 132 | 3300048910 | Ga0496107_0032785 | Ga0496107_0032785_2859_3353 | 161 |
| 133 | 3300048917 | Ga0496114_0000574 | Ga0496114_0000574_21643_22137 | 161 |
| 134 | 3300053085 | Ga0495619_0092479 | Ga0495619_0092479_1249_1743 | 161 |
| 135 | 3300005354 | Ga0070675_100164181 | Ga0070675_1001641812 | 162 |
| 136 | 3300005441 | Ga0070700_100857244 | Ga0070700_1008572441 | 162 |
| 137 | 3300005456 | Ga0070678_101304651 | Ga0070678_1013046511 | 162 |
| 138 | 3300005457 | Ga0070662_100987565 | Ga0070662_1009875651 | 162 |
| 139 | 3300005468 | Ga0070707_100005708 | Ga0070707_1000057084 | 162 |
| 140 | 3300005530 | Ga0070679_100391950 | Ga0070679_1003919502 | 162 |
| 141 | 3300005543 | Ga0070672_100384335 | Ga0070672_1003843352 | 162 |
| 142 | 3300006871 | Ga0075434_100006627 | Ga0075434_1000066277 | 162 |
| 143 | 3300006871 | Ga0075434_100059840 | Ga0075434_1000598405 | 162 |
| 144 | 3300007076 | Ga0075435_100065011 | Ga0075435_1000650113 | 162 |
| 145 | 3300009147 | Ga0114129_10091121 | Ga0114129_100911214 | 162 |
| 146 | 3300013308 | Ga0157375_11231299 | Ga0157375_112312992 | 162 |
| 147 | 3300014326 | Ga0157380_10342291 | Ga0157380_103422912 | 162 |
| 148 | 3300025922 | Ga0207646_10014929 | Ga0207646_100149294 | 162 |
| 149 | 3300025923 | Ga0207681_10755189 | Ga0207681_107551892 | 162 |
| 150 | 3300048908 | Ga0496105_0473805 | Ga0496105_0473805_14_511 | 162 |
| 151 | 3300050507 | nmdc:mga05p37_170688_c1 | nmdc:mga05p37_170688_c1_484_984 | 162 |
| 152 | 3300050512 | nmdc:mga0n895_382598_c1 | nmdc:mga0n895_382598_c1_537_1034 | 162 |
| 153 | 3300050512 | nmdc:mga0n895_64687_c1 | nmdc:mga0n895_64687_c1_1593_2093 | 162 |
| 154 | 3300050513 | nmdc:mga0rr50_53208_c1 | nmdc:mga0rr50_53208_c1_1494_1994 | 162 |
| 155 | 3300005335 | Ga0070666_10231225 | Ga0070666_102312252 | 163 |
| 156 | 3300005436 | Ga0070713_100057718 | Ga0070713_1000577181 | 163 |
| 157 | 3300006852 | Ga0075433_10305907 | Ga0075433_103059072 | 163 |
| 158 | 3300009176 | Ga0105242_11443190 | Ga0105242_114431902 | 163 |
| 159 | 3300009177 | Ga0105248_10078029 | Ga0105248_100780295 | 163 |
| 160 | 3300025928 | Ga0207700_10078047 | Ga0207700_100780472 | 163 |
| 161 | 3300025941 | Ga0207711_10051538 | Ga0207711_100515384 | 163 |
| 162 | 3300036401 | Ga0373937_0850676 | Ga0373937_0850676_255_761 | 163 |
| 163 | 3300037068 | Ga0373925_0052463 | Ga0373925_0052463_1870_2370 | 163 |
| 164 | 3300046472 | Ga0495580_0034652 | Ga0495580_0034652_1751_2251 | 163 |
| 165 | 3300047471 | Ga0495684_0564575 | Ga0495684_0564575_236_745 | 163 |
| 166 | 3300047471 | Ga0495684_0660882 | Ga0495684_0660882_136_636 | 163 |
| 167 | 3300050512 | nmdc:mga0n895_717019_c1 | nmdc:mga0n895_717019_c1_130_630 | 163 |
| 168 | 3300050515 | nmdc:mga0a205_484314_c1 | nmdc:mga0a205_484314_c1_213_713 | 163 |
| 169 | 3300005293 | Ga0065715_10134480 | Ga0065715_101344803 | 164 |
| 170 | 3300005334 | Ga0068869_100480260 | Ga0068869_1004802602 | 164 |
| 171 | 3300005335 | Ga0070666_10702089 | Ga0070666_107020891 | 164 |
| 172 | 3300005345 | Ga0070692_10375943 | Ga0070692_103759431 | 164 |
| 173 | 3300005444 | Ga0070694_100000711 | Ga0070694_1000007116 | 164 |
| 174 | 3300005468 | Ga0070707_100064348 | Ga0070707_1000643482 | 164 |
| 175 | 3300005468 | Ga0070707_100143060 | Ga0070707_1001430602 | 164 |
| 176 | 3300005471 | Ga0070698_100520362 | Ga0070698_1005203621 | 164 |
| 177 | 3300005518 | Ga0070699_100145909 | Ga0070699_1001459092 | 164 |
| 178 | 3300005545 | Ga0070695_100044174 | Ga0070695_1000441744 | 164 |
| 179 | 3300005546 | Ga0070696_100360574 | Ga0070696_1003605742 | 164 |
| 180 | 3300005548 | Ga0070665_100838228 | Ga0070665_1008382281 | 164 |
| 181 | 3300005549 | Ga0070704_100409327 | Ga0070704_1004093271 | 164 |
| 182 | 3300005564 | Ga0070664_100282056 | Ga0070664_1002820562 | 164 |
| 183 | 3300005578 | Ga0068854_100026281 | Ga0068854_1000262814 | 164 |
| 184 | 3300005615 | Ga0070702_100435513 | Ga0070702_1004355132 | 164 |
| 185 | 3300005617 | Ga0068859_100504565 | Ga0068859_1005045652 | 164 |
| 186 | 3300005842 | Ga0068858_100073383 | Ga0068858_1000733834 | 164 |
| 187 | 3300006881 | Ga0068865_101527357 | Ga0068865_1015273571 | 164 |
| 188 | 3300006931 | Ga0097620_100504552 | Ga0097620_1005045522 | 164 |
| 189 | 3300007076 | Ga0075435_100027217 | Ga0075435_1000272174 | 164 |
| 190 | 3300007265 | Ga0099794_10390835 | Ga0099794_103908351 | 164 |
| 191 | 3300009147 | Ga0114129_10004572 | Ga0114129_100045721 | 164 |
| 192 | 3300009148 | Ga0105243_10833115 | Ga0105243_108331152 | 164 |
| 193 | 3300009177 | Ga0105248_10042713 | Ga0105248_100427134 | 164 |
| 194 | 3300009177 | Ga0105248_10099995 | Ga0105248_100999952 | 164 |
| 195 | 3300009551 | Ga0105238_11445198 | Ga0105238_114451981 | 164 |
| 196 | 3300013308 | Ga0157375_10839858 | Ga0157375_108398582 | 164 |
| 197 | 3300025922 | Ga0207646_10077609 | Ga0207646_100776092 | 164 |
| 198 | 3300025922 | Ga0207646_10251839 | Ga0207646_102518392 | 164 |
| 199 | 3300025945 | Ga0207679_10138596 | Ga0207679_101385963 | 164 |
| 200 | 3300025981 | Ga0207640_10255607 | Ga0207640_102556072 | 164 |
| 201 | 3300026035 | Ga0207703_10944900 | Ga0207703_109449001 | 164 |
| 202 | 3300031235 | Ga0265330_10220634 | Ga0265330_102206341 | 164 |
| 203 | 3300031242 | Ga0265329_10095751 | Ga0265329_100957511 | 164 |
| 204 | 3300031250 | Ga0265331_10070504 | Ga0265331_100705042 | 164 |
| 205 | 3300031595 | Ga0265313_10013440 | Ga0265313_100134404 | 164 |
| 206 | 3300031711 | Ga0265314_10376309 | Ga0265314_103763091 | 164 |
| 207 | 3300031712 | Ga0265342_10313994 | Ga0265342_103139942 | 164 |
| 208 | 3300046473 | Ga0495582_0065598 | Ga0495582_0065598_541_1053 | 164 |
| 209 | 3300046642 | Ga0495634_0050690 | Ga0495634_0050690_765_1304 | 164 |
| 210 | 3300050507 | nmdc:mga05p37_30976_c1 | nmdc:mga05p37_30976_c1_2181_2699 | 164 |
| 211 | 3300050512 | nmdc:mga0n895_749592_c1 | nmdc:mga0n895_749592_c1_122_640 | 164 |
| 212 | 3300050515 | nmdc:mga0a205_204027_c1 | nmdc:mga0a205_204027_c1_1101_1616 | 164 |
| 213 | 3300050515 | nmdc:mga0a205_688075_c1 | nmdc:mga0a205_688075_c1_243_770 | 164 |
| 214 | 3300050515 | nmdc:mga0a205_825196_c1 | nmdc:mga0a205_825196_c1_95_613 | 164 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y5e-assembly1.cif.gz_QL | in situ single-pbs-psii-psi-lhcs megacomplex. | 0.6589 | 25 | 144 |
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.5569 | 1 | 148 |
| 1ow8-assembly1.cif.gz_A | paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase | 0.5455 | 24 | 151 |
| 4o79-assembly1.cif.gz_A | crystal structure of ascorbate-bound cytochrome b561, crystal soaked in 1 m l-ascorbate for 10 minutes | 0.5443 | 2 | 149 |
| 7qhm-assembly1.cif.gz_S | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.5409 | 5 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z1Y9_14_236_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6365 | 29 | 147 | 1.20.120.1770 |
| af_Q7JR72_54_280_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6167 | 29 | 160 | 1.20.120.1770 |
| af_Q4CZM6_26_149_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.6034 | 20 | 151 | 1.20.120.350 |
| af_G5EGK1_1078_1232_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.6017 | 2 | 144 | 1.20.1420.10 |
| af_P09483_251_364_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.5965 | 87 | 149 | 1.20.58.390 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8F546-F1-model_v4 | DUF6644 domain-containing protein | 0.9739 | 1 | 150 |
GO:0016020
|
| AF-A0A2V8MA02-F1-model_v4 | Uncharacterized protein | 0.9605 | 35 | 156 |
GO:0016020
|
| AF-A0A2V8DRR8-F1-model_v4 | DUF2214 domain-containing protein | 0.9598 | 2 | 157 |
GO:0016020
|
| AF-A0A7V0Y4P0-F1-model_v4 | Uncharacterized protein | 0.9598 | 3 | 152 |
GO:0016020
|
| AF-A0A2V8NNN7-F1-model_v4 | DUF2214 domain-containing protein | 0.959 | 2 | 157 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar