F321257

General Info

Members Datasets Scaffolds Average Seq Length
211 140 423 341

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100214568|Ga0070668_1002145681
Length 347
Sequence LQLNPFPKVAIAILNWNGKNFLQQFLPSVITTTYSNYEIIVIDNFSEDDSIAFLTSNYPGIRVIRHPANWGYAKGYNEGLKQIKSDYCVILNSDVEVTSGWLHPMVKLLEADSSVAVCQPKILSYDDKKMFEYAGAAGGWIDKYGYPFSKGRVFEVCETDNGQYDRQEPIFWASGAALFIRSSVFEQQNGFDEYFFAHQEEIDLCWRIQLAGKKIYSCPSSVVFHVGGGTLPKTNSKKTFLNFRNNLVMLTKNLPFRRLWIVPFRILLDATAATKGLLTGEGGYFLAILKAHLAFAKWLLFHPKGTTASPDPKGRLYGVLQKNLIWEYFIKRKRTFSEIVQNSSQDI

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
122 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
138 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.16
Nodule 0
Rhizoplane 0.47
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100214568 3300005347 Bacteria 1584
2 JGI24751J29686_10009816 3300002459 Bacteria 1972
3 rootH1_10013386 3300003316 Bacteria 3606
4 rootH1_10013386 3300003323 Bacteria 42758
5 Ga0065704_10143533 3300005289 Bacteria 1494
6 Ga0065712_10020876 3300005290 Bacteria 2717
7 Ga0065712_10211074 3300005290 Bacteria 1072
8 Ga0070676_10070464 3300005328 Bacteria 2097
9 Ga0070690_100021514 3300005330 Bacteria 3938
10 Ga0070670_100021615 3300005331 Bacteria 5533
11 Ga0070670_100037217 3300005331 Bacteria 4186
12 Ga0068869_100001765 3300005334 Bacteria 12943
13 Ga0070666_10000052 3300005335 Bacteria 99095
14 Ga0068868_100037379 3300005338 Bacteria 3763
15 Ga0068868_100085846 3300005338 Bacteria 2529
16 Ga0070689_100109184 3300005340 Bacteria 2199
17 Ga0070669_100019561 3300005353 Bacteria 4837
18 Ga0070675_100000611 3300005354 Bacteria 24630
19 Ga0070675_100015577 3300005354 Bacteria 6014
20 Ga0070675_100066887 3300005354 Bacteria 2973
21 Ga0070675_100133207 3300005354 Bacteria 2119
22 Ga0070674_100063078 3300005356 Bacteria 2592
23 Ga0070674_100116051 3300005356 Bacteria 1975
24 Ga0070673_100075383 3300005364 Bacteria 2720
25 Ga0070688_100028565 3300005365 Bacteria 3331
26 Ga0070667_100003555 3300005367 Bacteria 13278
27 Ga0070701_10087715 3300005438 Bacteria 1698
28 Ga0070678_100061440 3300005456 Bacteria 2769
29 Ga0070662_100168472 3300005457 Bacteria 1718
30 Ga0068867_100047164 3300005459 Bacteria 3167
31 Ga0068867_100111635 3300005459 Bacteria 2101
32 Ga0068867_100242462 3300005459 Bacteria 1462
33 Ga0070698_100002712 3300005471 Bacteria 19470
34 Ga0070672_100040826 3300005543 Bacteria 3563
35 Ga0070672_100053558 3300005543 Bacteria 3155
36 Ga0070686_100038401 3300005544 Bacteria 2976
37 Ga0070693_100055304 3300005547 Bacteria 2286
38 Ga0068855_100023398 3300005563 Bacteria 7400
39 Ga0068857_100304492 3300005577 Bacteria 1470
40 Ga0068854_100102959 3300005578 Bacteria 2143
41 Ga0068852_100003824 3300005616 Bacteria 10574
42 Ga0068852_100127978 3300005616 Bacteria 2335
43 Ga0068859_100010192 3300005617 Bacteria 9460
44 Ga0068859_100059704 3300005617 Bacteria 3842
45 Ga0068859_100118395 3300005617 Bacteria 2714
46 Ga0068864_100021224 3300005618 Bacteria 5440
47 Ga0068864_100234938 3300005618 Bacteria 1697
48 Ga0068861_100004587 3300005719 Bacteria 9270
49 Ga0068870_10046928 3300005840 Bacteria 2268
50 Ga0068858_100003299 3300005842 Bacteria 16064
51 Ga0068858_100170552 3300005842 Bacteria 2052
52 Ga0068860_100019940 3300005843 Bacteria 6501
53 Ga0068860_100133344 3300005843 Bacteria 2385
54 Ga0068862_100002489 3300005844 Bacteria 16300
55 Ga0068862_100334002 3300005844 Bacteria 1402
56 Ga0068862_100350129 3300005844 Bacteria 1370
57 Ga0075366_10013936 3300006195 Bacteria 4584
58 Ga0075429_100087051 3300006880 Bacteria 2723
59 Ga0068865_100185147 3300006881 Bacteria 1606
60 Ga0097620_100010192 3300006931 Bacteria 9460
61 Ga0097620_100059703 3300006931 Bacteria 3842
62 Ga0097620_100118387 3300006931 Bacteria 2714
63 Ga0111539_10001788 3300009094 Bacteria 28593
64 Ga0111539_10177607 3300009094 Bacteria 2487
65 Ga0111539_10290186 3300009094 Bacteria 1904
66 Ga0111539_10424942 3300009094 Bacteria 1548
67 Ga0105247_10002239 3300009101 Bacteria 13314
68 Ga0114129_10000470 3300009147 Bacteria 48413
69 Ga0114129_10070884 3300009147 Bacteria 4859
70 Ga0105241_10004036 3300009174 Bacteria 10864
71 Ga0105237_10001545 3300009545 Bacteria 30045
72 Ga0105249_10001331 3300009553 Bacteria 21632
73 Ga0105249_10007965 3300009553 Bacteria 9238
74 Ga0105249_10013224 3300009553 Bacteria 7283
75 Ga0105239_10000469 3300010375 Bacteria 59012
76 Ga0105239_10094668 3300010375 Bacteria 3299
77 Ga0105239_10476373 3300010375 Bacteria 1418
78 Ga0105246_10026217 3300011119 Bacteria 3805
79 Ga0157370_10005293 3300013104 Bacteria 14491
80 Ga0157374_10097176 3300013296 Bacteria 2818
81 Ga0157374_10252117 3300013296 Unclassified 1737
82 Ga0157378_10038762 3300013297 Bacteria 4225
83 Ga0163162_10009691 3300013306 Bacteria 9372
84 Ga0163162_10062327 3300013306 Bacteria 3769
85 Ga0163162_10085184 3300013306 Bacteria 3237
86 Ga0163162_10107143 3300013306 Bacteria 2890
87 Ga0157372_10006597 3300013307 Bacteria 12351
88 Ga0157375_10021656 3300013308 Bacteria 5900
89 Ga0157375_10046846 3300013308 Bacteria 4219
90 Ga0157375_10140850 3300013308 Bacteria 2539
91 Ga0157375_10266596 3300013308 Bacteria 1874
92 Ga0163163_10125941 3300014325 Bacteria 2600
93 Ga0163163_10159647 3300014325 Bacteria 2300
94 Ga0157380_10000368 3300014326 Bacteria 27181
95 Ga0157380_10022854 3300014326 Bacteria 4715
96 Ga0157377_10004052 3300014745 Bacteria 6686
97 Ga0157377_10074340 3300014745 Bacteria 1972
98 Ga0157379_10021369 3300014968 Bacteria 5728
99 Ga0157379_10076668 3300014968 Bacteria 2994
100 Ga0157379_10280299 3300014968 Bacteria 1517
101 Ga0157376_10355838 3300014969 Bacteria 1403
102 Ga0207710_10001510 3300025900 Bacteria 11538
103 Ga0207688_10088423 3300025901 Bacteria 1777
104 Ga0207680_10000035 3300025903 Bacteria 73889
105 Ga0207645_10022558 3300025907 Bacteria 4094
106 Ga0207643_10066333 3300025908 Bacteria 2069
107 Ga0207654_10003267 3300025911 Bacteria 8195
108 Ga0207671_10000502 3300025914 Bacteria 53150
109 Ga0207662_10103120 3300025918 Bacteria 1770
110 Ga0207681_10056037 3300025923 Bacteria 2687
111 Ga0207681_10185905 3300025923 Bacteria 1586
112 Ga0207650_10096251 3300025925 Bacteria 2270
113 Ga0207650_10246811 3300025925 Bacteria 1444
114 Ga0207650_10282522 3300025925 Bacteria 1352
115 Ga0207659_10014385 3300025926 Bacteria 5101
116 Ga0207659_10035693 3300025926 Bacteria 3439
117 Ga0207659_10044144 3300025926 Bacteria 3135
118 Ga0207659_10086941 3300025926 Bacteria 2326
119 Ga0207659_10164750 3300025926 Unclassified 1744
120 Ga0207706_10052974 3300025933 Bacteria 3582
121 Ga0207670_10109340 3300025936 Bacteria 1989
122 Ga0207669_10072729 3300025937 Bacteria 2166
123 Ga0207669_10150085 3300025937 Bacteria 1631
124 Ga0207704_10113414 3300025938 Bacteria 1838
125 Ga0207689_10001620 3300025942 Bacteria 21317
126 Ga0207689_10041825 3300025942 Bacteria 3791
127 Ga0207667_10050387 3300025949 Bacteria 4394
128 Ga0207651_10130589 3300025960 Bacteria 1922
129 Ga0207712_10014797 3300025961 Bacteria 5023
130 Ga0207712_10018766 3300025961 Bacteria 4509
131 Ga0207712_10040110 3300025961 Bacteria 3211
132 Ga0207668_10216687 3300025972 Bacteria 1534
133 Ga0207640_10056614 3300025981 Bacteria 2575
134 Ga0207640_10105352 3300025981 Bacteria 1987
135 Ga0207640_10105660 3300025981 Unclassified 1984
136 Ga0207658_10090778 3300025986 Bacteria 2368
137 Ga0207677_10044146 3300026023 Bacteria 2967
138 Ga0207703_10002779 3300026035 Bacteria 14978
139 Ga0207703_10053917 3300026035 Bacteria 3269
140 Ga0207708_10148039 3300026075 Bacteria 1846
141 Ga0207641_10000454 3300026088 Bacteria 46782
142 Ga0207648_10024830 3300026089 Bacteria 5345
143 Ga0207676_10023267 3300026095 Bacteria 4568
144 Ga0207674_10024749 3300026116 Bacteria 6408
145 Ga0207675_100006583 3300026118 Bacteria 10989
146 Ga0207683_10109715 3300026121 Bacteria 2470
147 Ga0207698_10008397 3300026142 Bacteria 6530
148 Ga0207698_10263809 3300026142 Bacteria 1584
149 Ga0268265_10012174 3300028380 Bacteria 5826
150 Ga0268264_10001805 3300028381 Bacteria 19566
151 Ga0268264_10063134 3300028381 Bacteria 3113
152 Ga0265327_10000459 3300031251 Bacteria 73045
153 Ga0307408_100000329 3300031548 Bacteria 45457
154 Ga0307408_100002115 3300031548 Bacteria 14269
155 Ga0439439_0003323 3300041406 Bacteria 3541
156 Ga0439445_0031340 3300042004 Bacteria 1382
157 Ga0439445_0055211 3300042004 Bacteria 1078
158 Ga0439457_005422 3300042014 Bacteria 3215
159 Ga0466969_0000972 3300044656 Bacteria 15442
160 Ga0466972_0043093 3300044658 Bacteria 2192
161 Ga0466972_0145835 3300044658 Bacteria 1114
162 Ga0466966_0000018 3300044684 Bacteria 122605
163 Ga0466957_0002242 3300044842 Bacteria 10366
164 Ga0466957_0075091 3300044842 Bacteria 2097
165 Ga0466959_0000002 3300045049 Bacteria 362671
166 Ga0495629_0095758 3300046459 Bacteria 2071
167 Ga0495630_0090492 3300046517 Bacteria 2312
168 Ga0495645_0130602 3300046543 Bacteria 1761
169 Ga0495668_0005153 3300046616 Bacteria 8974
170 Ga0495658_0009123 3300046683 Bacteria 4932
171 Ga0495613_0117337 3300046689 Bacteria 1914
172 Ga0496104_0194797 3300048907 Bacteria 1939
173 Ga0501031_0014994 3300049568 Bacteria 5034
174 Ga0501034_0029302 3300049571 Bacteria 5594
175 Ga0501036_0072147 3300049572 Bacteria 2919
176 Ga0501036_0101981 3300049572 Bacteria 2427
177 Ga0501037_0012620 3300049573 Bacteria 6225
178 Ga0501037_0019080 3300049573 Bacteria 5055
179 Ga0501038_0017634 3300049574 Bacteria 6452
180 Ga0501038_0112968 3300049574 Bacteria 2248
181 Ga0501039_0117886 3300049575 Bacteria 2079
182 Ga0501043_0005540 3300049579 Bacteria 10183
183 Ga0501043_0032353 3300049579 Bacteria 4112
184 Ga0501046_0105686 3300049580 Bacteria 2156
185 Ga0501047_0077546 3300049581 Bacteria 3196
186 Ga0501047_0137485 3300049581 Bacteria 2323
187 Ga0501047_0397244 3300049581 Bacteria 1212
188 Ga0501219_000048 3300049703 Bacteria 19595
189 Ga0501225_0005081 3300049705 Bacteria 3879
190 Ga0501083_0179872 3300049744 Bacteria 1381
191 Ga0501035_0037195 3300049822 Bacteria 4409
192 Ga0501035_0063919 3300049822 Bacteria 3272
193 Ga0501044_0044152 3300049823 Bacteria 4628
194 Ga0501044_0047269 3300049823 Bacteria 4451
195 Ga0501044_0057663 3300049823 Bacteria 3985
196 Ga0501284_00032 3300050005 Bacteria 64343
197 nmdc:mga05p37_11707_c1 3300050507 Bacteria 10454
198 nmdc:mga05p37_489_c1 3300050507 Bacteria 43460
199 nmdc:mga08y16_24274_c1 3300050511 Bacteria 6400
200 Ga0500578_0005177 3300053086 Bacteria 8921
201 Ga0500644_0024784 3300053088 Bacteria 1838
202 Ga0500583_0000012 3300053092 Bacteria 154426
203 Ga0500583_0021783 3300053092 Bacteria 2672
204 Ga0500642_0042835 3300053130 Bacteria 1964
205 Ga0500559_0035646 3300053136 Bacteria 2150
206 Ga0500568_0002807 3300053139 Bacteria 10075
207 Ga0500589_038349 3300053147 Bacteria 2237
208 Ga0500622_0083187 3300053156 Bacteria 1599
209 Ga0500636_0111642 3300053177 Bacteria 1544
210 Ga0500611_000086 3300053727 Bacteria 28214
211 Ga0500645_022927 3300053730 Bacteria 1916
212 2738727258 2738541278 Bacteria 9755573
213 Ga0070668_100214568
214 JGI24751J29686_10009816
215 rootH1_10013386
216 Ga0065704_10143533
217 Ga0065712_10020876
218 Ga0065712_10211074
219 Ga0070676_10070464
220 Ga0070690_100021514
221 Ga0070670_100021615
222 Ga0070670_100037217
223 Ga0068869_100001765
224 Ga0070666_10000052
225 Ga0068868_100037379
226 Ga0068868_100085846
227 Ga0070689_100109184
228 Ga0070669_100019561
229 Ga0070675_100000611
230 Ga0070675_100015577
231 Ga0070675_100066887
232 Ga0070675_100133207
233 Ga0070674_100063078
234 Ga0070674_100116051
235 Ga0070673_100075383
236 Ga0070688_100028565
237 Ga0070667_100003555
238 Ga0070701_10087715
239 Ga0070678_100061440
240 Ga0070662_100168472
241 Ga0068867_100047164
242 Ga0068867_100111635
243 Ga0068867_100242462
244 Ga0070698_100002712
245 Ga0070672_100040826
246 Ga0070672_100053558
247 Ga0070686_100038401
248 Ga0070693_100055304
249 Ga0068855_100023398
250 Ga0068857_100304492
251 Ga0068854_100102959
252 Ga0068852_100003824
253 Ga0068852_100127978
254 Ga0068859_100010192
255 Ga0068859_100059704
256 Ga0068859_100118395
257 Ga0068864_100021224
258 Ga0068864_100234938
259 Ga0068861_100004587
260 Ga0068870_10046928
261 Ga0068858_100003299
262 Ga0068858_100170552
263 Ga0068860_100019940
264 Ga0068860_100133344
265 Ga0068862_100002489
266 Ga0068862_100334002
267 Ga0068862_100350129
268 Ga0075366_10013936
269 Ga0075429_100087051
270 Ga0068865_100185147
271 Ga0097620_100010192
272 Ga0097620_100059703
273 Ga0097620_100118387
274 Ga0111539_10001788
275 Ga0111539_10177607
276 Ga0111539_10290186
277 Ga0111539_10424942
278 Ga0105247_10002239
279 Ga0114129_10000470
280 Ga0114129_10070884
281 Ga0105241_10004036
282 Ga0105237_10001545
283 Ga0105249_10001331
284 Ga0105249_10007965
285 Ga0105249_10013224
286 Ga0105239_10000469
287 Ga0105239_10094668
288 Ga0105239_10476373
289 Ga0105246_10026217
290 Ga0157370_10005293
291 Ga0157374_10097176
292 Ga0157374_10252117
293 Ga0157378_10038762
294 Ga0163162_10009691
295 Ga0163162_10062327
296 Ga0163162_10085184
297 Ga0163162_10107143
298 Ga0157372_10006597
299 Ga0157375_10021656
300 Ga0157375_10046846
301 Ga0157375_10140850
302 Ga0157375_10266596
303 Ga0163163_10125941
304 Ga0163163_10159647
305 Ga0157380_10000368
306 Ga0157380_10022854
307 Ga0157377_10004052
308 Ga0157377_10074340
309 Ga0157379_10021369
310 Ga0157379_10076668
311 Ga0157379_10280299
312 Ga0157376_10355838
313 Ga0207710_10001510
314 Ga0207688_10088423
315 Ga0207680_10000035
316 Ga0207645_10022558
317 Ga0207643_10066333
318 Ga0207654_10003267
319 Ga0207671_10000502
320 Ga0207662_10103120
321 Ga0207681_10056037
322 Ga0207681_10185905
323 Ga0207650_10096251
324 Ga0207650_10246811
325 Ga0207650_10282522
326 Ga0207659_10014385
327 Ga0207659_10035693
328 Ga0207659_10044144
329 Ga0207659_10086941
330 Ga0207659_10164750
331 Ga0207706_10052974
332 Ga0207670_10109340
333 Ga0207669_10072729
334 Ga0207669_10150085
335 Ga0207704_10113414
336 Ga0207689_10001620
337 Ga0207689_10041825
338 Ga0207667_10050387
339 Ga0207651_10130589
340 Ga0207712_10014797
341 Ga0207712_10018766
342 Ga0207712_10040110
343 Ga0207668_10216687
344 Ga0207640_10056614
345 Ga0207640_10105352
346 Ga0207640_10105660
347 Ga0207658_10090778
348 Ga0207677_10044146
349 Ga0207703_10002779
350 Ga0207703_10053917
351 Ga0207708_10148039
352 Ga0207641_10000454
353 Ga0207648_10024830
354 Ga0207676_10023267
355 Ga0207674_10024749
356 Ga0207675_100006583
357 Ga0207683_10109715
358 Ga0207698_10008397
359 Ga0207698_10263809
360 Ga0268265_10012174
361 Ga0268264_10001805
362 Ga0268264_10063134
363 Ga0265327_10000459
364 Ga0307408_100000329
365 Ga0307408_100002115
366 Ga0439439_0003323
367 Ga0439445_0031340
368 Ga0439445_0055211
369 Ga0439457_005422
370 Ga0466969_0000972
371 Ga0466972_0043093
372 Ga0466972_0145835
373 Ga0466966_0000018
374 Ga0466957_0002242
375 Ga0466957_0075091
376 Ga0466959_0000002
377 Ga0495629_0095758
378 Ga0495630_0090492
379 Ga0495645_0130602
380 Ga0495668_0005153
381 Ga0495658_0009123
382 Ga0495613_0117337
383 Ga0496104_0194797
384 Ga0501031_0014994
385 Ga0501034_0029302
386 Ga0501036_0072147
387 Ga0501036_0101981
388 Ga0501037_0012620
389 Ga0501037_0019080
390 Ga0501038_0017634
391 Ga0501038_0112968
392 Ga0501039_0117886
393 Ga0501043_0005540
394 Ga0501043_0032353
395 Ga0501046_0105686
396 Ga0501047_0077546
397 Ga0501047_0137485
398 Ga0501047_0397244
399 Ga0501219_000048
400 Ga0501225_0005081
401 Ga0501083_0179872
402 Ga0501035_0037195
403 Ga0501035_0063919
404 Ga0501044_0044152
405 Ga0501044_0047269
406 Ga0501044_0057663
407 Ga0501284_00032
408 nmdc:mga05p37_11707_c1
409 nmdc:mga05p37_489_c1
410 nmdc:mga08y16_24274_c1
411 Ga0500578_0005177
412 Ga0500644_0024784
413 Ga0500583_0000012
414 Ga0500583_0021783
415 Ga0500642_0042835
416 Ga0500559_0035646
417 Ga0500568_0002807
418 Ga0500589_038349
419 Ga0500622_0083187
420 Ga0500636_0111642
421 Ga0500611_000086
422 Ga0500645_022927
423 2738727258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

10

187

0.84

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

7

245

0.82

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

8

264

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7955 5 220
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7725 5 220
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7587 5 215
6e4q-assembly3.cif.gz_C crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9a in complex with udp and mn2+ 0.751 1 252
4d11-assembly4.cif.gz_F galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.751 5 226
ID Description Score Start End Superfamily
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.861 5 112 3.90.550.10
af_Q54XP5_80_490_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8143 5 123 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8036 1 229 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7996 1 230 3.90.550.10
4fiyB01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A; 0.7854 5 227 3.90.550.60
ID Description Score Start End GO Terms
AF-A0A2E4L2L8-F1-model_v4 Glycosyl hydrolase 0.9601 5 110 GO:0016787
AF-X1L7R2-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9499 5 171
AF-A0A3M2HMI6-F1-model_v4 Glycosyltransferase family 2 protein 0.9488 5 340 GO:0016740
AF-A0A7C2YIV5-F1-model_v4 Glycosyltransferase family 2 protein 0.9431 1 338 GO:0016740
AF-A0A3D2S329-F1-model_v4 Glycosyl transferase family 2 0.9381 6 337 GO:0016740

Map