F318974

General Info

Members Datasets Scaffolds Average Seq Length
209 99 418 293

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10005992|Ga0099794_100059925
Length 328
Sequence VESGLHPEGLRALAVEGQSRERQHGITLKEESWRTFVNKKQLSASVAGDVSLGGEISVHGFGFGAMRLTGEGIWGPPKDRKGALAVLRRAVELDINFIDTADSYGPHVNEELIAEALFPYPAGLVIATKGGWNRPGPNQWTHDASPSHLRKAVEGSLKRLRLDRIDVYQLHVPDPVISFEASVETLAQLRNEGKIRLVALSNVTQEHIDRARKIVPIVSVQNRYSFADREWDHVVEYCDRNGIVFIPWFPLGAGKVAGDVLNRIAQAHHASPTQVALAWLLRRSPNMLPIPGTSSIEHLEQNVAAASLHLAEEEYEKLSGVPELVGSR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
78 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 3.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10005992 3300007265 Bacteria 4907
2 rootH1_10321731 3300003323 Bacteria 2085
3 Ga0068868_100038707 3300005338 Bacteria 3702
4 Ga0070709_10016045 3300005434 Bacteria 4268
5 Ga0070709_10087090 3300005434 Bacteria 2051
6 Ga0070714_100000281 3300005435 Bacteria 39148
7 Ga0070714_100689894 3300005435 Bacteria 985
8 Ga0070713_100003101 3300005436 Bacteria 10928
9 Ga0070713_100016381 3300005436 Bacteria 5573
10 Ga0070713_100076451 3300005436 Bacteria 2843
11 Ga0070713_100153429 3300005436 Bacteria 2051
12 Ga0070713_100195120 3300005436 Unclassified 1826
13 Ga0070713_100222620 3300005436 Bacteria 1712
14 Ga0070711_100000154 3300005439 Bacteria 36893
15 Ga0070711_100003489 3300005439 Bacteria 9170
16 Ga0070708_100013185 3300005445 Bacteria 6763
17 Ga0070708_100031297 3300005445 Bacteria 4604
18 Ga0070708_100050675 3300005445 Bacteria 3677
19 Ga0070708_100233229 3300005445 Bacteria 1727
20 Ga0070678_100066303 3300005456 Bacteria 2684
21 Ga0070681_10101547 3300005458 Bacteria 2822
22 Ga0070706_100000594 3300005467 Bacteria 41898
23 Ga0070706_100022374 3300005467 Bacteria 5821
24 Ga0070706_100205869 3300005467 Bacteria 1837
25 Ga0070707_100026821 3300005468 Bacteria 5473
26 Ga0070707_100061541 3300005468 Bacteria 3600
27 Ga0070707_100066321 3300005468 Bacteria 3469
28 Ga0070698_100000582 3300005471 Bacteria 39263
29 Ga0070698_100003545 3300005471 Bacteria 17159
30 Ga0070698_100008469 3300005471 Bacteria 11107
31 Ga0070698_100034876 3300005471 Bacteria 5205
32 Ga0070698_100660033 3300005471 Bacteria 987
33 Ga0070699_100168033 3300005518 Bacteria 1943
34 Ga0070699_100182004 3300005518 Bacteria 1865
35 Ga0070699_100246874 3300005518 Bacteria 1594
36 Ga0070699_100251843 3300005518 Bacteria 1578
37 Ga0070684_100035192 3300005535 Bacteria 4286
38 Ga0070697_100000745 3300005536 Bacteria 24295
39 Ga0070697_100030987 3300005536 Bacteria 4299
40 Ga0070697_100582455 3300005536 Bacteria 983
41 Ga0068853_100017146 3300005539 Bacteria 5976
42 Ga0070686_100003895 3300005544 Bacteria 8204
43 Ga0070695_100363566 3300005545 Bacteria 1087
44 Ga0070693_100141321 3300005547 Bacteria 1516
45 Ga0068855_100000664 3300005563 Bacteria 41988
46 Ga0068855_100022920 3300005563 Bacteria 7483
47 Ga0068854_100080364 3300005578 Bacteria 2406
48 Ga0068856_100000667 3300005614 Bacteria 37242
49 Ga0068852_100089315 3300005616 Bacteria 2754
50 Ga0068852_100163564 3300005616 Bacteria 2080
51 Ga0068864_100024318 3300005618 Bacteria 5095
52 Ga0068858_100089224 3300005842 Bacteria 2869
53 Ga0070717_10000952 3300006028 Bacteria 19283
54 Ga0070717_10058963 3300006028 Bacteria 3175
55 Ga0070717_10085091 3300006028 Bacteria 2661
56 Ga0070717_10106299 3300006028 Bacteria 2389
57 Ga0070716_100000187 3300006173 Bacteria 24361
58 Ga0070716_100003036 3300006173 Bacteria 7836
59 Ga0070716_100104725 3300006173 Bacteria 1742
60 Ga0070716_100185507 3300006173 Bacteria 1370
61 Ga0070712_100002130 3300006175 Bacteria 12172
62 Ga0070712_100002410 3300006175 Bacteria 11521
63 Ga0070712_100003495 3300006175 Bacteria 9662
64 Ga0070712_100029546 3300006175 Bacteria 3675
65 Ga0070712_100042963 3300006175 Bacteria 3110
66 Ga0070712_100081322 3300006175 Bacteria 2347
67 Ga0097621_100000992 3300006237 Bacteria 19954
68 Ga0097621_100135156 3300006237 Unclassified 2102
69 Ga0068871_100000712 3300006358 Bacteria 22517
70 Ga0068871_100143598 3300006358 Unclassified 2031
71 Ga0075431_100082066 3300006847 Bacteria 3328
72 Ga0075433_10012902 3300006852 Bacteria 6772
73 Ga0075433_10051653 3300006852 Bacteria 3580
74 Ga0075433_10082043 3300006852 Plasmid 2843
75 Ga0075434_100004257 3300006871 Bacteria 12831
76 Ga0075434_100494919 3300006871 Bacteria 1243
77 Ga0075429_100323836 3300006880 Unclassified 1349
78 Ga0068865_100016057 3300006881 Bacteria 4784
79 Ga0075436_100010420 3300006914 Bacteria 6372
80 Ga0075436_100026715 3300006914 Bacteria 3974
81 Ga0075436_100028697 3300006914 Unclassified 3827
82 Ga0075436_100041862 3300006914 Bacteria 3160
83 Ga0075436_100081794 3300006914 Bacteria 2239
84 Ga0075435_100034069 3300007076 Bacteria 4032
85 Ga0075435_100035049 3300007076 Bacteria 3981
86 Ga0075435_100112774 3300007076 Unclassified 2262
87 Ga0075435_100496015 3300007076 Unclassified 1056
88 Ga0099794_10001121 3300007265 Bacteria 9168
89 Ga0099794_10001227 3300007265 Bacteria 8826
90 Ga0099794_10002232 3300007265 Bacteria 7082
91 Ga0099794_10005317 3300007265 Bacteria 5151
92 Ga0099794_10006114 3300007265 Bacteria 4864
93 Ga0099794_10033146 3300007265 Bacteria 2428
94 Ga0099794_10035427 3300007265 Unclassified 2355
95 Ga0099794_10042622 3300007265 Bacteria 2164
96 Ga0099794_10046772 3300007265 Bacteria 2073
97 Ga0099794_10082215 3300007265 Bacteria 1590
98 Ga0099794_10114277 3300007265 Bacteria 1355
99 Ga0099794_10170414 3300007265 Unclassified 1109
100 Ga0105240_10027885 3300009093 Bacteria 7388
101 Ga0114129_10105970 3300009147 Bacteria 3884
102 Ga0114129_10401484 3300009147 Unclassified 1806
103 Ga0105241_10148345 3300009174 Unclassified 1916
104 Ga0105241_10218925 3300009174 Bacteria 1599
105 Ga0105248_10013430 3300009177 Bacteria 9015
106 Ga0105248_10048912 3300009177 Bacteria 4743
107 Ga0105237_10017009 3300009545 Bacteria 7548
108 Ga0105238_10019616 3300009551 Bacteria 6884
109 Ga0105249_10138979 3300009553 Unclassified 2327
110 Ga0105239_10062876 3300010375 Bacteria 4074
111 Ga0157373_10050591 3300013100 Bacteria 2959
112 Ga0157371_10078533 3300013102 Bacteria 2338
113 Ga0157369_10027438 3300013105 Bacteria 6312
114 Ga0157374_10000280 3300013296 Bacteria 47309
115 Ga0157378_10000157 3300013297 Bacteria 64384
116 Ga0157378_10001275 3300013297 Bacteria 22626
117 Ga0163162_10167988 3300013306 Unclassified 2318
118 Ga0157372_10035867 3300013307 Bacteria 5461
119 Ga0157372_10080730 3300013307 Unclassified 3681
120 Ga0206350_11018424 3300020080 Bacteria 2163
121 Ga0224570_100510 3300022730 Unclassified 3058
122 Ga0224572_1000296 3300024225 Bacteria 5249
123 Ga0224572_1015963 3300024225 Bacteria 1440
124 Ga0228598_1001224 3300024227 Bacteria 5672
125 Ga0207699_10004108 3300025906 Bacteria 6973
126 Ga0207699_10206928 3300025906 Bacteria 1332
127 Ga0207699_10327338 3300025906 Unclassified 1076
128 Ga0207684_10036787 3300025910 Unclassified 4155
129 Ga0207684_10036795 3300025910 Bacteria 4154
130 Ga0207684_10054727 3300025910 Bacteria 3385
131 Ga0207684_10105675 3300025910 Bacteria 2408
132 Ga0207707_10090757 3300025912 Bacteria 2670
133 Ga0207693_10000102 3300025915 Bacteria 76687
134 Ga0207693_10003997 3300025915 Bacteria 12535
135 Ga0207693_10004526 3300025915 Bacteria 11751
136 Ga0207693_10036009 3300025915 Bacteria 3900
137 Ga0207693_10054030 3300025915 Bacteria 3151
138 Ga0207693_10061137 3300025915 Unclassified 2950
139 Ga0207693_10260478 3300025915 Bacteria 1360
140 Ga0207663_10039851 3300025916 Bacteria 2850
141 Ga0207646_10006881 3300025922 Bacteria 11677
142 Ga0207646_10059626 3300025922 Bacteria 3408
143 Ga0207646_10142443 3300025922 Bacteria 2159
144 Ga0207646_10275189 3300025922 Bacteria 1521
145 Ga0207694_10090196 3300025924 Bacteria 2418
146 Ga0207700_10001402 3300025928 Bacteria 13682
147 Ga0207700_10008274 3300025928 Bacteria 6428
148 Ga0207700_10038249 3300025928 Bacteria 3481
149 Ga0207700_10072853 3300025928 Bacteria 2650
150 Ga0207700_10176463 3300025928 Unclassified 1786
151 Ga0207704_10008917 3300025938 Bacteria 4818
152 Ga0207665_10000318 3300025939 Bacteria 33337
153 Ga0207665_10000670 3300025939 Bacteria 23066
154 Ga0207665_10052580 3300025939 Bacteria 2745
155 Ga0207665_10057559 3300025939 Bacteria 2626
156 Ga0207665_10062743 3300025939 Bacteria 2522
157 Ga0207665_10068667 3300025939 Bacteria 2415
158 Ga0207665_10093500 3300025939 Bacteria 2088
159 Ga0207711_10008594 3300025941 Bacteria 8536
160 Ga0207661_10027311 3300025944 Bacteria 4359
161 Ga0207667_10000764 3300025949 Bacteria 41822
162 Ga0207667_10450105 3300025949 Bacteria 1308
163 Ga0207677_10006176 3300026023 Bacteria 6546
164 Ga0207702_10001773 3300026078 Bacteria 21236
165 Ga0207702_10046244 3300026078 Bacteria 3663
166 Ga0207641_10008902 3300026088 Bacteria 8292
167 Ga0207648_10094483 3300026089 Bacteria 2615
168 Ga0207676_10020909 3300026095 Bacteria 4795
169 Ga0209588_1001913 3300027671 Bacteria 5568
170 Ga0209588_1009496 3300027671 Bacteria 2910
171 Ga0209588_1021956 3300027671 Bacteria 2007
172 Ga0209588_1024823 3300027671 Unclassified 1894
173 Ga0209588_1024908 3300027671 Bacteria 1891
174 Ga0265356_1000001 3300028017 Bacteria 47844
175 Ga0265355_1001820 3300028036 Bacteria 1435
176 Ga0265338_10033726 3300028800 Unclassified 4962
177 Ga0265762_1002788 3300030760 Bacteria 3122
178 Ga0265770_1005875 3300030878 Bacteria 1696
179 Ga0265760_10000638 3300031090 Bacteria 9929
180 Ga0265760_10002556 3300031090 Bacteria 5316
181 Ga0265760_10002668 3300031090 Bacteria 5221
182 Ga0265760_10016359 3300031090 Bacteria 2128
183 Ga0265760_10032776 3300031090 Bacteria 1535
184 Ga0265325_10007094 3300031241 Bacteria 6745
185 Ga0265316_10166887 3300031344 Bacteria 1644
186 Ga0436363_1080184 3300039450 Bacteria 1368
187 Ga0466967_0248911 3300045976 Bacteria 1697
188 Ga0495580_0094268 3300046472 Unclassified 2083
189 Ga0495674_0206832 3300047319 Unclassified 1627
190 Ga0496102_0193629 3300048905 Unclassified 1916
191 Ga0496105_0197524 3300048908 Bacteria 1643
192 Ga0496106_0006560 3300048909 Bacteria 8620
193 Ga0496107_0055758 3300048910 Unclassified 2854
194 Ga0496112_0332095 3300048915 Bacteria 1464
195 nmdc:mga05p37_61430_c2 3300050507 Bacteria 3637
196 nmdc:mga06r32_200025_c1 3300050510 Bacteria 1986
197 nmdc:mga0n895_11835_c1 3300050512 Bacteria 7803
198 nmdc:mga0n895_18186_c1 3300050512 Bacteria 6498
199 nmdc:mga0rr50_2608_c1 3300050513 Bacteria 10219
200 nmdc:mga0rr50_41124_c1 3300050513 Bacteria 3366
201 nmdc:mga0rr50_42888_c1 3300050513 Bacteria 3307
202 nmdc:mga0rr50_92685_c1 3300050513 Bacteria 2356
203 nmdc:mga08x19_200060_c1 3300050514 Bacteria 1369
204 nmdc:mga08x19_5547_c1 3300050514 Bacteria 7461
205 nmdc:mga08x19_59329_c1 3300050514 Bacteria 2477
206 nmdc:mga08x19_73458_c1 3300050514 Unclassified 2233
207 nmdc:mga0a205_21330_c1 3300050515 Bacteria 6129
208 nmdc:mga0a205_3815_c1 3300050515 Bacteria 13507
209 nmdc:mga0a205_82706_c1 3300050515 Bacteria 3101
210 Ga0099794_10005992
211 rootH1_10321731
212 Ga0068868_100038707
213 Ga0070709_10016045
214 Ga0070709_10087090
215 Ga0070714_100000281
216 Ga0070714_100689894
217 Ga0070713_100003101
218 Ga0070713_100016381
219 Ga0070713_100076451
220 Ga0070713_100153429
221 Ga0070713_100195120
222 Ga0070713_100222620
223 Ga0070711_100000154
224 Ga0070711_100003489
225 Ga0070708_100013185
226 Ga0070708_100031297
227 Ga0070708_100050675
228 Ga0070708_100233229
229 Ga0070678_100066303
230 Ga0070681_10101547
231 Ga0070706_100000594
232 Ga0070706_100022374
233 Ga0070706_100205869
234 Ga0070707_100026821
235 Ga0070707_100061541
236 Ga0070707_100066321
237 Ga0070698_100000582
238 Ga0070698_100003545
239 Ga0070698_100008469
240 Ga0070698_100034876
241 Ga0070698_100660033
242 Ga0070699_100168033
243 Ga0070699_100182004
244 Ga0070699_100246874
245 Ga0070699_100251843
246 Ga0070684_100035192
247 Ga0070697_100000745
248 Ga0070697_100030987
249 Ga0070697_100582455
250 Ga0068853_100017146
251 Ga0070686_100003895
252 Ga0070695_100363566
253 Ga0070693_100141321
254 Ga0068855_100000664
255 Ga0068855_100022920
256 Ga0068854_100080364
257 Ga0068856_100000667
258 Ga0068852_100089315
259 Ga0068852_100163564
260 Ga0068864_100024318
261 Ga0068858_100089224
262 Ga0070717_10000952
263 Ga0070717_10058963
264 Ga0070717_10085091
265 Ga0070717_10106299
266 Ga0070716_100000187
267 Ga0070716_100003036
268 Ga0070716_100104725
269 Ga0070716_100185507
270 Ga0070712_100002130
271 Ga0070712_100002410
272 Ga0070712_100003495
273 Ga0070712_100029546
274 Ga0070712_100042963
275 Ga0070712_100081322
276 Ga0097621_100000992
277 Ga0097621_100135156
278 Ga0068871_100000712
279 Ga0068871_100143598
280 Ga0075431_100082066
281 Ga0075433_10012902
282 Ga0075433_10051653
283 Ga0075433_10082043
284 Ga0075434_100004257
285 Ga0075434_100494919
286 Ga0075429_100323836
287 Ga0068865_100016057
288 Ga0075436_100010420
289 Ga0075436_100026715
290 Ga0075436_100028697
291 Ga0075436_100041862
292 Ga0075436_100081794
293 Ga0075435_100034069
294 Ga0075435_100035049
295 Ga0075435_100112774
296 Ga0075435_100496015
297 Ga0099794_10001121
298 Ga0099794_10001227
299 Ga0099794_10002232
300 Ga0099794_10005317
301 Ga0099794_10006114
302 Ga0099794_10033146
303 Ga0099794_10035427
304 Ga0099794_10042622
305 Ga0099794_10046772
306 Ga0099794_10082215
307 Ga0099794_10114277
308 Ga0099794_10170414
309 Ga0105240_10027885
310 Ga0114129_10105970
311 Ga0114129_10401484
312 Ga0105241_10148345
313 Ga0105241_10218925
314 Ga0105248_10013430
315 Ga0105248_10048912
316 Ga0105237_10017009
317 Ga0105238_10019616
318 Ga0105249_10138979
319 Ga0105239_10062876
320 Ga0157373_10050591
321 Ga0157371_10078533
322 Ga0157369_10027438
323 Ga0157374_10000280
324 Ga0157378_10000157
325 Ga0157378_10001275
326 Ga0163162_10167988
327 Ga0157372_10035867
328 Ga0157372_10080730
329 Ga0206350_11018424
330 Ga0224570_100510
331 Ga0224572_1000296
332 Ga0224572_1015963
333 Ga0228598_1001224
334 Ga0207699_10004108
335 Ga0207699_10206928
336 Ga0207699_10327338
337 Ga0207684_10036787
338 Ga0207684_10036795
339 Ga0207684_10054727
340 Ga0207684_10105675
341 Ga0207707_10090757
342 Ga0207693_10000102
343 Ga0207693_10003997
344 Ga0207693_10004526
345 Ga0207693_10036009
346 Ga0207693_10054030
347 Ga0207693_10061137
348 Ga0207693_10260478
349 Ga0207663_10039851
350 Ga0207646_10006881
351 Ga0207646_10059626
352 Ga0207646_10142443
353 Ga0207646_10275189
354 Ga0207694_10090196
355 Ga0207700_10001402
356 Ga0207700_10008274
357 Ga0207700_10038249
358 Ga0207700_10072853
359 Ga0207700_10176463
360 Ga0207704_10008917
361 Ga0207665_10000318
362 Ga0207665_10000670
363 Ga0207665_10052580
364 Ga0207665_10057559
365 Ga0207665_10062743
366 Ga0207665_10068667
367 Ga0207665_10093500
368 Ga0207711_10008594
369 Ga0207661_10027311
370 Ga0207667_10000764
371 Ga0207667_10450105
372 Ga0207677_10006176
373 Ga0207702_10001773
374 Ga0207702_10046244
375 Ga0207641_10008902
376 Ga0207648_10094483
377 Ga0207676_10020909
378 Ga0209588_1001913
379 Ga0209588_1009496
380 Ga0209588_1021956
381 Ga0209588_1024823
382 Ga0209588_1024908
383 Ga0265356_1000001
384 Ga0265355_1001820
385 Ga0265338_10033726
386 Ga0265762_1002788
387 Ga0265770_1005875
388 Ga0265760_10000638
389 Ga0265760_10002556
390 Ga0265760_10002668
391 Ga0265760_10016359
392 Ga0265760_10032776
393 Ga0265325_10007094
394 Ga0265316_10166887
395 Ga0436363_1080184
396 Ga0466967_0248911
397 Ga0495580_0094268
398 Ga0495674_0206832
399 Ga0496102_0193629
400 Ga0496105_0197524
401 Ga0496106_0006560
402 Ga0496107_0055758
403 Ga0496112_0332095
404 nmdc:mga05p37_61430_c2
405 nmdc:mga06r32_200025_c1
406 nmdc:mga0n895_11835_c1
407 nmdc:mga0n895_18186_c1
408 nmdc:mga0rr50_2608_c1
409 nmdc:mga0rr50_41124_c1
410 nmdc:mga0rr50_42888_c1
411 nmdc:mga0rr50_92685_c1
412 nmdc:mga08x19_200060_c1
413 nmdc:mga08x19_5547_c1
414 nmdc:mga08x19_59329_c1
415 nmdc:mga08x19_73458_c1
416 nmdc:mga0a205_21330_c1
417 nmdc:mga0a205_3815_c1
418 nmdc:mga0a205_82706_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

61

323

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.921 6 284
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8964 6 284
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8792 22 288
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8661 16 287
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8621 15 287
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9324 20 290 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9021 17 288 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8915 15 290 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8851 86 287 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.884 15 287 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2T3GUP6-F1-model_v4 Oxidoreductase 0.9409 6 288 GO:0004033
GO:0005737
AF-A0A0F5FNG7-F1-model_v4 Oxidoreductase 0.9408 6 291 GO:0004033
GO:0005737
AF-J2L1S2-F1-model_v4 Putative oxidoreductase, aryl-alcohol dehydrogenase like protein 0.9404 8 288 GO:0004033
GO:0005737
AF-A0A3C0BVS3-F1-model_v4 Oxidoreductase 0.9402 6 290 GO:0004033
GO:0005737
AF-A0A4R2X1S9-F1-model_v4 deleted 0.9398 8 288

Map