F318444

General Info

Members Datasets Scaffolds Average Seq Length
208 129 204 310

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0000798|Ga0500651_0000798_11813_12910
Length 365
Sequence MSIACPRSAPRKTIPHHQRIVRNGLPHTAVMQKASQPGLECIPMHHALRLSADSHRGTLLPTALETIINPLVLGNEDGLSQQFAKAAPFRHVVIENFLDDSFAERLLAAFPAFEKGNSIGDDGKPSGKSTIERMKALGADYTALDSVIQSREFLEFIGKITGIDELLYDPFYLGGGTHENRHEQALQAHIDFNYHPSERWHRRLNLIVYLNPAWDEAWGGNLELFDDPYKDSKPFVRISPAMNRCVIFETTEKSWHGFDRITLPAEHGGLSRKSIALYFYTKDRPAQEVAQKHTTHYVNQQLPEHLVEGHTLSNADVGLLKDLISHRDNQLQRLYAENSNLLQAQERGLSGQLIYLLKRLYVRYR

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2884411467 Dyella sp. AD56 Isolate Rhizosphere
3 2919513703 Luteimonas sp. 3794 Isolate Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
100 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0.48
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 2.4
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000531 3300002737 Bacteria 28374
2 JGI25162J39368_1001075 3300002737 Bacteria 16659
3 JGI25154J39366_1008200 3300002738 Bacteria 1364
4 JGI25157J39369_1004164 3300002741 Bacteria 2704
5 JGI25164J39214_1000024 3300002772 Bacteria 165608
6 JGI25164J39214_1000189 3300002772 Bacteria 54411
7 JGI25165J46597_1000446 3300003214 Bacteria 41610
8 rootH2_10039301 3300003320 Bacteria 2642
9 rootH2_10230422 3300003320 Bacteria 1580
10 Ga0055535_1000439 3300003761 Bacteria 38440
11 Ga0055542_1000460 3300003762 Bacteria 38448
12 Ga0065715_10113917 3300005293 Bacteria 2465
13 Ga0070670_100015519 3300005331 Bacteria 6542
14 Ga0070670_100016132 3300005331 Bacteria 6412
15 Ga0070666_10004708 3300005335 Bacteria 8339
16 Ga0070682_100265852 3300005337 Bacteria 1244
17 Ga0068868_100273780 3300005338 Bacteria 1427
18 Ga0070691_10139964 3300005341 Bacteria 1232
19 Ga0070661_100078925 3300005344 Bacteria 2428
20 Ga0070661_100198787 3300005344 Bacteria 1531
21 Ga0070668_100100666 3300005347 Bacteria 2289
22 Ga0070671_100325088 3300005355 Bacteria 1311
23 Ga0070673_100121355 3300005364 Bacteria 2181
24 Ga0070688_100115190 3300005365 Bacteria 1793
25 Ga0070659_100056272 3300005366 Bacteria 3101
26 Ga0070667_100182887 3300005367 Bacteria 1854
27 Ga0070714_100008466 3300005435 Bacteria 8033
28 Ga0070663_100004616 3300005455 Bacteria 8111
29 Ga0070663_100033586 3300005455 Bacteria 3545
30 Ga0070662_100042569 3300005457 Bacteria 3244
31 Ga0068867_100280855 3300005459 Bacteria 1365
32 Ga0070685_10000500 3300005466 Bacteria 22705
33 Ga0070685_10003419 3300005466 Bacteria 8074
34 Ga0070665_100000540 3300005548 Bacteria 53280
35 Ga0070665_100001103 3300005548 Bacteria 33310
36 Ga0068854_100043885 3300005578 Bacteria 3171
37 Ga0068854_100146952 3300005578 Bacteria 1814
38 Ga0068856_100000116 3300005614 Bacteria 79220
39 Ga0068856_100334027 3300005614 Bacteria 1533
40 Ga0068852_100022739 3300005616 Bacteria 5033
41 Ga0068861_100014601 3300005719 Bacteria 5514
42 Ga0068851_10000416 3300005834 Bacteria 19112
43 Ga0068851_10002712 3300005834 Bacteria 7800
44 Ga0068863_100174841 3300005841 Bacteria 2060
45 Ga0068858_100001311 3300005842 Bacteria 25694
46 Ga0068858_100004233 3300005842 Bacteria 14122
47 Ga0081455_10289635 3300005937 Bacteria 1179
48 Ga0081540_1000647 3300005983 Bacteria 32945
49 Ga0075364_10070939 3300006051 Bacteria 2294
50 Ga0075364_10301926 3300006051 Bacteria 1090
51 Ga0097621_100082590 3300006237 Bacteria 2676
52 Ga0068865_100199442 3300006881 Bacteria 1553
53 Ga0105240_10001308 3300009093 Bacteria 42956
54 Ga0105240_10009851 3300009093 Bacteria 13488
55 Ga0105240_10010576 3300009093 Bacteria 12963
56 Ga0105240_10016222 3300009093 Bacteria 10095
57 Ga0105240_10092628 3300009093 Bacteria 3690
58 Ga0105241_10045710 3300009174 Bacteria 3324
59 Ga0105241_10068782 3300009174 Bacteria 2744
60 Ga0105241_10087935 3300009174 Bacteria 2446
61 Ga0105241_10186241 3300009174 Bacteria 1725
62 Ga0105237_10000105 3300009545 Bacteria 118218
63 Ga0105237_10025652 3300009545 Bacteria 6025
64 Ga0105237_10026484 3300009545 Bacteria 5927
65 Ga0105238_10002019 3300009551 Bacteria 20484
66 Ga0105238_10003774 3300009551 Bacteria 15055
67 Ga0105238_10108680 3300009551 Bacteria 2755
68 Ga0105238_10185525 3300009551 Bacteria 2056
69 Ga0105238_10235338 3300009551 Bacteria 1809
70 Ga0105249_10000876 3300009553 Bacteria 26735
71 Ga0105249_10018451 3300009553 Bacteria 6207
72 Ga0105239_10045282 3300010375 Bacteria 4822
73 Ga0105239_10045302 3300010375 Bacteria 4821
74 Ga0105239_10049472 3300010375 Bacteria 4609
75 Ga0157370_10122416 3300013104 Bacteria 2429
76 Ga0157369_10137139 3300013105 Bacteria 2590
77 Ga0157374_10370548 3300013296 Bacteria 1425
78 Ga0157372_10060733 3300013307 Bacteria 4230
79 Ga0157372_10097923 3300013307 Bacteria 3346
80 Ga0157372_10127802 3300013307 Bacteria 2922
81 Ga0163163_10116871 3300014325 Bacteria 2698
82 Ga0157379_10003492 3300014968 Bacteria 13320
83 Ga0157376_10063348 3300014969 Bacteria 3114
84 Ga0157376_10068173 3300014969 Bacteria 3012
85 Ga0163161_10004052 3300017792 Bacteria 10245
86 Ga0163161_10054929 3300017792 Bacteria 2891
87 Ga0206353_10794876 3300020082 Bacteria 5781
88 Ga0209672_100320 3300025228 Bacteria 31383
89 Ga0209672_100858 3300025228 Bacteria 13915
90 Ga0207427_100050 3300025231 Bacteria 227233
91 Ga0207427_100058 3300025231 Bacteria 192979
92 Ga0209437_100120 3300025233 Bacteria 205054
93 Ga0209437_100142 3300025233 Bacteria 165628
94 Ga0209258_100503 3300025242 Bacteria 38473
95 Ga0209646_1001212 3300025246 Bacteria 7389
96 Ga0209026_1000111 3300025250 Bacteria 140599
97 Ga0209026_1005390 3300025250 Bacteria 3457
98 Ga0209148_1000517 3300025254 Bacteria 38502
99 Ga0209233_1000141 3300025261 Bacteria 192978
100 Ga0209233_1000174 3300025261 Bacteria 144639
101 Ga0209233_1000184 3300025261 Bacteria 134246
102 Ga0209455_1000211 3300025272 Bacteria 82660
103 Ga0209455_1002305 3300025272 Bacteria 7491
104 Ga0207680_10002883 3300025903 Bacteria 8060
105 Ga0207680_10003002 3300025903 Bacteria 7911
106 Ga0207647_10000382 3300025904 Bacteria 36037
107 Ga0207647_10002522 3300025904 Bacteria 13863
108 Ga0207654_10089354 3300025911 Bacteria 1874
109 Ga0207654_10092287 3300025911 Bacteria 1849
110 Ga0207654_10233913 3300025911 Unclassified 1225
111 Ga0207695_10000219 3300025913 Bacteria 153492
112 Ga0207695_10004519 3300025913 Bacteria 18929
113 Ga0207695_10007278 3300025913 Bacteria 14135
114 Ga0207695_10008846 3300025913 Bacteria 12537
115 Ga0207695_10081783 3300025913 Bacteria 3268
116 Ga0207695_10087632 3300025913 Bacteria 3135
117 Ga0207695_10129062 3300025913 Bacteria 2487
118 Ga0207671_10000292 3300025914 Bacteria 73798
119 Ga0207671_10006880 3300025914 Bacteria 10034
120 Ga0207671_10034650 3300025914 Bacteria 3750
121 Ga0207671_10048260 3300025914 Bacteria 3152
122 Ga0207671_10067153 3300025914 Unclassified 2670
123 Ga0207671_10214767 3300025914 Bacteria 1506
124 Ga0207694_10001538 3300025924 Bacteria 19612
125 Ga0207694_10002469 3300025924 Bacteria 15054
126 Ga0207694_10009258 3300025924 Bacteria 7432
127 Ga0207694_10024011 3300025924 Bacteria 4630
128 Ga0207694_10041425 3300025924 Bacteria 3549
129 Ga0207650_10016056 3300025925 Bacteria 5226
130 Ga0207650_10034950 3300025925 Bacteria 3647
131 Ga0207664_10039893 3300025929 Bacteria 3646
132 Ga0207644_10176076 3300025931 Bacteria 1674
133 Ga0207706_10006438 3300025933 Bacteria 10905
134 Ga0207706_10064536 3300025933 Bacteria 3224
135 Ga0207689_10061471 3300025942 Bacteria 3089
136 Ga0207667_10343647 3300025949 Bacteria 1522
137 Ga0207712_10000091 3300025961 Bacteria 103955
138 Ga0207712_10000332 3300025961 Bacteria 43130
139 Ga0207668_10020865 3300025972 Bacteria 4171
140 Ga0207640_10008347 3300025981 Bacteria 5753
141 Ga0207658_10040985 3300025986 Bacteria 3350
142 Ga0207677_10051498 3300026023 Bacteria 2792
143 Ga0207677_10145790 3300026023 Bacteria 1819
144 Ga0207703_10004046 3300026035 Bacteria 12111
145 Ga0207703_10005509 3300026035 Bacteria 10173
146 Ga0207639_10000164 3300026041 Bacteria 51171
147 Ga0207639_10009896 3300026041 Bacteria 6586
148 Ga0207678_10013373 3300026067 Bacteria 7202
149 Ga0207678_10112322 3300026067 Bacteria 2324
150 Ga0207702_10000170 3300026078 Bacteria 77504
151 Ga0207702_10076280 3300026078 Bacteria 2897
152 Ga0207702_10132761 3300026078 Bacteria 2242
153 Ga0207676_10242127 3300026095 Bacteria 1619
154 Ga0207674_10304886 3300026116 Bacteria 1542
155 Ga0207675_100064235 3300026118 Bacteria 3431
156 Ga0207675_100306670 3300026118 Bacteria 1547
157 Ga0207683_10044054 3300026121 Bacteria 3900
158 Ga0207698_10011826 3300026142 Bacteria 5680
159 Ga0268266_10000007 3300028379 Bacteria 1372921
160 Ga0307411_10113486 3300032005 Bacteria 1944
161 Ga0436365_1242278 3300039437 Bacteria 1863
162 Ga0439436_0018512 3300041404 Bacteria 2082
163 Ga0439432_050681 3300042006 Bacteria 1295
164 Ga0439449_0030484 3300042007 Bacteria 2010
165 Ga0450908_000002 3300042184 Bacteria 94473
166 Ga0466982_0000024 3300044672 Bacteria 76608
167 Ga0466966_0010726 3300044684 Bacteria 6091
168 Ga0466959_0032921 3300045049 Bacteria 3836
169 Ga0466967_0252262 3300045976 Bacteria 1686
170 Ga0495617_000040 3300046452 Bacteria 126637
171 Ga0495650_0000242 3300046471 Bacteria 108533
172 Ga0495607_0061963 3300046501 Bacteria 2123
173 Ga0495606_0000902 3300046507 Bacteria 44174
174 Ga0495606_0005113 3300046507 Bacteria 12741
175 Ga0495620_0000348 3300046515 Bacteria 32030
176 Ga0495625_0039729 3300046660 Bacteria 3434
177 Ga0495686_0000050 3300047472 Bacteria 269010
178 Ga0495686_0000297 3300047472 Bacteria 85762
179 Ga0496100_0011187 3300048903 Bacteria 5101
180 Ga0496101_0008932 3300048904 Bacteria 6568
181 Ga0496106_0000097 3300048909 Bacteria 66262
182 Ga0496115_0000002 3300048918 Bacteria 365286
183 Ga0496115_0006548 3300048918 Bacteria 8537
184 Ga0496117_0059668 3300048920 Bacteria 2633
185 Ga0496118_0000254 3300048921 Bacteria 94241
186 Ga0496118_0004496 3300048921 Bacteria 16495
187 Ga0496118_0011229 3300048921 Bacteria 8769
188 Ga0496118_0190912 3300048921 Bacteria 1225
189 Ga0496121_0059278 3300048924 Bacteria 3157
190 Ga0496123_0022451 3300048926 Bacteria 4863
191 Ga0496126_0000052 3300048929 Bacteria 312383
192 Ga0501034_0053598 3300049571 Bacteria 4061
193 Ga0501034_0070428 3300049571 Bacteria 3508
194 Ga0501036_0075058 3300049572 Bacteria 2860
195 Ga0501037_0100829 3300049573 Bacteria 2084
196 Ga0501037_0144809 3300049573 Bacteria 1700
197 Ga0501039_0228651 3300049575 Bacteria 1462
198 Ga0501047_0006972 3300049581 Bacteria 10609
199 Ga0501035_0033227 3300049822 Bacteria 4691
200 Ga0501035_0035024 3300049822 Bacteria 4560
201 Ga0501044_0037246 3300049823 Bacteria 5085
202 nmdc:mga00v17_71704_c1 3300050491 Bacteria 2148
203 Ga0500651_0000798 3300053093 Bacteria 15409
204 Ga0500568_0000278 3300053139 Bacteria 42699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10242127 Ga0207676_102421273 255
2 3300046471 Ga0495650_0000242 Ga0495650_0000242_77674_78705 280
3 3300049571 Ga0501034_0070428 Ga0501034_0070428_2276_3178 294
4 3300049573 Ga0501037_0144809 Ga0501037_0144809_556_1458 294
5 3300049575 Ga0501039_0228651 Ga0501039_0228651_275_1177 294
6 3300049822 Ga0501035_0035024 Ga0501035_0035024_641_1543 294
7 3300049823 Ga0501044_0037246 Ga0501044_0037246_3048_3950 294
8 3300014969 Ga0157376_10068173 Ga0157376_100681732 295
9 3300046501 Ga0495607_0061963 Ga0495607_0061963_412_1347 298
10 3300005364 Ga0070673_100121355 Ga0070673_1001213552 300
11 3300005366 Ga0070659_100056272 Ga0070659_1000562722 300
12 3300025942 Ga0207689_10061471 Ga0207689_100614712 300
13 3300026023 Ga0207677_10051498 Ga0207677_100514982 300
14 3300026118 Ga0207675_100306670 Ga0207675_1003066702 300
15 3300026121 Ga0207683_10044054 Ga0207683_100440544 300
16 iso_pu_bacteria 2884411467 2884411587 302
17 3300005331 Ga0070670_100015519 Ga0070670_1000155192 303
18 3300005338 Ga0068868_100273780 Ga0068868_1002737802 303
19 3300005344 Ga0070661_100198787 Ga0070661_1001987871 303
20 3300005367 Ga0070667_100182887 Ga0070667_1001828872 303
21 3300005455 Ga0070663_100004616 Ga0070663_1000046166 303
22 3300005457 Ga0070662_100042569 Ga0070662_1000425692 303
23 3300005548 Ga0070665_100000540 Ga0070665_10000054021 303
24 3300005614 Ga0068856_100334027 Ga0068856_1003340272 303
25 3300005834 Ga0068851_10002712 Ga0068851_100027125 303
26 3300005842 Ga0068858_100004233 Ga0068858_1000042332 303
27 3300006237 Ga0097621_100082590 Ga0097621_1000825902 303
28 3300009093 Ga0105240_10009851 Ga0105240_100098512 303
29 3300009174 Ga0105241_10068782 Ga0105241_100687822 303
30 3300009174 Ga0105241_10186241 Ga0105241_101862412 303
31 3300009545 Ga0105237_10026484 Ga0105237_100264842 303
32 3300009551 Ga0105238_10003774 Ga0105238_1000377413 303
33 3300009551 Ga0105238_10108680 Ga0105238_101086802 303
34 3300009551 Ga0105238_10235338 Ga0105238_102353382 303
35 3300009553 Ga0105249_10000876 Ga0105249_100008762 303
36 3300010375 Ga0105239_10045282 Ga0105239_100452822 303
37 3300010375 Ga0105239_10049472 Ga0105239_100494723 303
38 3300013105 Ga0157369_10137139 Ga0157369_101371392 303
39 3300013307 Ga0157372_10060733 Ga0157372_100607332 303
40 3300013307 Ga0157372_10097923 Ga0157372_100979232 303
41 3300014325 Ga0163163_10116871 Ga0163163_101168712 303
42 3300025903 Ga0207680_10003002 Ga0207680_100030022 303
43 3300025904 Ga0207647_10000382 Ga0207647_1000038222 303
44 3300025911 Ga0207654_10089354 Ga0207654_100893542 303
45 3300025913 Ga0207695_10081783 Ga0207695_100817832 303
46 3300025913 Ga0207695_10087632 Ga0207695_100876322 303
47 3300025914 Ga0207671_10067153 Ga0207671_100671532 303
48 3300025914 Ga0207671_10214767 Ga0207671_102147672 303
49 3300025924 Ga0207694_10002469 Ga0207694_1000246913 303
50 3300025924 Ga0207694_10024011 Ga0207694_100240112 303
51 3300025924 Ga0207694_10041425 Ga0207694_100414253 303
52 3300025925 Ga0207650_10016056 Ga0207650_100160564 303
53 3300025933 Ga0207706_10064536 Ga0207706_100645362 303
54 3300025961 Ga0207712_10000332 Ga0207712_1000033219 303
55 3300025981 Ga0207640_10008347 Ga0207640_100083475 303
56 3300025986 Ga0207658_10040985 Ga0207658_100409852 303
57 3300026023 Ga0207677_10145790 Ga0207677_101457902 303
58 3300026035 Ga0207703_10004046 Ga0207703_100040468 303
59 3300026041 Ga0207639_10000164 Ga0207639_1000016421 303
60 3300026067 Ga0207678_10013373 Ga0207678_100133736 303
61 3300026078 Ga0207702_10076280 Ga0207702_100762802 303
62 3300028379 Ga0268266_10000007 Ga0268266_100000071115 303
63 iso_pu_bacteria 2643221577 2643895852 304
64 iso_pu_bacteria 2919513703 2919513877 304
65 3300005365 Ga0070688_100115190 Ga0070688_1001151902 305
66 3300005466 Ga0070685_10000500 Ga0070685_1000050013 305
67 3300005616 Ga0068852_100022739 Ga0068852_1000227392 305
68 3300009093 Ga0105240_10001308 Ga0105240_100013088 305
69 3300009093 Ga0105240_10010576 Ga0105240_100105763 305
70 3300009174 Ga0105241_10087935 Ga0105241_100879351 305
71 3300009545 Ga0105237_10025652 Ga0105237_100256523 305
72 3300009551 Ga0105238_10002019 Ga0105238_1000201910 305
73 3300010375 Ga0105239_10045302 Ga0105239_100453022 305
74 3300013104 Ga0157370_10122416 Ga0157370_101224163 305
75 3300013307 Ga0157372_10127802 Ga0157372_101278025 305
76 3300014968 Ga0157379_10003492 Ga0157379_100034928 305
77 3300014969 Ga0157376_10063348 Ga0157376_100633483 305
78 3300017792 Ga0163161_10004052 Ga0163161_100040527 305
79 3300025911 Ga0207654_10233913 Ga0207654_102339131 305
80 3300025913 Ga0207695_10000219 Ga0207695_10000219103 305
81 3300025913 Ga0207695_10004519 Ga0207695_1000451912 305
82 3300025914 Ga0207671_10034650 Ga0207671_100346503 305
83 3300025924 Ga0207694_10001538 Ga0207694_1000153810 305
84 3300026067 Ga0207678_10112322 Ga0207678_101123222 305
85 3300026142 Ga0207698_10011826 Ga0207698_100118265 305
86 3300032005 Ga0307411_10113486 Ga0307411_101134862 305
87 3300039437 Ga0436365_1242278 Ga0436365_1242278_24_941 305
88 3300041404 Ga0439436_0018512 Ga0439436_0018512_365_1309 305
89 3300042006 Ga0439432_050681 Ga0439432_050681_106_1050 305
90 3300042007 Ga0439449_0030484 Ga0439449_0030484_738_1682 305
91 3300042184 Ga0450908_000002 Ga0450908_000002_16232_17161 305
92 3300046452 Ga0495617_000040 Ga0495617_000040_100539_101474 305
93 3300046507 Ga0495606_0000902 Ga0495606_0000902_16187_17122 305
94 3300046507 Ga0495606_0005113 Ga0495606_0005113_822_1751 305
95 3300046515 Ga0495620_0000348 Ga0495620_0000348_7091_8026 305
96 3300046660 Ga0495625_0039729 Ga0495625_0039729_645_1580 305
97 3300047472 Ga0495686_0000050 Ga0495686_0000050_132792_133721 305
98 3300047472 Ga0495686_0000297 Ga0495686_0000297_5805_6755 305
99 3300048903 Ga0496100_0011187 Ga0496100_0011187_1356_2285 305
100 3300048904 Ga0496101_0008932 Ga0496101_0008932_4030_4959 305
101 3300048909 Ga0496106_0000097 Ga0496106_0000097_41961_42896 305
102 3300048918 Ga0496115_0000002 Ga0496115_0000002_103457_104374 305
103 3300048921 Ga0496118_0004496 Ga0496118_0004496_9194_10123 305
104 3300048921 Ga0496118_0011229 Ga0496118_0011229_1847_2764 305
105 3300048921 Ga0496118_0190912 Ga0496118_0190912_116_1045 305
106 3300048924 Ga0496121_0059278 Ga0496121_0059278_1723_2658 305
107 3300048926 Ga0496123_0022451 Ga0496123_0022451_396_1325 305
108 3300048929 Ga0496126_0000052 Ga0496126_0000052_50628_51545 305
109 3300005466 Ga0070685_10003419 Ga0070685_100034197 306
110 3300025228 Ga0209672_100858 Ga0209672_1008585 306
111 3300048918 Ga0496115_0006548 Ga0496115_0006548_1399_2319 306
112 3300053139 Ga0500568_0000278 Ga0500568_0000278_36310_37257 306
113 3300045976 Ga0466967_0252262 Ga0466967_0252262_58_981 307
114 3300049571 Ga0501034_0053598 Ga0501034_0053598_95_1018 307
115 3300049572 Ga0501036_0075058 Ga0501036_0075058_1535_2458 307
116 3300049573 Ga0501037_0100829 Ga0501037_0100829_731_1654 307
117 3300049581 Ga0501047_0006972 Ga0501047_0006972_6437_7360 307
118 3300049822 Ga0501035_0033227 Ga0501035_0033227_2097_3020 307
119 3300053093 Ga0500651_0000798 Ga0500651_0000798_11813_12910 307
120 3300002737 JGI25162J39368_1000531 JGI25162J39368_100053125 308
121 3300002737 JGI25162J39368_1001075 JGI25162J39368_10010755 308
122 3300002738 JGI25154J39366_1008200 JGI25154J39366_10082002 308
123 3300002741 JGI25157J39369_1004164 JGI25157J39369_10041643 308
124 3300002772 JGI25164J39214_1000024 JGI25164J39214_100002449 308
125 3300002772 JGI25164J39214_1000189 JGI25164J39214_100018922 308
126 3300003214 JGI25165J46597_1000446 JGI25165J46597_100044614 308
127 3300003320 rootH2_10039301 rootH2_100393012 308
128 3300003320 rootH2_10230422 rootH2_102304222 308
129 3300003761 Ga0055535_1000439 Ga0055535_10004395 308
130 3300003762 Ga0055542_1000460 Ga0055542_10004605 308
131 3300005293 Ga0065715_10113917 Ga0065715_101139171 308
132 3300005331 Ga0070670_100016132 Ga0070670_1000161325 308
133 3300005335 Ga0070666_10004708 Ga0070666_100047085 308
134 3300005337 Ga0070682_100265852 Ga0070682_1002658522 308
135 3300005341 Ga0070691_10139964 Ga0070691_101399641 308
136 3300005344 Ga0070661_100078925 Ga0070661_1000789252 308
137 3300005347 Ga0070668_100100666 Ga0070668_1001006662 308
138 3300005355 Ga0070671_100325088 Ga0070671_1003250882 308
139 3300005435 Ga0070714_100008466 Ga0070714_1000084663 308
140 3300005455 Ga0070663_100033586 Ga0070663_1000335862 308
141 3300005459 Ga0068867_100280855 Ga0068867_1002808552 308
142 3300005548 Ga0070665_100001103 Ga0070665_10000110321 308
143 3300005578 Ga0068854_100043885 Ga0068854_1000438852 308
144 3300005578 Ga0068854_100146952 Ga0068854_1001469522 308
145 3300005614 Ga0068856_100000116 Ga0068856_10000011658 308
146 3300005719 Ga0068861_100014601 Ga0068861_1000146014 308
147 3300005834 Ga0068851_10000416 Ga0068851_100004163 308
148 3300005841 Ga0068863_100174841 Ga0068863_1001748413 308
149 3300005842 Ga0068858_100001311 Ga0068858_10000131122 308
150 3300005937 Ga0081455_10289635 Ga0081455_102896352 308
151 3300005983 Ga0081540_1000647 Ga0081540_100064715 308
152 3300006051 Ga0075364_10070939 Ga0075364_100709392 308
153 3300006051 Ga0075364_10301926 Ga0075364_103019262 308
154 3300006881 Ga0068865_100199442 Ga0068865_1001994422 308
155 3300009093 Ga0105240_10016222 Ga0105240_100162228 308
156 3300009093 Ga0105240_10092628 Ga0105240_100926283 308
157 3300009174 Ga0105241_10045710 Ga0105241_100457102 308
158 3300009545 Ga0105237_10000105 Ga0105237_1000010552 308
159 3300009551 Ga0105238_10185525 Ga0105238_101855252 308
160 3300009553 Ga0105249_10018451 Ga0105249_100184515 308
161 3300013296 Ga0157374_10370548 Ga0157374_103705482 308
162 3300017792 Ga0163161_10054929 Ga0163161_100549292 308
163 3300020082 Ga0206353_10794876 Ga0206353_107948767 308
164 3300025228 Ga0209672_100320 Ga0209672_10032027 308
165 3300025231 Ga0207427_100050 Ga0207427_100050278 308
166 3300025231 Ga0207427_100058 Ga0207427_100058144 308
167 3300025233 Ga0209437_100120 Ga0209437_10012063 308
168 3300025233 Ga0209437_100142 Ga0209437_10014248 308
169 3300025242 Ga0209258_100503 Ga0209258_1005035 308
170 3300025246 Ga0209646_1001212 Ga0209646_10012124 308
171 3300025250 Ga0209026_1000111 Ga0209026_100011163 308
172 3300025250 Ga0209026_1005390 Ga0209026_10053904 308
173 3300025254 Ga0209148_1000517 Ga0209148_10005175 308
174 3300025261 Ga0209233_1000141 Ga0209233_1000141144 308
175 3300025261 Ga0209233_1000174 Ga0209233_1000174107 308
176 3300025261 Ga0209233_1000184 Ga0209233_100018499 308
177 3300025272 Ga0209455_1000211 Ga0209455_100021150 308
178 3300025272 Ga0209455_1002305 Ga0209455_10023055 308
179 3300025903 Ga0207680_10002883 Ga0207680_100028833 308
180 3300025904 Ga0207647_10002522 Ga0207647_100025227 308
181 3300025911 Ga0207654_10092287 Ga0207654_100922872 308
182 3300025913 Ga0207695_10007278 Ga0207695_100072785 308
183 3300025913 Ga0207695_10008846 Ga0207695_100088464 308
184 3300025913 Ga0207695_10129062 Ga0207695_101290622 308
185 3300025914 Ga0207671_10000292 Ga0207671_1000029240 308
186 3300025914 Ga0207671_10006880 Ga0207671_100068809 308
187 3300025914 Ga0207671_10048260 Ga0207671_100482603 308
188 3300025924 Ga0207694_10009258 Ga0207694_100092583 308
189 3300025925 Ga0207650_10034950 Ga0207650_100349502 308
190 3300025929 Ga0207664_10039893 Ga0207664_100398932 308
191 3300025931 Ga0207644_10176076 Ga0207644_101760762 308
192 3300025933 Ga0207706_10006438 Ga0207706_100064387 308
193 3300025949 Ga0207667_10343647 Ga0207667_103436472 308
194 3300025961 Ga0207712_10000091 Ga0207712_1000009152 308
195 3300025972 Ga0207668_10020865 Ga0207668_100208655 308
196 3300026035 Ga0207703_10005509 Ga0207703_100055093 308
197 3300026041 Ga0207639_10009896 Ga0207639_100098964 308
198 3300026078 Ga0207702_10000170 Ga0207702_1000017036 308
199 3300026078 Ga0207702_10132761 Ga0207702_101327612 308
200 3300026116 Ga0207674_10304886 Ga0207674_103048863 308
201 3300026118 Ga0207675_100064235 Ga0207675_1000642352 308
202 3300028379 Ga0268266_10000007 Ga0268266_10000007451 308
203 3300044672 Ga0466982_0000024 Ga0466982_0000024_48675_49640 308
204 3300044684 Ga0466966_0010726 Ga0466966_0010726_3406_4332 308
205 3300045049 Ga0466959_0032921 Ga0466959_0032921_2379_3305 308
206 3300048920 Ga0496117_0059668 Ga0496117_0059668_861_1787 308
207 3300048921 Ga0496118_0000254 Ga0496118_0000254_70073_70999 308
208 3300050491 nmdc:mga00v17_71704_c1 nmdc:mga00v17_71704_c1_324_1250 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

176

280

0.9

PF13661

2OG-FeII_Oxy_4

2OG-Fe(II) oxygenase superfamily

177

280

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qgv-assembly1.cif.gz_A hif prolyl hydroxylase 2 (phd2/ egln1) in complex with a spiro[4.5]decanone inhibitor (jphm-2-167) 0.7679 14 223
4qm9-assembly2.cif.gz_B crystal structure of a putative cysteine dioxygenase from bacillus subtilis with cys-bound 0.755 119 221
3mgu-assembly1.cif.gz_A-2 structure of s. cerevisiae tpa1 protein, a proline hydroxylase modifying ribosomal protein rps23 0.7519 5 230
6zbo-assembly4.cif.gz_D hif prolyl hydroxylase 2 (phd2/egln1) in complex with 1-(6-morpholinopyrimidin-4-yl)-4-(1h-1,2,3-triazol-1-yl)-1h-pyrazol-5-ol (molidustat) 0.7426 14 223
1e5s-assembly1.cif.gz_A proline 3-hydroxylase (type ii) - iron form 0.7406 119 229
ID Description Score Start End Superfamily
af_Q09973_31_246_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7435 10 227 2.60.120.620
af_Q10SL2_56_251_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7401 119 218 2.60.120.620
1e5sA01 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.7355 119 229 2.60.120.330
af_D4ACB4_24_245_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.735 30 227 2.60.120.620
4nhyC02 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7318 9 222 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A7Y3H834-F1-model_v4 2OG-Fe(II) oxygenase 0.9645 6 220
AF-A0A7X2PV66-F1-model_v4 Uncharacterized protein 0.9602 8 126
AF-A0A7X4ALD4-F1-model_v4 2OG-Fe(II) oxygenase 0.9547 9 143
AF-A0A363RXA4-F1-model_v4 deleted 0.9435 93 307
AF-A0A7X4ALD4-F1-model_v4 2OG-Fe(II) oxygenase 0.9412 9 143

Feature Viewer

pLDDT pTM Quality
88.37 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map