F318136

General Info

Members Datasets Scaffolds Average Seq Length
208 132 416 307

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0236386|Ga0451841_0236386_1372_2472
Length 366
Sequence MDFGALKPLLGRVYPAKGVCSRFGLEWNIPMNPESHLNFGWTVQDLSPIDGVMKSSLDHIPLRKQREIGRVLEILHEEFEDALKDGTAEFKKRGRILKIILFGSYAKGGWVDEPFTMKGYRSDFDLLIIVNNRKLCEFAEYWHKAADRLIHDKSIETPVSFIVHSRREVNTYLKKGQYFFSDIRKEGIVLYELDAEPLAEPEPLSSEDRLRIAKEHYEDRLTLSRSFLKIAISCVSEKELRVAAFQLHQALEQAYSCVLLTLTNYGPPSHNIRFLRSLAEEQDRRLAEAFPRDQHRERAWFNTLNEAYVKARYSKHFEISEEALGWLAEQTALLLELVKMVCEGHLETLRGIVGSDKIKRDSLSCG

Samples

Sample ID Description Type Environment
1 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
19 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
20 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
21 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
22 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
23 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
24 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
25 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
34 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
35 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
36 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
37 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
38 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
39 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
40 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
41 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
45 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
46 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
49 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
50 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
51 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
52 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
53 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
54 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
55 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
56 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
57 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
58 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
59 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
60 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
61 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
62 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
63 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
64 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
65 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
66 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
67 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
68 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
69 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
70 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
71 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
72 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
73 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
74 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
75 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
76 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
77 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
78 2519899620 Rhizobium sp. Pop5 Isolate Nodule
79 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
80 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
81 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
82 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
83 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
84 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
85 2791355261 Rhizobium sp. J15 Isolate Nodule
86 2791355262 Rhizobium sp. M1 Isolate Nodule
87 2791355264 Rhizobium sp. S9 Isolate Nodule
88 2791355265 Rhizobium sp. H4 Isolate Nodule
89 2802429633 Rhizobium anhuiense J3 Isolate Nodule
90 2802429634 Rhizobium anhuiense S10 Isolate Nodule
91 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
92 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
93 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
94 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
95 2838061910 Rhizobium phaseoli L15 Isolate Nodule
96 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
97 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
98 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
99 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
100 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
101 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
102 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
103 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
104 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
105 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
106 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
107 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
108 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
109 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
110 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
111 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
112 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
113 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
114 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
115 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
116 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
117 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
118 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
119 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
120 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
121 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
122 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
123 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
124 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
125 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
126 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
127 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
128 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
129 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
130 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
131 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
132 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.77
Metatranscriptomes 0.96
Isolates 43.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.21
Nodule 41.35
Rhizoplane 0
Rhizosphere 8.65
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451841_0236386 3300041498 Bacteria 2537
2 JGI25155J39150_1000044 3300002704 Bacteria 86149
3 JGI25156J39149_1000058 3300002705 Bacteria 86233
4 JGI25154J39366_1000174 3300002738 Bacteria 49957
5 JGI25157J39369_1000078 3300002741 Bacteria 86233
6 JGI25151J46595_10056348 3300003187 Bacteria 1289
7 JGI25153J46596_10002963 3300003215 Bacteria 9618
8 JGI25153J46596_10006905 3300003215 Bacteria 5666
9 JGI25160J50197_1001659 3300003354 Bacteria 10882
10 JGI25160J50197_1024063 3300003354 Bacteria 1737
11 Ga0055526_1006886 3300003771 Bacteria 6056
12 Ga0055524_1004921 3300003775 Bacteria 6058
13 Ga0055528_1004882 3300003790 Bacteria 6347
14 Ga0055528_1016917 3300003790 Bacteria 2552
15 Ga0055543_1000625 3300004625 Bacteria 19011
16 Ga0065165_1004851 3300005262 Bacteria 7993
17 Ga0075365_10007081 3300006038 Bacteria 6250
18 Ga0075364_10185243 3300006051 Bacteria 1409
19 Ga0075362_10048319 3300006177 Bacteria 1898
20 Ga0075370_10051325 3300006353 Bacteria 2339
21 Ga0123341_1002262 3300009765 Bacteria 15665
22 Ga0123342_1031914 3300009766 Bacteria 2510
23 Ga0209435_100054 3300025206 Bacteria 86285
24 Ga0207425_1002013 3300025245 Bacteria 7573
25 Ga0209646_1000170 3300025246 Bacteria 86285
26 Ga0209026_1000193 3300025250 Bacteria 86285
27 Ga0209759_1000222 3300025256 Bacteria 86285
28 Ga0209129_1004336 3300025258 Bacteria 5596
29 Ga0209129_1005748 3300025258 Bacteria 4257
30 Ga0209673_1000967 3300025273 Bacteria 35634
31 Ga0209673_1001681 3300025273 Bacteria 18889
32 Ga0209673_1019779 3300025273 Bacteria 2406
33 Ga0209025_1000260 3300025294 Bacteria 124240
34 Ga0209025_1073820 3300025294 Bacteria 1194
35 Ga0209564_1003630 3300025295 Bacteria 10254
36 Ga0209564_1007614 3300025295 Bacteria 5549
37 Ga0209758_1000076 3300025297 Bacteria 270615
38 Ga0209758_1001982 3300025297 Bacteria 22133
39 Ga0209758_1002450 3300025297 Bacteria 18942
40 Ga0209758_1005092 3300025297 Bacteria 10406
41 Ga0209758_1049124 3300025297 Bacteria 1492
42 Ga0209256_1006484 3300025299 Bacteria 6162
43 Ga0209256_1013010 3300025299 Bacteria 3122
44 Ga0209256_1015150 3300025299 Bacteria 2717
45 Ga0209256_1015308 3300025299 Bacteria 2691
46 Ga0209256_1041390 3300025299 Bacteria 1171
47 Ga0207426_1000298 3300025302 Bacteria 97889
48 Ga0207426_1001199 3300025302 Bacteria 23041
49 Ga0209051_1009268 3300025303 Bacteria 5089
50 Ga0209051_1015378 3300025303 Bacteria 3521
51 Ga0209051_1018758 3300025303 Bacteria 3047
52 Ga0451833_0090118 3300041491 Bacteria 1525
53 Ga0451833_0865740 3300041491 Bacteria 1706
54 Ga0451835_0381003 3300041492 Bacteria 6374
55 Ga0451837_0677695 3300041494 Bacteria 3868
56 Ga0451839_0105420 3300041496 Bacteria 2309
57 Ga0451845_0431471 3300041501 Bacteria 13909
58 Ga0451845_0499825 3300041501 Bacteria 2112
59 Ga0451851_0389277 3300041507 Bacteria 2665
60 Ga0451851_1093736 3300041507 Bacteria 2182
61 Ga0451843_1760447 3300041509 Bacteria 2257
62 Ga0451853_1034206 3300041512 Bacteria 3134
63 Ga0451853_2098215 3300041512 Bacteria 1797
64 Ga0452268_15625 3300041907 Bacteria 1641
65 Ga0452268_35953 3300041907 Bacteria 1005
66 Ga0466970_0000568 3300044765 Bacteria 18086
67 Ga0495638_0000175 3300046460 Bacteria 100036
68 Ga0495638_0000634 3300046460 Bacteria 38683
69 Ga0495606_0042867 3300046507 Bacteria 3023
70 Ga0495610_0011616 3300046512 Bacteria 5368
71 Ga0495610_0056821 3300046512 Bacteria 1880
72 Ga0495620_0027206 3300046515 Bacteria 2679
73 Ga0495620_0028111 3300046515 Bacteria 2620
74 Ga0495643_0005332 3300046522 Bacteria 8713
75 Ga0495643_0020313 3300046522 Bacteria 3830
76 Ga0495643_0028074 3300046522 Bacteria 3158
77 Ga0495654_0000140 3300046530 Bacteria 75508
78 Ga0495597_0103573 3300046542 Bacteria 1198
79 Ga0495649_0153994 3300046694 Bacteria 1207
80 Ga0495660_0059566 3300046810 Bacteria 2053
81 Ga0495660_0072116 3300046810 Bacteria 1830
82 Ga0495686_0103734 3300047472 Bacteria 1713
83 Ga0496118_0004743 3300048921 Bacteria 15912
84 Ga0496121_0000235 3300048924 Bacteria 118983
85 Ga0496122_0000870 3300048925 Bacteria 56865
86 Ga0496123_0000664 3300048926 Bacteria 56865
87 Ga0496124_0026531 3300048927 Bacteria 5220
88 Ga0496125_0000417 3300048928 Bacteria 79282
89 Ga0496125_0192443 3300048928 Bacteria 1345
90 Ga0496126_0117181 3300048929 Bacteria 2314
91 Ga0496126_0254630 3300048929 Bacteria 1462
92 nmdc:mga03683_121443_c1 3300050489 Bacteria 1162
93 nmdc:mga00v17_47789_c1 3300050491 Bacteria 2592
94 nmdc:mga0yw44_1339_c1 3300050492 Bacteria 7783
95 nmdc:mga0k408_19439_c1 3300050493 Bacteria 3797
96 nmdc:mga0k408_49983_c1 3300050493 Bacteria 1997
97 nmdc:mga07m45_82503_c1 3300050496 Bacteria 1836
98 Ga0500578_0018598 3300053086 Bacteria 4463
99 Ga0500578_0026058 3300053086 Bacteria 3752
100 Ga0500578_0030624 3300053086 Bacteria 3458
101 Ga0500578_0052486 3300053086 Bacteria 2611
102 Ga0500557_000395 3300053105 Bacteria 5706
103 Ga0500569_002468 3300053109 Bacteria 3647
104 Ga0500569_039446 3300053109 Bacteria 1375
105 Ga0500658_0000065 3300053134 Bacteria 49371
106 Ga0500658_0000534 3300053134 Bacteria 16049
107 Ga0500658_0000629 3300053134 Bacteria 14603
108 Ga0500658_0006571 3300053134 Bacteria 4313
109 Ga0500568_0000092 3300053139 Bacteria 84471
110 Ga0500616_0001138 3300053153 Bacteria 27357
111 Ga0500616_0001531 3300053153 Bacteria 21753
112 Ga0500616_0015937 3300053153 Bacteria 4288
113 Ga0500616_0048256 3300053153 Bacteria 2257
114 Ga0500616_0050136 3300053153 Bacteria 2205
115 Ga0500616_0077490 3300053153 Bacteria 1678
116 Ga0500616_0112116 3300053153 Unclassified 1316
117 Ga0500622_0138230 3300053156 Bacteria 1165
118 Ga0500636_0022829 3300053177 Bacteria 3697
119 2509385914 2509276021 Bacteria 7634384
120 2509441449 2509276033 Bacteria 7180565
121 2509443981 2509276033 Bacteria 7180565
122 2509448525 2509276033 Bacteria 7180565
123 2511175146 2510917026 Bacteria 7046020
124 2513580208 2513237085 Bacteria 7695351
125 2517079892 2516653085 Bacteria 7346596
126 2517080991 2516653085 Bacteria 7346596
127 2520377797 2519899620 Bacteria 6499161
128 2586003715 2585427634 Bacteria 6455027
129 2586003940 2585427634 Bacteria 6455027
130 2586004174 2585427634 Bacteria 6455027
131 2616294129 2615840624 Bacteria 6557588
132 2616297124 2615840624 Bacteria 6557588
133 2720618569 2718218233 Bacteria 6662049
134 2739034441 2738541333 Bacteria 7106503
135 2766066561 2765235942 Bacteria 7445910
136 2793315428 2791355259 Bacteria 7254731
137 2793328638 2791355261 Bacteria 6661293
138 2793334222 2791355262 Bacteria 6774204
139 2793345209 2791355264 Bacteria 6429314
140 2793354084 2791355265 Bacteria 6539969
141 2806043241 2802429633 Bacteria 7341974
142 2806051193 2802429634 Bacteria 7083200
143 2806054957 2802429634 Bacteria 7083200
144 2806057635 2802429635 Bacteria 7650140
145 2806062141 2802429635 Bacteria 7650140
146 2806065647 2802429636 Bacteria 7597525
147 2819688935 2818991461 Bacteria 7026071
148 2838028172 2838022645 Bacteria 6494267
149 2838068433 2838061910 Bacteria 6794874
150 2838669207 2838668709 Bacteria 6671819
151 2838672390 2838668709 Bacteria 6671819
152 2838687752 2838686498 Bacteria 7807632
153 2838691579 2838686498 Bacteria 7807632
154 2838701132 2838701080 Bacteria 6669771
155 2838703868 2838701080 Bacteria 6669771
156 2838735639 2838729681 Bacteria 7400765
157 2838748541 2838742623 Bacteria 7396178
158 2841854299 2841851746 Bacteria 7532261
159 2841856139 2841851746 Bacteria 7532261
160 2841858842 2841851746 Bacteria 7532261
161 2842146803 2842146304 Bacteria 5957337
162 2842148340 2842146304 Bacteria 5957337
163 2842183098 2842180545 Bacteria 6888678
164 2842192889 2842192696 Bacteria 6147454
165 2842193814 2842192696 Bacteria 6147454
166 2842205165 2842198810 Bacteria 6608673
167 2842232809 2842229732 Bacteria 7475766
168 2842235297 2842229732 Bacteria 7475766
169 2842246948 2842243621 Bacteria 7421798
170 2842248247 2842243621 Bacteria 7421798
171 2842250498 2842243621 Bacteria 7421798
172 2842250967 2842250916 Bacteria 6579627
173 2842253406 2842250916 Bacteria 6579627
174 2842259366 2842257432 Bacteria 7401195
175 2842272216 2842271015 Bacteria 7807131
176 2842276552 2842271015 Bacteria 7807131
177 2842286841 2842285085 Bacteria 6011953
178 2842289292 2842285085 Bacteria 6011953
179 2842306498 2842304105 Bacteria 7023636
180 2842309628 2842304105 Bacteria 7023636
181 2842310792 2842304105 Bacteria 7023636
182 2842312616 2842311132 Bacteria 6616990
183 2842322517 2842317721 Bacteria 6793725
184 2842403606 2842402390 Bacteria 6681310
185 2842407498 2842402390 Bacteria 6681310
186 2842410692 2842409023 Bacteria 6687331
187 2842413253 2842409023 Bacteria 6687331
188 2842417338 2842415677 Bacteria 6596907
189 2842419896 2842415677 Bacteria 6596907
190 2842450189 2842447887 Bacteria 6754142
191 2842499028 2842495871 Bacteria 6820686
192 2844455988 2844454524 Bacteria 7952546
193 2844460747 2844454524 Bacteria 7952546
194 2844461160 2844454524 Bacteria 7952546
195 2852390294 2852387548 Bacteria 8025568
196 2933573567 2933570622 Bacteria 7023390
197 2933576072 2933570622 Bacteria 7023390
198 2933577286 2933570622 Bacteria 7023390
199 2936374095 2936367885 Bacteria 7324495
200 2936375387 2936375103 Bacteria 6652732
201 2989781497 2989776772 Bacteria 4843317
202 639646650 639633055 Bacteria 7751309
203 8005301557 8005301065 Bacteria 6614431
204 8005380090 8005376324 Bacteria 6590079
205 8005565221 8005563573 Bacteria 7153261
206 8023684215 8023680758 Bacteria 7729763
207 8024484738 8024479707 Bacteria 6954785
208 8057876051 8057874678 Bacteria 7494653
209 Ga0451841_0236386
210 JGI25155J39150_1000044
211 JGI25156J39149_1000058
212 JGI25154J39366_1000174
213 JGI25157J39369_1000078
214 JGI25151J46595_10056348
215 JGI25153J46596_10002963
216 JGI25153J46596_10006905
217 JGI25160J50197_1001659
218 JGI25160J50197_1024063
219 Ga0055526_1006886
220 Ga0055524_1004921
221 Ga0055528_1004882
222 Ga0055528_1016917
223 Ga0055543_1000625
224 Ga0065165_1004851
225 Ga0075365_10007081
226 Ga0075364_10185243
227 Ga0075362_10048319
228 Ga0075370_10051325
229 Ga0123341_1002262
230 Ga0123342_1031914
231 Ga0209435_100054
232 Ga0207425_1002013
233 Ga0209646_1000170
234 Ga0209026_1000193
235 Ga0209759_1000222
236 Ga0209129_1004336
237 Ga0209129_1005748
238 Ga0209673_1000967
239 Ga0209673_1001681
240 Ga0209673_1019779
241 Ga0209025_1000260
242 Ga0209025_1073820
243 Ga0209564_1003630
244 Ga0209564_1007614
245 Ga0209758_1000076
246 Ga0209758_1001982
247 Ga0209758_1002450
248 Ga0209758_1005092
249 Ga0209758_1049124
250 Ga0209256_1006484
251 Ga0209256_1013010
252 Ga0209256_1015150
253 Ga0209256_1015308
254 Ga0209256_1041390
255 Ga0207426_1000298
256 Ga0207426_1001199
257 Ga0209051_1009268
258 Ga0209051_1015378
259 Ga0209051_1018758
260 Ga0451833_0090118
261 Ga0451833_0865740
262 Ga0451835_0381003
263 Ga0451837_0677695
264 Ga0451839_0105420
265 Ga0451845_0431471
266 Ga0451845_0499825
267 Ga0451851_0389277
268 Ga0451851_1093736
269 Ga0451843_1760447
270 Ga0451853_1034206
271 Ga0451853_2098215
272 Ga0452268_15625
273 Ga0452268_35953
274 Ga0466970_0000568
275 Ga0495638_0000175
276 Ga0495638_0000634
277 Ga0495606_0042867
278 Ga0495610_0011616
279 Ga0495610_0056821
280 Ga0495620_0027206
281 Ga0495620_0028111
282 Ga0495643_0005332
283 Ga0495643_0020313
284 Ga0495643_0028074
285 Ga0495654_0000140
286 Ga0495597_0103573
287 Ga0495649_0153994
288 Ga0495660_0059566
289 Ga0495660_0072116
290 Ga0495686_0103734
291 Ga0496118_0004743
292 Ga0496121_0000235
293 Ga0496122_0000870
294 Ga0496123_0000664
295 Ga0496124_0026531
296 Ga0496125_0000417
297 Ga0496125_0192443
298 Ga0496126_0117181
299 Ga0496126_0254630
300 nmdc:mga03683_121443_c1
301 nmdc:mga00v17_47789_c1
302 nmdc:mga0yw44_1339_c1
303 nmdc:mga0k408_19439_c1
304 nmdc:mga0k408_49983_c1
305 nmdc:mga07m45_82503_c1
306 Ga0500578_0018598
307 Ga0500578_0026058
308 Ga0500578_0030624
309 Ga0500578_0052486
310 Ga0500557_000395
311 Ga0500569_002468
312 Ga0500569_039446
313 Ga0500658_0000065
314 Ga0500658_0000534
315 Ga0500658_0000629
316 Ga0500658_0006571
317 Ga0500568_0000092
318 Ga0500616_0001138
319 Ga0500616_0001531
320 Ga0500616_0015937
321 Ga0500616_0048256
322 Ga0500616_0050136
323 Ga0500616_0077490
324 Ga0500616_0112116
325 Ga0500622_0138230
326 Ga0500636_0022829
327 2509385914
328 2509441449
329 2509443981
330 2509448525
331 2511175146
332 2513580208
333 2517079892
334 2517080991
335 2520377797
336 2586003715
337 2586003940
338 2586004174
339 2616294129
340 2616297124
341 2720618569
342 2739034441
343 2766066561
344 2793315428
345 2793328638
346 2793334222
347 2793345209
348 2793354084
349 2806043241
350 2806051193
351 2806054957
352 2806057635
353 2806062141
354 2806065647
355 2819688935
356 2838028172
357 2838068433
358 2838669207
359 2838672390
360 2838687752
361 2838691579
362 2838701132
363 2838703868
364 2838735639
365 2838748541
366 2841854299
367 2841856139
368 2841858842
369 2842146803
370 2842148340
371 2842183098
372 2842192889
373 2842193814
374 2842205165
375 2842232809
376 2842235297
377 2842246948
378 2842248247
379 2842250498
380 2842250967
381 2842253406
382 2842259366
383 2842272216
384 2842276552
385 2842286841
386 2842289292
387 2842306498
388 2842309628
389 2842310792
390 2842312616
391 2842322517
392 2842403606
393 2842407498
394 2842410692
395 2842413253
396 2842417338
397 2842419896
398 2842450189
399 2842499028
400 2844455988
401 2844460747
402 2844461160
403 2852390294
404 2933573567
405 2933576072
406 2933577286
407 2936374095
408 2936375387
409 2989781497
410 639646650
411 8005301557
412 8005380090
413 8005565221
414 8023684215
415 8024484738
416 8057876051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05168

HEPN

HEPN domain

217

341

0.84

PF01909

NTP_transf_2

Nucleotidyltransferase domain

83

188

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.7008 153 300
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.6831 153 300
5a7d-assembly4.cif.gz_N tetrameric assembly of lgn with inscuteable 0.5946 139 304
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5934 30 119
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5758 155 306
ID Description Score Start End Superfamily
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7679 164 296 1.20.120.330
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7411 164 296 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7044 153 300 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6861 153 300 1.20.120.330
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.5708 153 312 1.20.120.80
ID Description Score Start End GO Terms
AF-W6RB65-F1-model_v4 Putative nucleotidyltransferase protein 0.9258 109 219 GO:0016740
AF-A0A7W9Z1K7-F1-model_v4 Putative nucleotidyltransferase 0.9172 1 142 GO:0016779
AF-A0A844A3V1-F1-model_v4 Nucleotidyltransferase 0.9101 2 139 GO:0016740
AF-W6RB65-F1-model_v4 Putative nucleotidyltransferase protein 0.9094 109 219 GO:0016740
AF-A0A3D4M4K6-F1-model_v4 deleted 0.9059 2 164

Map