F317839

General Info

Members Datasets Scaffolds Average Seq Length
208 140 208 100

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_11933330|Ga0157379_119333302
Length 119
Sequence MIAAFSITPLGVGDSVGGSVADAVRLVRESGLPNETNAMFTNVEGEWDEVMGLIKACVDKVAETAPRVSVVIKLDHRPGVSDALHAKVTTVLVELSAYNVMRLLHELRAEQTRMAFSKA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0
Rhizoplane 7.69
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10154694 3300003203 Bacteria 669
2 Ga0070683_100923333 3300005329 Bacteria 838
3 Ga0070680_101986940 3300005336 Bacteria 504
4 Ga0070709_10002147 3300005434 Bacteria 10677
5 Ga0070714_100424915 3300005435 Bacteria 1259
6 Ga0070713_100009654 3300005436 Bacteria 6925
7 Ga0070713_101935535 3300005436 Bacteria 572
8 Ga0070710_10030450 3300005437 Bacteria 2903
9 Ga0070711_100034431 3300005439 Bacteria 3378
10 Ga0070678_100338764 3300005456 Bacteria 1289
11 Ga0070681_10982077 3300005458 Bacteria 764
12 Ga0070706_100005887 3300005467 Bacteria 11620
13 Ga0070698_100001633 3300005471 Bacteria 24971
14 Ga0070699_100708126 3300005518 Bacteria 920
15 Ga0070679_100851158 3300005530 Bacteria 855
16 Ga0070684_101368065 3300005535 Bacteria 666
17 Ga0070684_101619866 3300005535 Bacteria 611
18 Ga0070686_100953843 3300005544 Bacteria 701
19 Ga0070665_100924219 3300005548 Bacteria 885
20 Ga0070665_101937517 3300005548 Bacteria 595
21 Ga0068856_100549600 3300005614 Bacteria 1176
22 Ga0081455_10619749 3300005937 Bacteria 702
23 Ga0081539_10006922 3300005985 Bacteria 10559
24 Ga0070717_10075063 3300006028 Bacteria 2828
25 Ga0075365_10329772 3300006038 Bacteria 1075
26 Ga0075365_10380481 3300006038 Bacteria 996
27 Ga0075363_100018985 3300006048 Bacteria 3431
28 Ga0075364_10037343 3300006051 Bacteria 3144
29 Ga0075364_10287055 3300006051 Bacteria 1120
30 Ga0070715_10091718 3300006163 Bacteria 1399
31 Ga0070716_100004793 3300006173 Bacteria 6494
32 Ga0070712_100006016 3300006175 Bacteria 7507
33 Ga0075367_10058431 3300006178 Bacteria 2295
34 Ga0075367_10439824 3300006178 Bacteria 826
35 Ga0075367_10470178 3300006178 Bacteria 797
36 Ga0075434_100572119 3300006871 Bacteria 1149
37 Ga0075434_100607968 3300006871 Bacteria 1112
38 Ga0105240_11805555 3300009093 Bacteria 637
39 Ga0111539_12031231 3300009094 Bacteria 667
40 Ga0105245_10751598 3300009098 Bacteria 1011
41 Ga0105245_12115409 3300009098 Bacteria 616
42 Ga0105245_13127787 3300009098 Bacteria 513
43 Ga0105247_11505749 3300009101 Bacteria 549
44 Ga0114129_11087859 3300009147 Bacteria 1002
45 Ga0105242_10013686 3300009176 Bacteria 6276
46 Ga0105239_10180515 3300010375 Bacteria 2362
47 Ga0105239_10213021 3300010375 Bacteria 2166
48 Ga0157373_11459800 3300013100 Bacteria 521
49 Ga0157369_10788768 3300013105 Bacteria 976
50 Ga0157378_10793285 3300013297 Bacteria 972
51 Ga0157378_12553669 3300013297 Bacteria 563
52 Ga0163162_12754016 3300013306 Bacteria 566
53 Ga0157372_10829732 3300013307 Bacteria 1073
54 Ga0163163_10129624 3300014325 Bacteria 2562
55 Ga0163163_12150787 3300014325 Bacteria 617
56 Ga0157380_10888676 3300014326 Bacteria 916
57 Ga0157379_11933330 3300014968 Bacteria 582
58 Ga0163161_11867808 3300017792 Bacteria 535
59 Ga0224712_10457603 3300022467 Bacteria 613
60 Ga0207692_10004331 3300025898 Bacteria 5615
61 Ga0207685_10145915 3300025905 Bacteria 1066
62 Ga0207699_10000860 3300025906 Bacteria 14445
63 Ga0207693_10568363 3300025915 Bacteria 884
64 Ga0207663_10166813 3300025916 Bacteria 1560
65 Ga0207652_10795557 3300025921 Bacteria 840
66 Ga0207687_11592936 3300025927 Bacteria 560
67 Ga0207700_10000526 3300025928 Bacteria 22554
68 Ga0207664_10025301 3300025929 Bacteria 4469
69 Ga0207665_10008925 3300025939 Bacteria 6585
70 Ga0207689_10806061 3300025942 Bacteria 793
71 Ga0207661_11079717 3300025944 Bacteria 739
72 Ga0207702_10906043 3300026078 Bacteria 874
73 Ga0207648_11066636 3300026089 Bacteria 757
74 Ga0268266_11567374 3300028379 Bacteria 634
75 Ga0265339_10127162 3300031249 Unclassified 1306
76 Ga0265327_10045188 3300031251 Bacteria 2343
77 Ga0265327_10057627 3300031251 Bacteria 1998
78 Ga0265327_10075669 3300031251 Bacteria 1674
79 Ga0316579_10037720 3300031691 Bacteria 2233
80 Ga0316577_10078361 3300031733 Bacteria 1846
81 Ga0307410_12019573 3300031852 Bacteria 515
82 Ga0316574_0046691 3300035398 Bacteria 2686
83 Ga0373935_0155970 3300035692 Bacteria 1553
84 Ga0373947_0080521 3300035725 Bacteria 2015
85 Ga0316582_0015661 3300036647 Bacteria 4344
86 Ga0373925_0480457 3300037068 Bacteria 1019
87 Ga0436365_1930065 3300039437 Bacteria 513
88 Ga0436360_0299776 3300039438 Bacteria 577
89 Ga0451837_0113062 3300041494 Bacteria 835
90 Ga0466968_0172210 3300044735 Bacteria 1004
91 Ga0466960_0152423 3300044901 Bacteria 1236
92 Ga0495590_0445142 3300046457 Bacteria 500
93 Ga0495629_0100649 3300046459 Bacteria 2017
94 Ga0495651_0226135 3300046462 Bacteria 1292
95 Ga0495651_0276578 3300046462 Bacteria 1136
96 Ga0495651_0964276 3300046462 Bacteria 519
97 Ga0495653_0019626 3300046463 Bacteria 5482
98 Ga0495653_0192718 3300046463 Bacteria 1389
99 Ga0495653_0266081 3300046463 Bacteria 1131
100 Ga0495594_0079476 3300046499 Bacteria 1831
101 Ga0495608_0058215 3300046511 Bacteria 2548
102 Ga0495608_0097928 3300046511 Bacteria 1893
103 Ga0495608_0370615 3300046511 Bacteria 879
104 Ga0495618_0010023 3300046514 Bacteria 5732
105 Ga0495618_0054486 3300046514 Bacteria 2531
106 Ga0495620_0160581 3300046515 Bacteria 873
107 Ga0495628_0008788 3300046516 Bacteria 8644
108 Ga0495628_0010404 3300046516 Bacteria 7901
109 Ga0495630_0028298 3300046517 Bacteria 4165
110 Ga0495630_0236009 3300046517 Bacteria 1397
111 Ga0495630_0241767 3300046517 Bacteria 1379
112 Ga0495630_0350973 3300046517 Bacteria 1129
113 Ga0495630_0590277 3300046517 Bacteria 852
114 Ga0495630_1059408 3300046517 Bacteria 615
115 Ga0495666_0015256 3300046526 Bacteria 3827
116 Ga0495652_0628920 3300046529 Bacteria 729
117 Ga0495640_0006956 3300046533 Bacteria 8906
118 Ga0495640_0500591 3300046533 Bacteria 739
119 Ga0495586_0041832 3300046535 Bacteria 2468
120 Ga0495645_0083600 3300046543 Bacteria 2288
121 Ga0495667_0044462 3300046559 Bacteria 2942
122 Ga0495667_0100561 3300046559 Bacteria 1871
123 Ga0495634_0008470 3300046642 Bacteria 7651
124 Ga0495634_0259463 3300046642 Bacteria 1061
125 Ga0495657_0074696 3300046675 Bacteria 2205
126 Ga0495657_0146604 3300046675 Bacteria 1468
127 Ga0495646_0072998 3300046680 Bacteria 2017
128 Ga0495658_0094152 3300046683 Bacteria 1778
129 Ga0495658_0268159 3300046683 Bacteria 1076
130 Ga0495658_0480902 3300046683 Bacteria 794
131 Ga0495613_0002645 3300046689 Bacteria 13465
132 Ga0495613_0470173 3300046689 Bacteria 850
133 Ga0495613_0521492 3300046689 Bacteria 798
134 Ga0495613_0815435 3300046689 Bacteria 608
135 Ga0495624_0162281 3300046690 Bacteria 1365
136 Ga0495624_0252336 3300046690 Bacteria 1067
137 Ga0495604_0461901 3300047317 Bacteria 828
138 Ga0495604_0490764 3300047317 Bacteria 798
139 Ga0495604_0665631 3300047317 Bacteria 663
140 Ga0495604_0815805 3300047317 Bacteria 587
141 Ga0495674_0019136 3300047319 Bacteria 6361
142 Ga0495674_0031077 3300047319 Bacteria 4853
143 Ga0495674_0700016 3300047319 Bacteria 795
144 Ga0495672_0253971 3300047320 Bacteria 852
145 Ga0495680_0012544 3300047322 Bacteria 7452
146 Ga0495680_0056958 3300047322 Bacteria 3025
147 Ga0495680_0441025 3300047322 Bacteria 893
148 Ga0495684_0234947 3300047471 Bacteria 1339
149 Ga0495684_0459662 3300047471 Bacteria 883
150 Ga0495602_0640238 3300048088 Bacteria 727
151 Ga0496104_0072455 3300048907 Bacteria 3276
152 Ga0496104_0438115 3300048907 Bacteria 1219
153 Ga0496104_1559418 3300048907 Bacteria 563
154 Ga0496105_0808024 3300048908 Bacteria 712
155 Ga0496106_0974257 3300048909 Bacteria 668
156 Ga0496108_0063571 3300048911 Bacteria 3108
157 Ga0496108_0681023 3300048911 Bacteria 893
158 Ga0496108_1510371 3300048911 Bacteria 559
159 Ga0496109_0131667 3300048912 Bacteria 2334
160 Ga0496109_0231939 3300048912 Bacteria 1737
161 Ga0496110_0028603 3300048913 Bacteria 4790
162 Ga0496110_1077243 3300048913 Bacteria 712
163 Ga0496112_0007643 3300048915 Bacteria 9613
164 Ga0496113_0446299 3300048916 Bacteria 1039
165 Ga0496114_0675176 3300048917 Bacteria 907
166 Ga0496114_1252201 3300048917 Bacteria 628
167 Ga0501034_0097439 3300049571 Bacteria 2936
168 Ga0501039_0336390 3300049575 Bacteria 1186
169 Ga0501040_0984755 3300049576 Bacteria 611
170 Ga0501047_1193470 3300049581 Bacteria 574
171 Ga0501048_0484003 3300049582 Bacteria 887
172 Ga0501048_0873617 3300049582 Bacteria 646
173 Ga0501071_1213017 3300049587 Bacteria 583
174 Ga0501072_0072178 3300049588 Bacteria 2728
175 Ga0501073_0380742 3300049589 Bacteria 975
176 Ga0501076_1320673 3300049592 Bacteria 593
177 Ga0501077_1094034 3300049593 Bacteria 513
178 Ga0501083_0587622 3300049744 Bacteria 725
179 nmdc:mga00v17_188969_c1 3300050491 Bacteria 1330
180 nmdc:mga00v17_3977_c1 3300050491 Bacteria 7627
181 nmdc:mga0yw44_127999_c1 3300050492 Bacteria 1641
182 nmdc:mga0yw44_360791_c1 3300050492 Bacteria 979
183 nmdc:mga06z11_213513_c1 3300050494 Bacteria 1125
184 nmdc:mga06z11_467998_c1 3300050494 Bacteria 762
185 nmdc:mga0n895_1442952_c1 3300050512 Bacteria 656
186 nmdc:mga0n895_558557_c1 3300050512 Bacteria 1150
187 Ga0495601_0087215 3300053077 Bacteria 2006
188 Ga0495601_0221395 3300053077 Bacteria 1236
189 Ga0495601_0732258 3300053077 Bacteria 630
190 Ga0495612_0254103 3300053078 Bacteria 782
191 Ga0500635_0038766 3300053080 Bacteria 1581
192 Ga0495595_0085858 3300053084 Bacteria 1505
193 Ga0495595_0135459 3300053084 Bacteria 1206
194 Ga0495595_0191455 3300053084 Bacteria 1017
195 Ga0495619_0010921 3300053085 Bacteria 5715
196 Ga0495619_0029042 3300053085 Bacteria 3571
197 Ga0495619_0103418 3300053085 Bacteria 1940
198 Ga0495619_0338176 3300053085 Bacteria 1042
199 Ga0495619_0374259 3300053085 Bacteria 984
200 Ga0495619_0385012 3300053085 Bacteria 969
201 Ga0500644_0555666 3300053088 Bacteria 507
202 Ga0500646_0028616 3300053090 Bacteria 1522
203 Ga0500566_0284951 3300053094 Bacteria 785
204 Ga0500650_0385373 3300053098 Bacteria 608
205 Ga0500620_061940 3300053155 Bacteria 1275
206 Ga0501084_0000065 3300054114 Bacteria 81183
207 Ga0501084_1006915 3300054114 Bacteria 700
208 Ga0530510_0003266 3300061734 Bacteria 11148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100549600 Ga0068856_1005496002 96
2 3300010375 Ga0105239_10213021 Ga0105239_102130214 96
3 3300013105 Ga0157369_10788768 Ga0157369_107887681 96
4 3300044901 Ga0466960_0152423 Ga0466960_0152423_609_911 96
5 3300046690 Ga0495624_0252336 Ga0495624_0252336_600_890 96
6 3300048907 Ga0496104_0438115 Ga0496104_0438115_83_373 96
7 3300048909 Ga0496106_0974257 Ga0496106_0974257_102_392 96
8 3300048911 Ga0496108_0063571 Ga0496108_0063571_1500_1790 96
9 3300048912 Ga0496109_0131667 Ga0496109_0131667_1952_2242 96
10 3300048913 Ga0496110_0028603 Ga0496110_0028603_463_753 96
11 3300048915 Ga0496112_0007643 Ga0496112_0007643_5937_6227 96
12 3300048916 Ga0496113_0446299 Ga0496113_0446299_274_564 96
13 3300003203 JGI25406J46586_10154694 JGI25406J46586_101546941 97
14 3300005329 Ga0070683_100923333 Ga0070683_1009233332 97
15 3300005336 Ga0070680_101986940 Ga0070680_1019869401 97
16 3300005434 Ga0070709_10002147 Ga0070709_100021472 97
17 3300005435 Ga0070714_100424915 Ga0070714_1004249152 97
18 3300005436 Ga0070713_100009654 Ga0070713_1000096541 97
19 3300005436 Ga0070713_101935535 Ga0070713_1019355351 97
20 3300005437 Ga0070710_10030450 Ga0070710_100304504 97
21 3300005439 Ga0070711_100034431 Ga0070711_1000344311 97
22 3300005456 Ga0070678_100338764 Ga0070678_1003387643 97
23 3300005458 Ga0070681_10982077 Ga0070681_109820772 97
24 3300005467 Ga0070706_100005887 Ga0070706_1000058872 97
25 3300005471 Ga0070698_100001633 Ga0070698_10000163318 97
26 3300005518 Ga0070699_100708126 Ga0070699_1007081262 97
27 3300005530 Ga0070679_100851158 Ga0070679_1008511582 97
28 3300005535 Ga0070684_101368065 Ga0070684_1013680652 97
29 3300005535 Ga0070684_101619866 Ga0070684_1016198661 97
30 3300005544 Ga0070686_100953843 Ga0070686_1009538431 97
31 3300005548 Ga0070665_100924219 Ga0070665_1009242192 97
32 3300005548 Ga0070665_101937517 Ga0070665_1019375172 97
33 3300005937 Ga0081455_10619749 Ga0081455_106197492 97
34 3300005985 Ga0081539_10006922 Ga0081539_100069222 97
35 3300006028 Ga0070717_10075063 Ga0070717_100750632 97
36 3300006038 Ga0075365_10329772 Ga0075365_103297722 97
37 3300006038 Ga0075365_10380481 Ga0075365_103804812 97
38 3300006048 Ga0075363_100018985 Ga0075363_1000189856 97
39 3300006051 Ga0075364_10037343 Ga0075364_100373434 97
40 3300006051 Ga0075364_10287055 Ga0075364_102870552 97
41 3300006163 Ga0070715_10091718 Ga0070715_100917182 97
42 3300006173 Ga0070716_100004793 Ga0070716_1000047936 97
43 3300006175 Ga0070712_100006016 Ga0070712_1000060161 97
44 3300006178 Ga0075367_10058431 Ga0075367_100584311 97
45 3300006178 Ga0075367_10439824 Ga0075367_104398241 97
46 3300006178 Ga0075367_10470178 Ga0075367_104701782 97
47 3300006871 Ga0075434_100572119 Ga0075434_1005721193 97
48 3300006871 Ga0075434_100607968 Ga0075434_1006079682 97
49 3300009093 Ga0105240_11805555 Ga0105240_118055551 97
50 3300009094 Ga0111539_12031231 Ga0111539_120312311 97
51 3300009098 Ga0105245_10751598 Ga0105245_107515982 97
52 3300009098 Ga0105245_12115409 Ga0105245_121154092 97
53 3300009098 Ga0105245_13127787 Ga0105245_131277872 97
54 3300009101 Ga0105247_11505749 Ga0105247_115057492 97
55 3300009147 Ga0114129_11087859 Ga0114129_110878592 97
56 3300009176 Ga0105242_10013686 Ga0105242_100136864 97
57 3300010375 Ga0105239_10180515 Ga0105239_101805153 97
58 3300013100 Ga0157373_11459800 Ga0157373_114598001 97
59 3300013297 Ga0157378_10793285 Ga0157378_107932852 97
60 3300013297 Ga0157378_12553669 Ga0157378_125536692 97
61 3300013306 Ga0163162_12754016 Ga0163162_127540161 97
62 3300013307 Ga0157372_10829732 Ga0157372_108297322 97
63 3300014325 Ga0163163_10129624 Ga0163163_101296244 97
64 3300014325 Ga0163163_12150787 Ga0163163_121507872 97
65 3300014326 Ga0157380_10888676 Ga0157380_108886763 97
66 3300014968 Ga0157379_11933330 Ga0157379_119333302 97
67 3300017792 Ga0163161_11867808 Ga0163161_118678081 97
68 3300022467 Ga0224712_10457603 Ga0224712_104576032 97
69 3300025898 Ga0207692_10004331 Ga0207692_100043314 97
70 3300025905 Ga0207685_10145915 Ga0207685_101459152 97
71 3300025906 Ga0207699_10000860 Ga0207699_100008607 97
72 3300025915 Ga0207693_10568363 Ga0207693_105683632 97
73 3300025916 Ga0207663_10166813 Ga0207663_101668132 97
74 3300025921 Ga0207652_10795557 Ga0207652_107955572 97
75 3300025927 Ga0207687_11592936 Ga0207687_115929362 97
76 3300025928 Ga0207700_10000526 Ga0207700_1000052611 97
77 3300025929 Ga0207664_10025301 Ga0207664_100253012 97
78 3300025939 Ga0207665_10008925 Ga0207665_100089251 97
79 3300025942 Ga0207689_10806061 Ga0207689_108060611 97
80 3300025944 Ga0207661_11079717 Ga0207661_110797171 97
81 3300026078 Ga0207702_10906043 Ga0207702_109060432 97
82 3300026089 Ga0207648_11066636 Ga0207648_110666362 97
83 3300028379 Ga0268266_11567374 Ga0268266_115673741 97
84 3300031249 Ga0265339_10127162 Ga0265339_101271624 97
85 3300031251 Ga0265327_10045188 Ga0265327_100451883 97
86 3300031251 Ga0265327_10057627 Ga0265327_100576272 97
87 3300031251 Ga0265327_10075669 Ga0265327_100756693 97
88 3300031691 Ga0316579_10037720 Ga0316579_100377203 97
89 3300031733 Ga0316577_10078361 Ga0316577_100783612 97
90 3300031852 Ga0307410_12019573 Ga0307410_120195731 97
91 3300035398 Ga0316574_0046691 Ga0316574_0046691_1403_1699 97
92 3300035692 Ga0373935_0155970 Ga0373935_0155970_223_549 97
93 3300035725 Ga0373947_0080521 Ga0373947_0080521_333_659 97
94 3300036647 Ga0316582_0015661 Ga0316582_0015661_2675_2971 97
95 3300037068 Ga0373925_0480457 Ga0373925_0480457_351_677 97
96 3300039437 Ga0436365_1930065 Ga0436365_1930065_58_357 97
97 3300039438 Ga0436360_0299776 Ga0436360_0299776_124_420 97
98 3300041494 Ga0451837_0113062 Ga0451837_0113062_426_725 97
99 3300044735 Ga0466968_0172210 Ga0466968_0172210_121_417 97
100 3300046457 Ga0495590_0445142 Ga0495590_0445142_16_309 97
101 3300046459 Ga0495629_0100649 Ga0495629_0100649_1488_1790 97
102 3300046462 Ga0495651_0226135 Ga0495651_0226135_127_423 97
103 3300046462 Ga0495651_0276578 Ga0495651_0276578_505_801 97
104 3300046462 Ga0495651_0964276 Ga0495651_0964276_27_323 97
105 3300046463 Ga0495653_0019626 Ga0495653_0019626_1659_1955 97
106 3300046463 Ga0495653_0192718 Ga0495653_0192718_981_1277 97
107 3300046463 Ga0495653_0266081 Ga0495653_0266081_293_589 97
108 3300046499 Ga0495594_0079476 Ga0495594_0079476_821_1117 97
109 3300046511 Ga0495608_0058215 Ga0495608_0058215_1734_2030 97
110 3300046511 Ga0495608_0097928 Ga0495608_0097928_752_1093 97
111 3300046511 Ga0495608_0370615 Ga0495608_0370615_541_843 97
112 3300046514 Ga0495618_0010023 Ga0495618_0010023_700_996 97
113 3300046514 Ga0495618_0054486 Ga0495618_0054486_2195_2497 97
114 3300046515 Ga0495620_0160581 Ga0495620_0160581_410_709 97
115 3300046516 Ga0495628_0008788 Ga0495628_0008788_301_597 97
116 3300046516 Ga0495628_0010404 Ga0495628_0010404_7444_7740 97
117 3300046517 Ga0495630_0028298 Ga0495630_0028298_2662_2958 97
118 3300046517 Ga0495630_0236009 Ga0495630_0236009_958_1263 97
119 3300046517 Ga0495630_0241767 Ga0495630_0241767_889_1191 97
120 3300046517 Ga0495630_0350973 Ga0495630_0350973_61_423 97
121 3300046517 Ga0495630_0590277 Ga0495630_0590277_353_649 97
122 3300046517 Ga0495630_1059408 Ga0495630_1059408_61_387 97
123 3300046526 Ga0495666_0015256 Ga0495666_0015256_3297_3593 97
124 3300046529 Ga0495652_0628920 Ga0495652_0628920_164_460 97
125 3300046533 Ga0495640_0006956 Ga0495640_0006956_3591_3887 97
126 3300046533 Ga0495640_0500591 Ga0495640_0500591_204_500 97
127 3300046535 Ga0495586_0041832 Ga0495586_0041832_967_1269 97
128 3300046543 Ga0495645_0083600 Ga0495645_0083600_15_311 97
129 3300046559 Ga0495667_0044462 Ga0495667_0044462_896_1192 97
130 3300046559 Ga0495667_0100561 Ga0495667_0100561_1329_1625 97
131 3300046642 Ga0495634_0008470 Ga0495634_0008470_2377_2679 97
132 3300046642 Ga0495634_0259463 Ga0495634_0259463_183_479 97
133 3300046675 Ga0495657_0074696 Ga0495657_0074696_1244_1540 97
134 3300046675 Ga0495657_0146604 Ga0495657_0146604_894_1190 97
135 3300046680 Ga0495646_0072998 Ga0495646_0072998_378_674 97
136 3300046683 Ga0495658_0094152 Ga0495658_0094152_295_591 97
137 3300046683 Ga0495658_0268159 Ga0495658_0268159_568_906 97
138 3300046683 Ga0495658_0480902 Ga0495658_0480902_185_481 97
139 3300046689 Ga0495613_0002645 Ga0495613_0002645_11643_11945 97
140 3300046689 Ga0495613_0470173 Ga0495613_0470173_121_447 97
141 3300046689 Ga0495613_0521492 Ga0495613_0521492_205_501 97
142 3300046689 Ga0495613_0815435 Ga0495613_0815435_285_581 97
143 3300046690 Ga0495624_0162281 Ga0495624_0162281_319_615 97
144 3300047317 Ga0495604_0461901 Ga0495604_0461901_158_454 97
145 3300047317 Ga0495604_0490764 Ga0495604_0490764_341_637 97
146 3300047317 Ga0495604_0665631 Ga0495604_0665631_146_487 97
147 3300047317 Ga0495604_0815805 Ga0495604_0815805_16_309 97
148 3300047319 Ga0495674_0019136 Ga0495674_0019136_5414_5710 97
149 3300047319 Ga0495674_0031077 Ga0495674_0031077_1655_1951 97
150 3300047319 Ga0495674_0700016 Ga0495674_0700016_328_624 97
151 3300047320 Ga0495672_0253971 Ga0495672_0253971_263_568 97
152 3300047322 Ga0495680_0012544 Ga0495680_0012544_7117_7413 97
153 3300047322 Ga0495680_0056958 Ga0495680_0056958_1830_2171 97
154 3300047322 Ga0495680_0441025 Ga0495680_0441025_516_812 97
155 3300047471 Ga0495684_0234947 Ga0495684_0234947_34_330 97
156 3300047471 Ga0495684_0459662 Ga0495684_0459662_474_770 97
157 3300048088 Ga0495602_0640238 Ga0495602_0640238_348_644 97
158 3300048907 Ga0496104_0072455 Ga0496104_0072455_1647_1958 97
159 3300048907 Ga0496104_1559418 Ga0496104_1559418_44_346 97
160 3300048908 Ga0496105_0808024 Ga0496105_0808024_328_639 97
161 3300048911 Ga0496108_0681023 Ga0496108_0681023_130_435 97
162 3300048911 Ga0496108_1510371 Ga0496108_1510371_101_394 97
163 3300048912 Ga0496109_0231939 Ga0496109_0231939_1288_1581 97
164 3300048913 Ga0496110_1077243 Ga0496110_1077243_324_656 97
165 3300048917 Ga0496114_0675176 Ga0496114_0675176_391_723 97
166 3300048917 Ga0496114_1252201 Ga0496114_1252201_47_352 97
167 3300049571 Ga0501034_0097439 Ga0501034_0097439_766_1071 97
168 3300049575 Ga0501039_0336390 Ga0501039_0336390_826_1122 97
169 3300049576 Ga0501040_0984755 Ga0501040_0984755_285_581 97
170 3300049581 Ga0501047_1193470 Ga0501047_1193470_25_330 97
171 3300049582 Ga0501048_0484003 Ga0501048_0484003_370_675 97
172 3300049582 Ga0501048_0873617 Ga0501048_0873617_52_345 97
173 3300049587 Ga0501071_1213017 Ga0501071_1213017_31_336 97
174 3300049588 Ga0501072_0072178 Ga0501072_0072178_401_697 97
175 3300049589 Ga0501073_0380742 Ga0501073_0380742_346_651 97
176 3300049592 Ga0501076_1320673 Ga0501076_1320673_108_407 97
177 3300049593 Ga0501077_1094034 Ga0501077_1094034_196_492 97
178 3300049744 Ga0501083_0587622 Ga0501083_0587622_266_568 97
179 3300050491 nmdc:mga00v17_188969_c1 nmdc:mga00v17_188969_c1_886_1188 97
180 3300050491 nmdc:mga00v17_3977_c1 nmdc:mga00v17_3977_c1_3369_3680 97
181 3300050492 nmdc:mga0yw44_127999_c1 nmdc:mga0yw44_127999_c1_1267_1572 97
182 3300050492 nmdc:mga0yw44_360791_c1 nmdc:mga0yw44_360791_c1_485_778 97
183 3300050494 nmdc:mga06z11_213513_c1 nmdc:mga06z11_213513_c1_67_372 97
184 3300050494 nmdc:mga06z11_467998_c1 nmdc:mga06z11_467998_c1_401_712 97
185 3300050512 nmdc:mga0n895_1442952_c1 nmdc:mga0n895_1442952_c1_181_477 97
186 3300050512 nmdc:mga0n895_558557_c1 nmdc:mga0n895_558557_c1_238_534 97
187 3300053077 Ga0495601_0087215 Ga0495601_0087215_1611_1907 97
188 3300053077 Ga0495601_0221395 Ga0495601_0221395_192_488 97
189 3300053077 Ga0495601_0732258 Ga0495601_0732258_19_315 97
190 3300053078 Ga0495612_0254103 Ga0495612_0254103_355_651 97
191 3300053080 Ga0500635_0038766 Ga0500635_0038766_23_328 97
192 3300053084 Ga0495595_0085858 Ga0495595_0085858_1171_1467 97
193 3300053084 Ga0495595_0135459 Ga0495595_0135459_753_1049 97
194 3300053084 Ga0495595_0191455 Ga0495595_0191455_133_426 97
195 3300053085 Ga0495619_0010921 Ga0495619_0010921_3625_3966 97
196 3300053085 Ga0495619_0029042 Ga0495619_0029042_746_1042 97
197 3300053085 Ga0495619_0103418 Ga0495619_0103418_283_579 97
198 3300053085 Ga0495619_0338176 Ga0495619_0338176_265_561 97
199 3300053085 Ga0495619_0374259 Ga0495619_0374259_673_969 97
200 3300053085 Ga0495619_0385012 Ga0495619_0385012_620_916 97
201 3300053088 Ga0500644_0555666 Ga0500644_0555666_121_426 97
202 3300053090 Ga0500646_0028616 Ga0500646_0028616_371_676 97
203 3300053094 Ga0500566_0284951 Ga0500566_0284951_179_481 97
204 3300053098 Ga0500650_0385373 Ga0500650_0385373_57_362 97
205 3300053155 Ga0500620_061940 Ga0500620_061940_466_771 97
206 3300054114 Ga0501084_0000065 Ga0501084_0000065_80860_81156 97
207 3300054114 Ga0501084_1006915 Ga0501084_1006915_255_551 97
208 3300061734 Ga0530510_0003266 Ga0530510_0003266_3604_3900 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01910

Thiamine_BP

Thiamine-binding protein

3

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbr-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.9154 2 72
1s7h-assembly2.cif.gz_D structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.9136 2 72
1sbr-assembly1.cif.gz_A the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.9107 2 72
1s99-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: ligand free protein 0.9103 2 72
1s7h-assembly1.cif.gz_B structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.9081 2 72
ID Description Score Start End Superfamily
af_P9WFQ1_1_102_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.961 2 95 3.30.70.930
af_P9WFQ1_1_102_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9229 2 95 3.30.70.930
af_Q2FY28_1_104_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9116 2 97 3.30.70.930
2ekyH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9014 2 92 3.30.70.930
af_Q2FY28_1_104_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8942 2 97 3.30.70.930
ID Description Score Start End GO Terms
AF-A0A1H4HSK8-F1-model_v4 deleted 0.9796 19 97
AF-A0A6G9YJL8-F1-model_v4 MTH1187 family thiamine-binding protein 0.9776 2 96 GO:0005829
AF-A0A4D4N107-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9775 16 97 GO:0005829
AF-A0A0Q0XVB6-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9752 1 96 GO:0005829
AF-A0A1F9TUS0-F1-model_v4 Thiamine-binding protein domain-containing protein 0.975 1 96 GO:0005829

Feature Viewer

pLDDT pTM Quality
92.18 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map