F317679

General Info

Members Datasets Scaffolds Average Seq Length
208 146 416 223

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100832415|Ga0075434_1008324151
Length 254
Sequence LRRGRETKEAPPTHVGVVAESCSDRGSIPRASIVFIGHFAVGFASKRAAPRTSLGLLLAAPLLADIIWPVLLLAGVEKVRITGGTNPFLTLTFDSYPWSHSLLMLTIWGVLLAGGYYAVTKYRPGATILFVGVLSHWVLDVVTHVQDMPLAPGVPSLVGLGLWLSVVGTVVIEGMMFVAGVWLYSRVTTPRDTIGRWAWWAYVVLLVVSYLSQFGGGTPPSVQAIGWLAIIMSVLMVVWAWWLDRHRDLRASAH

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 23.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100832415 3300006871 Unclassified 939
2 MBSR1b_contig_10085942 2162886012 Bacteria 3053
3 MBSR1b_contig_6076606 2162886012 Bacteria 3053
4 MBSR1b_contig_9538077 2162886012 Bacteria 3957
5 Ga0065715_10096026 3300005293 Bacteria 3957
6 Ga0070658_10001431 3300005327 Bacteria 20352
7 Ga0070658_10544625 3300005327 Unclassified 1004
8 Ga0070676_10295328 3300005328 Bacteria 1096
9 Ga0070690_100041707 3300005330 Unclassified 2906
10 Ga0068869_100045234 3300005334 Bacteria 3168
11 Ga0070680_100031707 3300005336 Bacteria 4249
12 Ga0070660_100086273 3300005339 Bacteria 2470
13 Ga0070660_100412401 3300005339 Unclassified 1118
14 Ga0070660_100431408 3300005339 Bacteria 1092
15 Ga0070689_100006835 3300005340 Bacteria 7936
16 Ga0070687_100003394 3300005343 Bacteria 6184
17 Ga0070687_100289086 3300005343 Bacteria 1035
18 Ga0070661_100041613 3300005344 Bacteria 3353
19 Ga0070661_100205196 3300005344 Bacteria 1507
20 Ga0070692_10055714 3300005345 Bacteria 2068
21 Ga0070692_10085151 3300005345 Bacteria 1709
22 Ga0070692_10136229 3300005345 Unclassified 1385
23 Ga0070675_100000455 3300005354 Bacteria 27928
24 Ga0070673_100047466 3300005364 Bacteria 3342
25 Ga0070673_100575457 3300005364 Bacteria 1025
26 Ga0070688_100007576 3300005365 Bacteria 5858
27 Ga0070688_100113379 3300005365 Bacteria 1806
28 Ga0070659_100007186 3300005366 Bacteria 8080
29 Ga0070709_10002452 3300005434 Bacteria 10042
30 Ga0070709_10017039 3300005434 Bacteria 4160
31 Ga0070709_10019810 3300005434 Bacteria 3896
32 Ga0070709_10102420 3300005434 Bacteria 1910
33 Ga0070714_100036301 3300005435 Bacteria 4133
34 Ga0070713_100027139 3300005436 Unclassified 4505
35 Ga0070713_100195021 3300005436 Bacteria 1827
36 Ga0070713_100382761 3300005436 Unclassified 1311
37 Ga0070713_100392368 3300005436 Bacteria 1295
38 Ga0070710_10359437 3300005437 Bacteria 966
39 Ga0070711_100036282 3300005439 Bacteria 3303
40 Ga0070711_100349090 3300005439 Unclassified 1189
41 Ga0070705_100416191 3300005440 Bacteria 999
42 Ga0070700_100369007 3300005441 Bacteria 1070
43 Ga0070694_100009847 3300005444 Bacteria 5875
44 Ga0070663_100397433 3300005455 Bacteria 1126
45 Ga0070681_10245119 3300005458 Bacteria 1705
46 Ga0068867_100097150 3300005459 Unclassified 2244
47 Ga0070707_100733113 3300005468 Unclassified 951
48 Ga0070707_100759707 3300005468 Bacteria 933
49 Ga0070684_100003348 3300005535 Bacteria 12005
50 Ga0070684_100024267 3300005535 Bacteria 5084
51 Ga0070684_100475791 3300005535 Bacteria 1156
52 Ga0070672_100483866 3300005543 Bacteria 1069
53 Ga0070686_100089672 3300005544 Unclassified 2054
54 Ga0070686_100107960 3300005544 Unclassified 1891
55 Ga0070695_100010385 3300005545 Bacteria 5559
56 Ga0070695_100348548 3300005545 Bacteria 1109
57 Ga0070696_100028058 3300005546 Bacteria 3839
58 Ga0070704_100025279 3300005549 Bacteria 3908
59 Ga0070704_100460638 3300005549 Bacteria 1097
60 Ga0068855_100124203 3300005563 Bacteria 2952
61 Ga0068857_100401839 3300005577 Unclassified 1275
62 Ga0068856_100325644 3300005614 Unclassified 1554
63 Ga0070702_100123332 3300005615 Bacteria 1625
64 Ga0068859_100000011 3300005617 Bacteria 309687
65 Ga0068859_100004360 3300005617 Bacteria 14437
66 Ga0068859_100019089 3300005617 Bacteria 6885
67 Ga0068864_100062393 3300005618 Bacteria 3229
68 Ga0068863_100625400 3300005841 Bacteria 1067
69 Ga0068858_100045828 3300005842 Bacteria 4054
70 Ga0068858_100329893 3300005842 Unclassified 1459
71 Ga0068860_100004756 3300005843 Bacteria 13831
72 Ga0068860_100225926 3300005843 Bacteria 1818
73 Ga0070717_11025345 3300006028 Bacteria 752
74 Ga0070715_10152839 3300006163 Bacteria 1133
75 Ga0070712_100126561 3300006175 Bacteria 1931
76 Ga0075433_10002299 3300006852 Bacteria 14557
77 Ga0075433_10091375 3300006852 Bacteria 2691
78 Ga0075434_100004944 3300006871 Bacteria 12086
79 Ga0075434_100007970 3300006871 Bacteria 9819
80 Ga0068865_100215964 3300006881 Bacteria 1497
81 Ga0075436_100030401 3300006914 Bacteria 3718
82 Ga0075436_100146375 3300006914 Bacteria 1661
83 Ga0097620_100000011 3300006931 Bacteria 309687
84 Ga0097620_100004360 3300006931 Bacteria 14437
85 Ga0097620_100019089 3300006931 Bacteria 6885
86 Ga0075435_100002394 3300007076 Bacteria 12435
87 Ga0099794_10153371 3300007265 Bacteria 1170
88 Ga0105237_10043910 3300009545 Bacteria 4501
89 Ga0105237_10197780 3300009545 Bacteria 2010
90 Ga0105238_10226815 3300009551 Bacteria 1845
91 Ga0105238_11039998 3300009551 Unclassified 840
92 Ga0157373_10084243 3300013100 Bacteria 2241
93 Ga0157369_10002740 3300013105 Bacteria 21040
94 Ga0157369_10047676 3300013105 Bacteria 4650
95 Ga0157369_10409680 3300013105 Unclassified 1406
96 Ga0157374_10058436 3300013296 Bacteria 3604
97 Ga0163162_10000003 3300013306 Bacteria 698280
98 Ga0163162_10018443 3300013306 Bacteria 6838
99 Ga0163162_10602251 3300013306 Bacteria 1225
100 Ga0157372_10005624 3300013307 Bacteria 13326
101 Ga0157372_10026359 3300013307 Bacteria 6324
102 Ga0157372_11374426 3300013307 Unclassified 814
103 Ga0157375_10112954 3300013308 Bacteria 2817
104 Ga0163163_10041232 3300014325 Bacteria 4513
105 Ga0157380_10535252 3300014326 Unclassified 1146
106 Ga0157377_10000260 3300014745 Bacteria 25939
107 Ga0157379_10147561 3300014968 Bacteria 2121
108 Ga0157376_10314584 3300014969 Bacteria 1486
109 Ga0182005_1084163 3300015265 Bacteria 880
110 Ga0207692_10290566 3300025898 Bacteria 992
111 Ga0207647_10050493 3300025904 Bacteria 2574
112 Ga0207699_10001663 3300025906 Bacteria 10545
113 Ga0207699_10089280 3300025906 Bacteria 1931
114 Ga0207699_10140760 3300025906 Bacteria 1585
115 Ga0207705_10008375 3300025909 Bacteria 7550
116 Ga0207705_10034489 3300025909 Bacteria 3618
117 Ga0207705_10379691 3300025909 Unclassified 1091
118 Ga0207693_10016210 3300025915 Bacteria 5958
119 Ga0207693_10030815 3300025915 Bacteria 4236
120 Ga0207693_10200886 3300025915 Unclassified 1568
121 Ga0207663_10236387 3300025916 Unclassified 1338
122 Ga0207663_10376660 3300025916 Unclassified 1080
123 Ga0207660_10076005 3300025917 Bacteria 2455
124 Ga0207662_10068428 3300025918 Bacteria 2144
125 Ga0207657_10000851 3300025919 Bacteria 32255
126 Ga0207657_10345985 3300025919 Bacteria 1173
127 Ga0207649_10056526 3300025920 Bacteria 2451
128 Ga0207694_10381877 3300025924 Unclassified 1169
129 Ga0207659_10000704 3300025926 Bacteria 19847
130 Ga0207700_10497288 3300025928 Unclassified 1079
131 Ga0207664_10060833 3300025929 Unclassified 3012
132 Ga0207690_10016862 3300025932 Bacteria 4452
133 Ga0207670_10018573 3300025936 Bacteria 4231
134 Ga0207704_10049574 3300025938 Bacteria 2527
135 Ga0207691_10601528 3300025940 Bacteria 931
136 Ga0207689_10103841 3300025942 Bacteria 2335
137 Ga0207661_10003822 3300025944 Bacteria 10501
138 Ga0207667_10071302 3300025949 Unclassified 3613
139 Ga0207703_10156447 3300026035 Bacteria 1992
140 Ga0207703_10220979 3300026035 Unclassified 1694
141 Ga0207678_10122769 3300026067 Bacteria 2216
142 Ga0207641_10451746 3300026088 Bacteria 1242
143 Ga0207676_10047416 3300026095 Bacteria 3330
144 Ga0207674_10020713 3300026116 Bacteria 7096
145 Ga0207675_100092613 3300026118 Bacteria 2842
146 Ga0268265_10609465 3300028380 Unclassified 1044
147 Ga0268264_10241573 3300028381 Bacteria 1673
148 Ga0307405_10579990 3300031731 Unclassified 912
149 Ga0307416_100061608 3300032002 Unclassified 3063
150 Ga0373932_0000177 3300035112 Bacteria 18737
151 Ga0466963_0158969 3300044694 Bacteria 1572
152 Ga0451576_0102036 3300045051 Bacteria 2984
153 Ga0451576_0422496 3300045051 Bacteria 1399
154 Ga0495603_0078278 3300046455 Unclassified 1939
155 Ga0495629_0050516 3300046459 Bacteria 2912
156 Ga0495582_0021274 3300046473 Unclassified 3550
157 Ga0495639_0005381 3300046475 Bacteria 5512
158 Ga0495639_0041166 3300046475 Unclassified 2081
159 Ga0495594_0040694 3300046499 Bacteria 2544
160 Ga0495594_0065142 3300046499 Unclassified 2021
161 Ga0495630_0020746 3300046517 Unclassified 4848
162 Ga0495652_0256637 3300046529 Bacteria 1293
163 Ga0495652_0404824 3300046529 Unclassified 965
164 Ga0495665_0057618 3300046531 Bacteria 2051
165 Ga0495640_0062561 3300046533 Unclassified 2524
166 Ga0495667_0186029 3300046559 Unclassified 1332
167 Ga0495625_0140274 3300046660 Unclassified 1631
168 Ga0495647_0003352 3300046681 Bacteria 5132
169 Ga0495669_0069314 3300046684 Bacteria 1605
170 Ga0495613_0086140 3300046689 Viruses 2278
171 Ga0495581_0013511 3300047315 Bacteria 4736
172 Ga0495581_0104860 3300047315 Unclassified 1643
173 Ga0495674_0222145 3300047319 Bacteria 1561
174 Ga0495676_0044219 3300047321 Viruses 3637
175 Ga0495680_0343784 3300047322 Bacteria 1040
176 Ga0495593_0154234 3300047673 Bacteria 1161
177 Ga0495614_0067406 3300048089 Unclassified 1540
178 Ga0495614_0151468 3300048089 Bacteria 1035
179 Ga0496100_0102264 3300048903 Unclassified 1977
180 Ga0496102_0275514 3300048905 Bacteria 1586
181 Ga0496104_0584349 3300048907 Unclassified 1027
182 Ga0496106_0357810 3300048909 Bacteria 1173
183 Ga0496106_0825070 3300048909 Bacteria 735
184 Ga0496108_0266951 3300048911 Unclassified 1489
185 Ga0496112_0047876 3300048915 Unclassified 4193
186 Ga0496113_0081712 3300048916 Bacteria 2477
187 Ga0501031_0247252 3300049568 Bacteria 1159
188 Ga0501038_0494172 3300049574 Bacteria 936
189 Ga0501039_0438978 3300049575 Bacteria 1025
190 Ga0501041_0030896 3300049577 Bacteria 3233
191 Ga0501071_0151674 3300049587 Unclassified 1729
192 Ga0501072_0266885 3300049588 Bacteria 1362
193 Ga0501075_0063947 3300049591 Bacteria 2775
194 Ga0501079_0013015 3300049741 Bacteria 6346
195 Ga0501080_0777375 3300049742 Bacteria 841
196 Ga0501081_0022682 3300049743 Bacteria 4202
197 nmdc:mga06r32_540229_c1 3300050510 Bacteria 1140
198 nmdc:mga0n895_4256_c1 3300050512 Bacteria 11707
199 nmdc:mga0n895_4875_c1 3300050512 Bacteria 11115
200 nmdc:mga0rr50_1144_c1 3300050513 Bacteria 14408
201 nmdc:mga0rr50_62300_c1 3300050513 Bacteria 2813
202 nmdc:mga08x19_33795_c1 3300050514 Bacteria 3229
203 nmdc:mga08x19_66298_c1 3300050514 Unclassified 2346
204 nmdc:mga0a205_8108_c1 3300050515 Bacteria 9546
205 nmdc:mga0a205_917323_c1 3300050515 Unclassified 723
206 Ga0495601_0058610 3300053077 Bacteria 2441
207 Ga0495619_0159671 3300053085 Bacteria 1557
208 Ga0501082_0088874 3300060353 Bacteria 2667
209 Ga0075434_100832415
210 MBSR1b_contig_10085942
211 MBSR1b_contig_6076606
212 MBSR1b_contig_9538077
213 Ga0065715_10096026
214 Ga0070658_10001431
215 Ga0070658_10544625
216 Ga0070676_10295328
217 Ga0070690_100041707
218 Ga0068869_100045234
219 Ga0070680_100031707
220 Ga0070660_100086273
221 Ga0070660_100412401
222 Ga0070660_100431408
223 Ga0070689_100006835
224 Ga0070687_100003394
225 Ga0070687_100289086
226 Ga0070661_100041613
227 Ga0070661_100205196
228 Ga0070692_10055714
229 Ga0070692_10085151
230 Ga0070692_10136229
231 Ga0070675_100000455
232 Ga0070673_100047466
233 Ga0070673_100575457
234 Ga0070688_100007576
235 Ga0070688_100113379
236 Ga0070659_100007186
237 Ga0070709_10002452
238 Ga0070709_10017039
239 Ga0070709_10019810
240 Ga0070709_10102420
241 Ga0070714_100036301
242 Ga0070713_100027139
243 Ga0070713_100195021
244 Ga0070713_100382761
245 Ga0070713_100392368
246 Ga0070710_10359437
247 Ga0070711_100036282
248 Ga0070711_100349090
249 Ga0070705_100416191
250 Ga0070700_100369007
251 Ga0070694_100009847
252 Ga0070663_100397433
253 Ga0070681_10245119
254 Ga0068867_100097150
255 Ga0070707_100733113
256 Ga0070707_100759707
257 Ga0070684_100003348
258 Ga0070684_100024267
259 Ga0070684_100475791
260 Ga0070672_100483866
261 Ga0070686_100089672
262 Ga0070686_100107960
263 Ga0070695_100010385
264 Ga0070695_100348548
265 Ga0070696_100028058
266 Ga0070704_100025279
267 Ga0070704_100460638
268 Ga0068855_100124203
269 Ga0068857_100401839
270 Ga0068856_100325644
271 Ga0070702_100123332
272 Ga0068859_100000011
273 Ga0068859_100004360
274 Ga0068859_100019089
275 Ga0068864_100062393
276 Ga0068863_100625400
277 Ga0068858_100045828
278 Ga0068858_100329893
279 Ga0068860_100004756
280 Ga0068860_100225926
281 Ga0070717_11025345
282 Ga0070715_10152839
283 Ga0070712_100126561
284 Ga0075433_10002299
285 Ga0075433_10091375
286 Ga0075434_100004944
287 Ga0075434_100007970
288 Ga0068865_100215964
289 Ga0075436_100030401
290 Ga0075436_100146375
291 Ga0097620_100000011
292 Ga0097620_100004360
293 Ga0097620_100019089
294 Ga0075435_100002394
295 Ga0099794_10153371
296 Ga0105237_10043910
297 Ga0105237_10197780
298 Ga0105238_10226815
299 Ga0105238_11039998
300 Ga0157373_10084243
301 Ga0157369_10002740
302 Ga0157369_10047676
303 Ga0157369_10409680
304 Ga0157374_10058436
305 Ga0163162_10000003
306 Ga0163162_10018443
307 Ga0163162_10602251
308 Ga0157372_10005624
309 Ga0157372_10026359
310 Ga0157372_11374426
311 Ga0157375_10112954
312 Ga0163163_10041232
313 Ga0157380_10535252
314 Ga0157377_10000260
315 Ga0157379_10147561
316 Ga0157376_10314584
317 Ga0182005_1084163
318 Ga0207692_10290566
319 Ga0207647_10050493
320 Ga0207699_10001663
321 Ga0207699_10089280
322 Ga0207699_10140760
323 Ga0207705_10008375
324 Ga0207705_10034489
325 Ga0207705_10379691
326 Ga0207693_10016210
327 Ga0207693_10030815
328 Ga0207693_10200886
329 Ga0207663_10236387
330 Ga0207663_10376660
331 Ga0207660_10076005
332 Ga0207662_10068428
333 Ga0207657_10000851
334 Ga0207657_10345985
335 Ga0207649_10056526
336 Ga0207694_10381877
337 Ga0207659_10000704
338 Ga0207700_10497288
339 Ga0207664_10060833
340 Ga0207690_10016862
341 Ga0207670_10018573
342 Ga0207704_10049574
343 Ga0207691_10601528
344 Ga0207689_10103841
345 Ga0207661_10003822
346 Ga0207667_10071302
347 Ga0207703_10156447
348 Ga0207703_10220979
349 Ga0207678_10122769
350 Ga0207641_10451746
351 Ga0207676_10047416
352 Ga0207674_10020713
353 Ga0207675_100092613
354 Ga0268265_10609465
355 Ga0268264_10241573
356 Ga0307405_10579990
357 Ga0307416_100061608
358 Ga0373932_0000177
359 Ga0466963_0158969
360 Ga0451576_0102036
361 Ga0451576_0422496
362 Ga0495603_0078278
363 Ga0495629_0050516
364 Ga0495582_0021274
365 Ga0495639_0005381
366 Ga0495639_0041166
367 Ga0495594_0040694
368 Ga0495594_0065142
369 Ga0495630_0020746
370 Ga0495652_0256637
371 Ga0495652_0404824
372 Ga0495665_0057618
373 Ga0495640_0062561
374 Ga0495667_0186029
375 Ga0495625_0140274
376 Ga0495647_0003352
377 Ga0495669_0069314
378 Ga0495613_0086140
379 Ga0495581_0013511
380 Ga0495581_0104860
381 Ga0495674_0222145
382 Ga0495676_0044219
383 Ga0495680_0343784
384 Ga0495593_0154234
385 Ga0495614_0067406
386 Ga0495614_0151468
387 Ga0496100_0102264
388 Ga0496102_0275514
389 Ga0496104_0584349
390 Ga0496106_0357810
391 Ga0496106_0825070
392 Ga0496108_0266951
393 Ga0496112_0047876
394 Ga0496113_0081712
395 Ga0501031_0247252
396 Ga0501038_0494172
397 Ga0501039_0438978
398 Ga0501041_0030896
399 Ga0501071_0151674
400 Ga0501072_0266885
401 Ga0501075_0063947
402 Ga0501079_0013015
403 Ga0501080_0777375
404 Ga0501081_0022682
405 nmdc:mga06r32_540229_c1
406 nmdc:mga0n895_4256_c1
407 nmdc:mga0n895_4875_c1
408 nmdc:mga0rr50_1144_c1
409 nmdc:mga0rr50_62300_c1
410 nmdc:mga08x19_33795_c1
411 nmdc:mga08x19_66298_c1
412 nmdc:mga0a205_8108_c1
413 nmdc:mga0a205_917323_c1
414 Ga0495601_0058610
415 Ga0495619_0159671
416 Ga0501082_0088874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p2p-assembly1.cif.gz_D human signal peptidase complex paralog a (spc-a) 0.7945 69 106
6t80-assembly2.cif.gz_D human 14-3-3 sigma fused to the aanat peptide including phosphoserine-205 0.4367 68 152
7p2p-assembly1.cif.gz_D human signal peptidase complex paralog a (spc-a) 0.3969 69 106
7voj-assembly1.cif.gz_B al-bound structure of the atalmt1 mutant m60a 0.3646 8 146
7u8g-assembly1.cif.gz_B cryo-em structure of the core human nadph oxidase nox2 0.3305 3 106
ID Description Score Start End Superfamily
af_Q6H4I2_5_90_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5976 69 106 1.10.10.1740
af_I1MJ03_3_89_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5885 69 106 1.10.10.1740
af_I1N324_4_83_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4272 28 101 1.10.10.1740
af_Q6Z565_5_89_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.3895 28 106 1.10.10.1740
af_P07866_1_155_1.20.870.10 Mainly Alpha;Up-down Bundle;Son of sevenless (SoS) protein; Chain S, domain 1;Son of sevenless (SoS) protein Chain: S domain 1 0.376 26 112 1.20.870.10
ID Description Score Start End GO Terms
AF-A0A7J5F0K5-F1-model_v4 Metal-dependent hydrolase 0.978 1 116 GO:0016020
AF-A0A7V8BPQ9-F1-model_v4 Metal-dependent hydrolase 0.9624 1 206 GO:0016020
AF-A0A350BM70-F1-model_v4 Metal-dependent hydrolase 0.9619 1 204 GO:0016020
AF-A0A7J5F0K5-F1-model_v4 Metal-dependent hydrolase 0.9617 1 116 GO:0016020
AF-A0A1I5Z1X9-F1-model_v4 LexA-binding, inner membrane-associated hydrolase 0.9604 1 206 GO:0016020

Map