F315137

General Info

Members Datasets Scaffolds Average Seq Length
206 128 412 193

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10225486|Ga0163163_102254864
Length 184
Sequence MRAYKFLRPGGVGPFSRYAWPLPRADRPGAWVISGGGTVLCHSGIHACRVADLPWWLQDELWEAELDGEVAAGRHKVTAPRARLVRRVDAWDAACARRFGDACAQRAHGHAARAAAGTDGVTPDAARIATAMAGDATTRARSGAAIVAAYIAVHTAARVDGPAAVADERAWQAGWLAAELSLDS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.19
Rhizosphere 76.7
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10225486 3300014325 Bacteria 1923
2 JGI25407J50210_10025011 3300003373 Bacteria 1548
3 JGI25407J50210_10031740 3300003373 Bacteria 1367
4 JGI25407J50210_10104642 3300003373 Unclassified 699
5 Ga0070683_100683562 3300005329 Unclassified 983
6 Ga0070690_100077843 3300005330 Bacteria 2166
7 Ga0070682_100045032 3300005337 Bacteria 2733
8 Ga0068868_100085763 3300005338 Bacteria 2531
9 Ga0070689_100127649 3300005340 Bacteria 2037
10 Ga0070689_100482802 3300005340 Unclassified 1059
11 Ga0070692_10186898 3300005345 Bacteria 1204
12 Ga0070668_100416273 3300005347 Bacteria 1150
13 Ga0070669_100644239 3300005353 Bacteria 891
14 Ga0070671_100110041 3300005355 Bacteria 2314
15 Ga0070659_100050916 3300005366 Bacteria 3256
16 Ga0070659_100125291 3300005366 Bacteria 2084
17 Ga0070714_100011717 3300005435 Bacteria 6966
18 Ga0070714_100247982 3300005435 Unclassified 1646
19 Ga0070714_100292680 3300005435 Unclassified 1516
20 Ga0070713_100235142 3300005436 Bacteria 1667
21 Ga0070713_100785611 3300005436 Bacteria 912
22 Ga0070710_10038872 3300005437 Bacteria 2615
23 Ga0070701_10308176 3300005438 Bacteria 976
24 Ga0070711_100011365 3300005439 Bacteria 5526
25 Ga0070700_100227428 3300005441 Unclassified 1325
26 Ga0070681_10247797 3300005458 Bacteria 1694
27 Ga0068867_100357318 3300005459 Bacteria 1221
28 Ga0070685_10059766 3300005466 Bacteria 2226
29 Ga0068853_100191737 3300005539 Bacteria 1857
30 Ga0068853_100383924 3300005539 Bacteria 1312
31 Ga0070693_100092770 3300005547 Bacteria 1824
32 Ga0070704_100843516 3300005549 Bacteria 821
33 Ga0068857_100150282 3300005577 Bacteria 2110
34 Ga0068857_100329061 3300005577 Bacteria 1412
35 Ga0068856_100521049 3300005614 Bacteria 1210
36 Ga0068852_100116930 3300005616 Bacteria 2434
37 Ga0068852_100240788 3300005616 Bacteria 1729
38 Ga0068852_100871016 3300005616 Unclassified 917
39 Ga0068864_100217249 3300005618 Bacteria 1762
40 Ga0068866_10054434 3300005718 Bacteria 2050
41 Ga0068861_100023290 3300005719 Bacteria 4466
42 Ga0068861_100032706 3300005719 Bacteria 3832
43 Ga0068858_100465059 3300005842 Bacteria 1220
44 Ga0068860_100396911 3300005843 Unclassified 1364
45 Ga0081538_10003062 3300005981 Bacteria 15926
46 Ga0081538_10005924 3300005981 Bacteria 10889
47 Ga0081538_10020336 3300005981 Bacteria 4890
48 Ga0081538_10034139 3300005981 Bacteria 3369
49 Ga0070717_10064349 3300006028 Bacteria 3046
50 Ga0070717_10252707 3300006028 Bacteria 1558
51 Ga0070717_10553814 3300006028 Bacteria 1041
52 Ga0070712_100022401 3300006175 Bacteria 4162
53 Ga0070712_100040155 3300006175 Bacteria 3207
54 Ga0070712_100156405 3300006175 Bacteria 1756
55 Ga0075433_10284074 3300006852 Bacteria 1466
56 Ga0068865_100075828 3300006881 Bacteria 2399
57 Ga0068865_100635348 3300006881 Bacteria 906
58 Ga0105245_10006704 3300009098 Bacteria 10099
59 Ga0105245_10013805 3300009098 Bacteria 7036
60 Ga0105245_10429654 3300009098 Unclassified 1325
61 Ga0105247_10033720 3300009101 Bacteria 3116
62 Ga0105243_10037549 3300009148 Bacteria 3766
63 Ga0105248_11010553 3300009177 Bacteria 939
64 Ga0105249_10053194 3300009553 Bacteria 3701
65 Ga0105249_10263588 3300009553 Bacteria 1713
66 Ga0105239_10619151 3300010375 Bacteria 1235
67 Ga0157380_10510425 3300014326 Unclassified 1170
68 Ga0157377_10030247 3300014745 Bacteria 2932
69 Ga0157377_10129962 3300014745 Bacteria 1537
70 Ga0157379_10163272 3300014968 Bacteria 2010
71 Ga0213873_10002554 3300021358 Bacteria 3166
72 Ga0213874_10000243 3300021377 Bacteria 10325
73 Ga0213874_10093430 3300021377 Bacteria 991
74 Ga0213876_10020460 3300021384 Bacteria 3497
75 Ga0213876_10034470 3300021384 Bacteria 2669
76 Ga0213876_10287253 3300021384 Bacteria 874
77 Ga0213875_10014855 3300021388 Bacteria 3795
78 Ga0207692_10084315 3300025898 Bacteria 1707
79 Ga0207699_10057002 3300025906 Bacteria 2332
80 Ga0207693_10006154 3300025915 Bacteria 9953
81 Ga0207693_10048732 3300025915 Bacteria 3326
82 Ga0207693_10289104 3300025915 Bacteria 1284
83 Ga0207663_10007912 3300025916 Bacteria 5545
84 Ga0207681_10386820 3300025923 Bacteria 1127
85 Ga0207700_10110545 3300025928 Unclassified 2210
86 Ga0207664_10120007 3300025929 Unclassified 2199
87 Ga0207664_10200660 3300025929 Bacteria 1721
88 Ga0207690_10036819 3300025932 Bacteria 3172
89 Ga0207709_10041506 3300025935 Bacteria 2761
90 Ga0207709_10131614 3300025935 Bacteria 1706
91 Ga0207669_10890674 3300025937 Unclassified 743
92 Ga0207704_10039665 3300025938 Bacteria 2745
93 Ga0207661_10332496 3300025944 Bacteria 1368
94 Ga0207661_10333745 3300025944 Bacteria 1365
95 Ga0207679_10364804 3300025945 Bacteria 1262
96 Ga0207651_10145421 3300025960 Bacteria 1838
97 Ga0207712_10045719 3300025961 Bacteria 3033
98 Ga0207712_10237284 3300025961 Unclassified 1467
99 Ga0207668_10497372 3300025972 Bacteria 1048
100 Ga0207677_10123740 3300026023 Bacteria 1951
101 Ga0207703_10178547 3300026035 Bacteria 1872
102 Ga0207639_10227470 3300026041 Bacteria 1615
103 Ga0207678_10676423 3300026067 Bacteria 907
104 Ga0207708_10020420 3300026075 Bacteria 4997
105 Ga0207648_10395614 3300026089 Bacteria 1251
106 Ga0207648_10570385 3300026089 Bacteria 1041
107 Ga0207674_10356719 3300026116 Bacteria 1413
108 Ga0207675_100009251 3300026118 Bacteria 9241
109 Ga0207675_100076498 3300026118 Bacteria 3134
110 Ga0207698_10325036 3300026142 Bacteria 1442
111 Ga0207698_10689054 3300026142 Unclassified 1016
112 Ga0268264_10241734 3300028381 Unclassified 1673
113 Ga0373953_0007040 3300035117 Bacteria 3744
114 Ga0373954_0237478 3300035118 Unclassified 897
115 Ga0373956_0084085 3300035119 Unclassified 1463
116 Ga0373937_0012082 3300036401 Bacteria 7578
117 Ga0436364_0249623 3300037853 Bacteria 6267
118 Ga0436364_0877118 3300037853 Bacteria 796
119 Ga0436365_0038796 3300039437 Bacteria 5381
120 Ga0436365_0751819 3300039437 Bacteria 1436
121 Ga0436365_0826214 3300039437 Bacteria 1465
122 Ga0436365_1350152 3300039437 Bacteria 7333
123 Ga0436365_1555860 3300039437 Bacteria 1286
124 Ga0436365_1601396 3300039437 Unclassified 1308
125 Ga0436360_0425881 3300039438 Bacteria 1197
126 Ga0436363_0031879 3300039450 Bacteria 1140
127 Ga0436363_0359283 3300039450 Bacteria 5169
128 Ga0436363_0510352 3300039450 Bacteria 718
129 Ga0436363_0547340 3300039450 Bacteria 1058
130 Ga0436363_0628296 3300039450 Bacteria 1299
131 Ga0436363_0651309 3300039450 Bacteria 2256
132 Ga0436363_0818785 3300039450 Bacteria 4074
133 Ga0436363_0897753 3300039450 Unclassified 1325
134 Ga0436363_1032154 3300039450 Bacteria 692
135 Ga0436363_1216058 3300039450 Bacteria 4937
136 Ga0436363_1280363 3300039450 Bacteria 1508
137 Ga0436363_1465331 3300039450 Bacteria 9366
138 Ga0436363_1585910 3300039450 Bacteria 1316
139 Ga0436362_0149701 3300039453 Bacteria 1785
140 Ga0436362_0291319 3300039453 Bacteria 788
141 Ga0436362_0883189 3300039453 Bacteria 929
142 Ga0436362_1130558 3300039453 Bacteria 609
143 Ga0436362_1242922 3300039453 Unclassified 1358
144 Ga0466961_0201687 3300044693 Bacteria 1230
145 Ga0466961_0281380 3300044693 Bacteria 1018
146 Ga0466963_0003659 3300044694 Bacteria 8843
147 Ga0466963_0474038 3300044694 Unclassified 883
148 Ga0466964_0551071 3300044706 Unclassified 626
149 Ga0466968_0121495 3300044735 Bacteria 1182
150 Ga0466970_0221658 3300044765 Bacteria 1056
151 Ga0466957_0131555 3300044842 Bacteria 1604
152 Ga0466959_0121604 3300045049 Bacteria 1856
153 Ga0466958_0001976 3300045836 Bacteria 10077
154 Ga0466958_0019213 3300045836 Bacteria 3976
155 Ga0466958_0131007 3300045836 Bacteria 1575
156 Ga0466958_0372488 3300045836 Bacteria 920
157 Ga0466958_0401591 3300045836 Unclassified 885
158 Ga0466967_0240469 3300045976 Bacteria 1727
159 Ga0466967_0452189 3300045976 Unclassified 1255
160 Ga0466967_0785406 3300045976 Bacteria 945
161 Ga0466967_0989643 3300045976 Bacteria 837
162 Ga0495651_0001755 3300046462 Bacteria 16733
163 Ga0495653_0009220 3300046463 Bacteria 8073
164 Ga0495608_0003508 3300046511 Bacteria 11240
165 Ga0495628_0108405 3300046516 Unclassified 2138
166 Ga0495652_0100844 3300046529 Unclassified 2341
167 Ga0495634_0008411 3300046642 Bacteria 7687
168 Ga0495635_0001638 3300046663 Bacteria 15101
169 Ga0495657_0006121 3300046675 Bacteria 9428
170 Ga0495599_0114866 3300046678 Unclassified 1675
171 Ga0495646_0002813 3300046680 Bacteria 10767
172 Ga0495600_0033762 3300046809 Unclassified 3321
173 Ga0495604_0031882 3300047317 Bacteria 4178
174 Ga0495674_0083411 3300047319 Bacteria 2740
175 Ga0495674_0113908 3300047319 Unclassified 2290
176 Ga0495680_0007086 3300047322 Bacteria 10327
177 Ga0495684_0038777 3300047471 Bacteria 3652
178 Ga0495602_0062327 3300048088 Unclassified 3235
179 Ga0496100_0265008 3300048903 Bacteria 1275
180 Ga0496102_0054351 3300048905 Bacteria 3651
181 Ga0496104_0261582 3300048907 Bacteria 1643
182 Ga0496104_0517443 3300048907 Bacteria 1104
183 Ga0496105_0339618 3300048908 Bacteria 1201
184 Ga0496106_0086185 3300048909 Bacteria 2419
185 Ga0496106_0204681 3300048909 Bacteria 1571
186 Ga0496108_0015586 3300048911 Bacteria 6200
187 Ga0496108_0129854 3300048911 Bacteria 2166
188 Ga0496109_0025374 3300048912 Bacteria 5281
189 Ga0496109_0594987 3300048912 Bacteria 1042
190 Ga0496109_0853025 3300048912 Bacteria 849
191 Ga0496110_0226130 3300048913 Bacteria 1701
192 Ga0496111_0042900 3300048914 Bacteria 3249
193 Ga0496112_0032953 3300048915 Bacteria 5032
194 Ga0496112_0107644 3300048915 Bacteria 2758
195 Ga0496112_0250483 3300048915 Unclassified 1722
196 Ga0496113_0161352 3300048916 Bacteria 1772
197 Ga0496113_0217143 3300048916 Bacteria 1523
198 Ga0496115_0212419 3300048918 Bacteria 1598
199 Ga0496115_0313502 3300048918 Unclassified 1284
200 nmdc:mga08y16_1034935_c1 3300050511 Bacteria 799
201 nmdc:mga0a205_931541_c1 3300050515 Bacteria 715
202 Ga0495601_0142249 3300053077 Bacteria 1565
203 Ga0495601_0147422 3300053077 Unclassified 1536
204 Ga0495612_0052251 3300053078 Unclassified 1681
205 Ga0495595_0041065 3300053084 Unclassified 2115
206 Ga0495619_0202657 3300053085 Bacteria 1374
207 Ga0163163_10225486
208 JGI25407J50210_10025011
209 JGI25407J50210_10031740
210 JGI25407J50210_10104642
211 Ga0070683_100683562
212 Ga0070690_100077843
213 Ga0070682_100045032
214 Ga0068868_100085763
215 Ga0070689_100127649
216 Ga0070689_100482802
217 Ga0070692_10186898
218 Ga0070668_100416273
219 Ga0070669_100644239
220 Ga0070671_100110041
221 Ga0070659_100050916
222 Ga0070659_100125291
223 Ga0070714_100011717
224 Ga0070714_100247982
225 Ga0070714_100292680
226 Ga0070713_100235142
227 Ga0070713_100785611
228 Ga0070710_10038872
229 Ga0070701_10308176
230 Ga0070711_100011365
231 Ga0070700_100227428
232 Ga0070681_10247797
233 Ga0068867_100357318
234 Ga0070685_10059766
235 Ga0068853_100191737
236 Ga0068853_100383924
237 Ga0070693_100092770
238 Ga0070704_100843516
239 Ga0068857_100150282
240 Ga0068857_100329061
241 Ga0068856_100521049
242 Ga0068852_100116930
243 Ga0068852_100240788
244 Ga0068852_100871016
245 Ga0068864_100217249
246 Ga0068866_10054434
247 Ga0068861_100023290
248 Ga0068861_100032706
249 Ga0068858_100465059
250 Ga0068860_100396911
251 Ga0081538_10003062
252 Ga0081538_10005924
253 Ga0081538_10020336
254 Ga0081538_10034139
255 Ga0070717_10064349
256 Ga0070717_10252707
257 Ga0070717_10553814
258 Ga0070712_100022401
259 Ga0070712_100040155
260 Ga0070712_100156405
261 Ga0075433_10284074
262 Ga0068865_100075828
263 Ga0068865_100635348
264 Ga0105245_10006704
265 Ga0105245_10013805
266 Ga0105245_10429654
267 Ga0105247_10033720
268 Ga0105243_10037549
269 Ga0105248_11010553
270 Ga0105249_10053194
271 Ga0105249_10263588
272 Ga0105239_10619151
273 Ga0157380_10510425
274 Ga0157377_10030247
275 Ga0157377_10129962
276 Ga0157379_10163272
277 Ga0213873_10002554
278 Ga0213874_10000243
279 Ga0213874_10093430
280 Ga0213876_10020460
281 Ga0213876_10034470
282 Ga0213876_10287253
283 Ga0213875_10014855
284 Ga0207692_10084315
285 Ga0207699_10057002
286 Ga0207693_10006154
287 Ga0207693_10048732
288 Ga0207693_10289104
289 Ga0207663_10007912
290 Ga0207681_10386820
291 Ga0207700_10110545
292 Ga0207664_10120007
293 Ga0207664_10200660
294 Ga0207690_10036819
295 Ga0207709_10041506
296 Ga0207709_10131614
297 Ga0207669_10890674
298 Ga0207704_10039665
299 Ga0207661_10332496
300 Ga0207661_10333745
301 Ga0207679_10364804
302 Ga0207651_10145421
303 Ga0207712_10045719
304 Ga0207712_10237284
305 Ga0207668_10497372
306 Ga0207677_10123740
307 Ga0207703_10178547
308 Ga0207639_10227470
309 Ga0207678_10676423
310 Ga0207708_10020420
311 Ga0207648_10395614
312 Ga0207648_10570385
313 Ga0207674_10356719
314 Ga0207675_100009251
315 Ga0207675_100076498
316 Ga0207698_10325036
317 Ga0207698_10689054
318 Ga0268264_10241734
319 Ga0373953_0007040
320 Ga0373954_0237478
321 Ga0373956_0084085
322 Ga0373937_0012082
323 Ga0436364_0249623
324 Ga0436364_0877118
325 Ga0436365_0038796
326 Ga0436365_0751819
327 Ga0436365_0826214
328 Ga0436365_1350152
329 Ga0436365_1555860
330 Ga0436365_1601396
331 Ga0436360_0425881
332 Ga0436363_0031879
333 Ga0436363_0359283
334 Ga0436363_0510352
335 Ga0436363_0547340
336 Ga0436363_0628296
337 Ga0436363_0651309
338 Ga0436363_0818785
339 Ga0436363_0897753
340 Ga0436363_1032154
341 Ga0436363_1216058
342 Ga0436363_1280363
343 Ga0436363_1465331
344 Ga0436363_1585910
345 Ga0436362_0149701
346 Ga0436362_0291319
347 Ga0436362_0883189
348 Ga0436362_1130558
349 Ga0436362_1242922
350 Ga0466961_0201687
351 Ga0466961_0281380
352 Ga0466963_0003659
353 Ga0466963_0474038
354 Ga0466964_0551071
355 Ga0466968_0121495
356 Ga0466970_0221658
357 Ga0466957_0131555
358 Ga0466959_0121604
359 Ga0466958_0001976
360 Ga0466958_0019213
361 Ga0466958_0131007
362 Ga0466958_0372488
363 Ga0466958_0401591
364 Ga0466967_0240469
365 Ga0466967_0452189
366 Ga0466967_0785406
367 Ga0466967_0989643
368 Ga0495651_0001755
369 Ga0495653_0009220
370 Ga0495608_0003508
371 Ga0495628_0108405
372 Ga0495652_0100844
373 Ga0495634_0008411
374 Ga0495635_0001638
375 Ga0495657_0006121
376 Ga0495599_0114866
377 Ga0495646_0002813
378 Ga0495600_0033762
379 Ga0495604_0031882
380 Ga0495674_0083411
381 Ga0495674_0113908
382 Ga0495680_0007086
383 Ga0495684_0038777
384 Ga0495602_0062327
385 Ga0496100_0265008
386 Ga0496102_0054351
387 Ga0496104_0261582
388 Ga0496104_0517443
389 Ga0496105_0339618
390 Ga0496106_0086185
391 Ga0496106_0204681
392 Ga0496108_0015586
393 Ga0496108_0129854
394 Ga0496109_0025374
395 Ga0496109_0594987
396 Ga0496109_0853025
397 Ga0496110_0226130
398 Ga0496111_0042900
399 Ga0496112_0032953
400 Ga0496112_0107644
401 Ga0496112_0250483
402 Ga0496113_0161352
403 Ga0496113_0217143
404 Ga0496115_0212419
405 Ga0496115_0313502
406 nmdc:mga08y16_1034935_c1
407 nmdc:mga0a205_931541_c1
408 Ga0495601_0142249
409 Ga0495601_0147422
410 Ga0495612_0052251
411 Ga0495595_0041065
412 Ga0495619_0202657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uc1-assembly1.cif.gz_B structural analysis of glucocorticoid receptor beta ligand binding domain complexed with glucocorticoid antagonist ru-486: implication of helix 12 in antagonism 0.5529 131 166
5x20-assembly3.cif.gz_F the ternary structure of d-mandelate dehydrogenase with nadh and anilino(oxo)acetate 0.5404 133 169
7prw-assembly1.cif.gz_B the glucocorticoid receptor in complex with velsecorat, a pgc1a coactivator fragment and sgk 23bp 0.473 120 162
3odm-assembly1.cif.gz_D archaeal-type phosphoenolpyruvate carboxylase 0.4191 123 169
1l2j-assembly2.cif.gz_B human estrogen receptor beta ligand-binding domain in complex with (r,r)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol 0.4167 120 167
ID Description Score Start End Superfamily
af_A0A1D8PNP7_69_490_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5944 132 167 1.20.1250.20
af_A0A0R0J975_105_305_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.5783 133 167 1.20.120.1760
3u3wA02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5745 134 167 1.25.40.10
5uc1B00 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.5529 131 166 1.10.565.10
af_A0A1D8PI09_102_311_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.5395 133 166 1.20.900.10
ID Description Score Start End GO Terms
AF-A0A7K0JX05-F1-model_v4 deleted 0.9272 1 111
AF-A0A538HSJ0-F1-model_v4 Uncharacterized protein 0.9257 1 170
AF-A0A7W0KVY9-F1-model_v4 Uncharacterized protein 0.9248 1 85
AF-A0A538HSJ0-F1-model_v4 Uncharacterized protein 0.9205 1 170
AF-A0A7V9CWF7-F1-model_v4 Uncharacterized protein 0.9037 1 80

Map