F312231

General Info

Members Datasets Scaffolds Average Seq Length
204 126 408 246

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100037055|Ga0070698_1000370552
Length 282
Sequence MPWWRDRRRASENDAATQSSAASTVFLRSGPYNCCPVHRFFAPALDPGDETVMLPRDEAEHLTRVLRLGVGDTVAIFDGRGHEFLARVASAARRDVRVQLLTRVEPAAEPPVPLTLAQAVLKADKMDDVVRDAVMLGVAAIQPLVTKRSETTVAALARGARRDRWTRVALASVKQSRRATLPDIRTPLTLEGYLSEPGPLLRLMFIEPGAGASVQTLAVLRNRPAPSDAAILVGPEGGWDEEEWTAAQAQGVELVTLGHRTLRADAVPIAAISILQFLWDSG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
82 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
83 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
84 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 20.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100037055 3300005471 Bacteria 5030
2 Ga0065715_10004151 3300005293 Bacteria 5545
3 Ga0070670_100486448 3300005331 Bacteria 1096
4 Ga0068869_100122412 3300005334 Unclassified 1991
5 Ga0068869_100404736 3300005334 Bacteria 1123
6 Ga0070666_10179454 3300005335 Bacteria 1485
7 Ga0068868_100156644 3300005338 Bacteria 1879
8 Ga0070689_100030081 3300005340 Bacteria 4118
9 Ga0070689_100056137 3300005340 Unclassified 3053
10 Ga0070671_100105360 3300005355 Bacteria 2367
11 Ga0070673_100005141 3300005364 Bacteria 8347
12 Ga0070688_100006828 3300005365 Bacteria 6122
13 Ga0070688_100421815 3300005365 Bacteria 992
14 Ga0070667_100050066 3300005367 Bacteria 3519
15 Ga0070714_100004063 3300005435 Bacteria 10996
16 Ga0070711_100459847 3300005439 Bacteria 1043
17 Ga0070694_100005411 3300005444 Bacteria 7727
18 Ga0070708_100078482 3300005445 Unclassified 2985
19 Ga0070708_100157378 3300005445 Bacteria 2116
20 Ga0070708_100256872 3300005445 Unclassified 1642
21 Ga0070678_100047136 3300005456 Unclassified 3095
22 Ga0070707_100054553 3300005468 Bacteria 3832
23 Ga0070707_100089899 3300005468 Bacteria 2972
24 Ga0070698_100100638 3300005471 Bacteria 2863
25 Ga0070698_100176627 3300005471 Bacteria 2075
26 Ga0070699_100002361 3300005518 Bacteria 16930
27 Ga0070699_100105514 3300005518 Unclassified 2472
28 Ga0070699_100200024 3300005518 Bacteria 1776
29 Ga0070699_100230635 3300005518 Bacteria 1651
30 Ga0070699_100580708 3300005518 Bacteria 1021
31 Ga0070697_100138710 3300005536 Bacteria 2044
32 Ga0070697_100338052 3300005536 Unclassified 1299
33 Ga0070672_100101719 3300005543 Bacteria 2331
34 Ga0070672_100257104 3300005543 Bacteria 1472
35 Ga0070686_100358917 3300005544 Bacteria 1097
36 Ga0070695_100003611 3300005545 Bacteria 9029
37 Ga0070695_100107002 3300005545 Bacteria 1892
38 Ga0070696_100452842 3300005546 Unclassified 1013
39 Ga0070665_100017847 3300005548 Bacteria 7124
40 Ga0070704_100087004 3300005549 Bacteria 2318
41 Ga0070704_100412371 3300005549 Bacteria 1155
42 Ga0068855_100151990 3300005563 Bacteria 2632
43 Ga0068854_100417207 3300005578 Unclassified 1114
44 Ga0070702_100276369 3300005615 Unclassified 1151
45 Ga0068859_100618383 3300005617 Bacteria 1176
46 Ga0068864_100247144 3300005618 Unclassified 1655
47 Ga0068866_10268158 3300005718 Unclassified 1052
48 Ga0068851_10136733 3300005834 Bacteria 1329
49 Ga0068858_100154520 3300005842 Bacteria 2159
50 Ga0068858_100337414 3300005842 Unclassified 1442
51 Ga0068860_100270654 3300005843 Bacteria 1658
52 Ga0068860_100778890 3300005843 Unclassified 969
53 Ga0068862_100117923 3300005844 Bacteria 2336
54 Ga0068871_100003518 3300006358 Bacteria 10778
55 Ga0068871_100089569 3300006358 Bacteria 2561
56 Ga0068871_100270302 3300006358 Unclassified 1485
57 Ga0075428_100566910 3300006844 Bacteria 1213
58 Ga0075433_10046504 3300006852 Bacteria 3775
59 Ga0075433_10050345 3300006852 Bacteria 3626
60 Ga0075434_100013104 3300006871 Bacteria 7873
61 Ga0075434_100026504 3300006871 Bacteria 5679
62 Ga0075434_100027370 3300006871 Bacteria 5597
63 Ga0075434_100698346 3300006871 Unclassified 1032
64 Ga0068865_100012501 3300006881 Bacteria 5344
65 Ga0075436_100025075 3300006914 Bacteria 4100
66 Ga0075436_100089796 3300006914 Unclassified 2135
67 Ga0075436_100104194 3300006914 Bacteria 1977
68 Ga0097620_100618397 3300006931 Bacteria 1176
69 Ga0075435_100006626 3300007076 Bacteria 8204
70 Ga0075435_100011641 3300007076 Bacteria 6484
71 Ga0075435_100042669 3300007076 Bacteria 3629
72 Ga0075435_100128300 3300007076 Bacteria 2121
73 Ga0075435_100191078 3300007076 Bacteria 1733
74 Ga0105240_10056272 3300009093 Bacteria 4922
75 Ga0111539_10031302 3300009094 Bacteria 6463
76 Ga0111539_10043073 3300009094 Bacteria 5414
77 Ga0105245_10085457 3300009098 Bacteria 2892
78 Ga0114129_10005815 3300009147 Bacteria 17467
79 Ga0114129_10009041 3300009147 Bacteria 14197
80 Ga0114129_10009110 3300009147 Bacteria 14147
81 Ga0114129_10087289 3300009147 Bacteria 4326
82 Ga0114129_10236603 3300009147 Bacteria 2457
83 Ga0114129_10290786 3300009147 Bacteria 2181
84 Ga0114129_10316756 3300009147 Bacteria 2074
85 Ga0114129_11133949 3300009147 Unclassified 977
86 Ga0105242_10019826 3300009176 Bacteria 5268
87 Ga0105248_10111817 3300009177 Unclassified 3081
88 Ga0105248_10116519 3300009177 Bacteria 3013
89 Ga0105248_10162122 3300009177 Bacteria 2522
90 Ga0105248_10174470 3300009177 Bacteria 2423
91 Ga0105238_10080136 3300009551 Bacteria 3255
92 Ga0157369_10412019 3300013105 Bacteria 1401
93 Ga0157378_10032946 3300013297 Bacteria 4580
94 Ga0157378_10935386 3300013297 Unclassified 899
95 Ga0163162_10030323 3300013306 Bacteria 5359
96 Ga0157375_11225469 3300013308 Unclassified 881
97 Ga0163163_10122062 3300014325 Unclassified 2640
98 Ga0163163_10343312 3300014325 Bacteria 1549
99 Ga0163163_10935358 3300014325 Unclassified 930
100 Ga0157380_10042447 3300014326 Bacteria 3556
101 Ga0157380_10185991 3300014326 Bacteria 1830
102 Ga0157379_10004296 3300014968 Bacteria 12177
103 Ga0157379_10028725 3300014968 Bacteria 4946
104 Ga0157376_10030993 3300014969 Unclassified 4277
105 Ga0157376_10094706 3300014969 Bacteria 2595
106 Ga0207680_10058159 3300025903 Unclassified 2342
107 Ga0207663_10560478 3300025916 Unclassified 894
108 Ga0207662_10267851 3300025918 Unclassified 1126
109 Ga0207646_10008835 3300025922 Bacteria 10043
110 Ga0207646_10182678 3300025922 Bacteria 1894
111 Ga0207681_10016026 3300025923 Bacteria 4681
112 Ga0207650_10736606 3300025925 Bacteria 834
113 Ga0207664_10089905 3300025929 Bacteria 2515
114 Ga0207644_10012829 3300025931 Bacteria 5573
115 Ga0207644_10296410 3300025931 Bacteria 1302
116 Ga0207686_10186814 3300025934 Bacteria 1474
117 Ga0207686_10446955 3300025934 Unclassified 994
118 Ga0207670_10072933 3300025936 Bacteria 2379
119 Ga0207704_10014894 3300025938 Unclassified 3944
120 Ga0207691_10023566 3300025940 Bacteria 5796
121 Ga0207691_10344482 3300025940 Bacteria 1275
122 Ga0207711_10225196 3300025941 Bacteria 1716
123 Ga0207711_10360971 3300025941 Bacteria 1346
124 Ga0207689_10188611 3300025942 Unclassified 1701
125 Ga0207651_10180260 3300025960 Bacteria 1675
126 Ga0207703_10513273 3300026035 Bacteria 1126
127 Ga0207676_10462424 3300026095 Unclassified 1198
128 Ga0207683_10301395 3300026121 Bacteria 1466
129 Ga0268266_10012450 3300028379 Bacteria 7352
130 Ga0268266_10739965 3300028379 Unclassified 949
131 Ga0268265_10289537 3300028380 Bacteria 1470
132 Ga0268264_10045228 3300028381 Bacteria 3655
133 Ga0373930_0001079 3300034816 Unclassified 3943
134 Ga0373948_0000872 3300034817 Bacteria 4008
135 Ga0373950_0001380 3300034818 Bacteria 3158
136 Ga0373928_0058873 3300035084 Bacteria 924
137 Ga0373951_0000587 3300035091 Bacteria 10052
138 Ga0373932_0001750 3300035112 Bacteria 5876
139 Ga0373939_0000629 3300035114 Bacteria 8771
140 Ga0373941_0000065 3300035115 Bacteria 16423
141 Ga0373941_0019187 3300035115 Bacteria 1900
142 Ga0373956_0166804 3300035119 Bacteria 1039
143 Ga0373960_0000092 3300035121 Bacteria 13839
144 Ga0373942_0000398 3300035207 Bacteria 12063
145 Ga0373961_0001869 3300035241 Bacteria 5737
146 Ga0373962_0007388 3300035242 Bacteria 2690
147 Ga0373931_0009570 3300035691 Bacteria 4635
148 Ga0373947_0317634 3300035725 Bacteria 1041
149 Ga0373937_0197128 3300036401 Bacteria 1893
150 Ga0373925_0081788 3300037068 Bacteria 2457
151 Ga0450916_014620 3300042530 Bacteria 1024
152 Ga0451576_0106633 3300045051 Bacteria 2915
153 Ga0451576_0413605 3300045051 Archaea 1415
154 Ga0451576_0758981 3300045051 Bacteria 1019
155 Ga0451576_0765627 3300045051 Bacteria 1014
156 Ga0466967_0637431 3300045976 Unclassified 1053
157 Ga0495652_0303005 3300046529 Unclassified 1161
158 Ga0495640_0117064 3300046533 Unclassified 1735
159 Ga0495621_0015061 3300046539 Bacteria 2460
160 Ga0495645_0007571 3300046543 Bacteria 7555
161 Ga0495667_0345687 3300046559 Bacteria 940
162 Ga0495656_0190928 3300046615 Unclassified 1012
163 Ga0495658_0121732 3300046683 Bacteria 1579
164 Ga0495669_0030611 3300046684 Bacteria 2363
165 Ga0496107_0058518 3300048910 Bacteria 2787
166 Ga0496109_0255286 3300048912 Bacteria 1651
167 Ga0496112_0519278 3300048915 Bacteria 1126
168 Ga0501034_0028992 3300049571 Bacteria 5629
169 Ga0501043_0337772 3300049579 Bacteria 1146
170 Ga0501047_0020209 3300049581 Bacteria 6394
171 Ga0501070_0268760 3300049586 Bacteria 1393
172 Ga0501071_0347962 3300049587 Bacteria 1128
173 Ga0501073_0138713 3300049589 Bacteria 1685
174 Ga0501073_0186865 3300049589 Bacteria 1434
175 Ga0501080_0482480 3300049742 Unclassified 1109
176 Ga0501083_0258684 3300049744 Bacteria 1133
177 Ga0501044_0005869 3300049823 Bacteria 13604
178 nmdc:mga05p37_184918_c1 3300050507 Bacteria 2534
179 nmdc:mga05p37_224947_c1 3300050507 Bacteria 2263
180 nmdc:mga05p37_257816_c1 3300050507 Bacteria 2089
181 nmdc:mga05p37_386278_c1 3300050507 Bacteria 1639
182 nmdc:mga05p37_4912_c1 3300050507 Bacteria 15656
183 nmdc:mga05p37_574688_c1 3300050507 Unclassified 1278
184 nmdc:mga05p37_70346_c1 3300050507 Bacteria 4304
185 nmdc:mga05p37_980264_c1 3300050507 Bacteria 901
186 nmdc:mga08y16_180040_c1 3300050511 Bacteria 2195
187 nmdc:mga08y16_22172_c1 3300050511 Bacteria 6704
188 nmdc:mga08y16_45739_c1 3300050511 Bacteria 4585
189 nmdc:mga0n895_27247_c1 3300050512 Bacteria 5426
190 nmdc:mga0n895_460449_c1 3300050512 Bacteria 1284
191 nmdc:mga0n895_557959_c1 3300050512 Bacteria 1151
192 nmdc:mga0rr50_103916_c1 3300050513 Bacteria 2237
193 nmdc:mga0rr50_169541_c1 3300050513 Unclassified 1778
194 nmdc:mga0rr50_18453_c1 3300050513 Bacteria 4688
195 nmdc:mga08x19_281345_c1 3300050514 Bacteria 1153
196 nmdc:mga08x19_48610_c1 3300050514 Bacteria 2718
197 nmdc:mga08x19_59939_c1 3300050514 Unclassified 2465
198 nmdc:mga08x19_81533_c1 3300050514 Bacteria 2125
199 nmdc:mga0a205_20402_c1 3300050515 Bacteria 4273
200 nmdc:mga0a205_35932_c1 3300050515 Bacteria 4759
201 nmdc:mga0a205_5457_c2 3300050515 Bacteria 9974
202 nmdc:mga0a205_60420_c1 3300050515 Bacteria 3661
203 nmdc:mga0a205_65063_c1 3300050515 Bacteria 3522
204 Ga0495619_0071301 3300053085 Bacteria 2325
205 Ga0070698_100037055
206 Ga0065715_10004151
207 Ga0070670_100486448
208 Ga0068869_100122412
209 Ga0068869_100404736
210 Ga0070666_10179454
211 Ga0068868_100156644
212 Ga0070689_100030081
213 Ga0070689_100056137
214 Ga0070671_100105360
215 Ga0070673_100005141
216 Ga0070688_100006828
217 Ga0070688_100421815
218 Ga0070667_100050066
219 Ga0070714_100004063
220 Ga0070711_100459847
221 Ga0070694_100005411
222 Ga0070708_100078482
223 Ga0070708_100157378
224 Ga0070708_100256872
225 Ga0070678_100047136
226 Ga0070707_100054553
227 Ga0070707_100089899
228 Ga0070698_100100638
229 Ga0070698_100176627
230 Ga0070699_100002361
231 Ga0070699_100105514
232 Ga0070699_100200024
233 Ga0070699_100230635
234 Ga0070699_100580708
235 Ga0070697_100138710
236 Ga0070697_100338052
237 Ga0070672_100101719
238 Ga0070672_100257104
239 Ga0070686_100358917
240 Ga0070695_100003611
241 Ga0070695_100107002
242 Ga0070696_100452842
243 Ga0070665_100017847
244 Ga0070704_100087004
245 Ga0070704_100412371
246 Ga0068855_100151990
247 Ga0068854_100417207
248 Ga0070702_100276369
249 Ga0068859_100618383
250 Ga0068864_100247144
251 Ga0068866_10268158
252 Ga0068851_10136733
253 Ga0068858_100154520
254 Ga0068858_100337414
255 Ga0068860_100270654
256 Ga0068860_100778890
257 Ga0068862_100117923
258 Ga0068871_100003518
259 Ga0068871_100089569
260 Ga0068871_100270302
261 Ga0075428_100566910
262 Ga0075433_10046504
263 Ga0075433_10050345
264 Ga0075434_100013104
265 Ga0075434_100026504
266 Ga0075434_100027370
267 Ga0075434_100698346
268 Ga0068865_100012501
269 Ga0075436_100025075
270 Ga0075436_100089796
271 Ga0075436_100104194
272 Ga0097620_100618397
273 Ga0075435_100006626
274 Ga0075435_100011641
275 Ga0075435_100042669
276 Ga0075435_100128300
277 Ga0075435_100191078
278 Ga0105240_10056272
279 Ga0111539_10031302
280 Ga0111539_10043073
281 Ga0105245_10085457
282 Ga0114129_10005815
283 Ga0114129_10009041
284 Ga0114129_10009110
285 Ga0114129_10087289
286 Ga0114129_10236603
287 Ga0114129_10290786
288 Ga0114129_10316756
289 Ga0114129_11133949
290 Ga0105242_10019826
291 Ga0105248_10111817
292 Ga0105248_10116519
293 Ga0105248_10162122
294 Ga0105248_10174470
295 Ga0105238_10080136
296 Ga0157369_10412019
297 Ga0157378_10032946
298 Ga0157378_10935386
299 Ga0163162_10030323
300 Ga0157375_11225469
301 Ga0163163_10122062
302 Ga0163163_10343312
303 Ga0163163_10935358
304 Ga0157380_10042447
305 Ga0157380_10185991
306 Ga0157379_10004296
307 Ga0157379_10028725
308 Ga0157376_10030993
309 Ga0157376_10094706
310 Ga0207680_10058159
311 Ga0207663_10560478
312 Ga0207662_10267851
313 Ga0207646_10008835
314 Ga0207646_10182678
315 Ga0207681_10016026
316 Ga0207650_10736606
317 Ga0207664_10089905
318 Ga0207644_10012829
319 Ga0207644_10296410
320 Ga0207686_10186814
321 Ga0207686_10446955
322 Ga0207670_10072933
323 Ga0207704_10014894
324 Ga0207691_10023566
325 Ga0207691_10344482
326 Ga0207711_10225196
327 Ga0207711_10360971
328 Ga0207689_10188611
329 Ga0207651_10180260
330 Ga0207703_10513273
331 Ga0207676_10462424
332 Ga0207683_10301395
333 Ga0268266_10012450
334 Ga0268266_10739965
335 Ga0268265_10289537
336 Ga0268264_10045228
337 Ga0373930_0001079
338 Ga0373948_0000872
339 Ga0373950_0001380
340 Ga0373928_0058873
341 Ga0373951_0000587
342 Ga0373932_0001750
343 Ga0373939_0000629
344 Ga0373941_0000065
345 Ga0373941_0019187
346 Ga0373956_0166804
347 Ga0373960_0000092
348 Ga0373942_0000398
349 Ga0373961_0001869
350 Ga0373962_0007388
351 Ga0373931_0009570
352 Ga0373947_0317634
353 Ga0373937_0197128
354 Ga0373925_0081788
355 Ga0450916_014620
356 Ga0451576_0106633
357 Ga0451576_0413605
358 Ga0451576_0758981
359 Ga0451576_0765627
360 Ga0466967_0637431
361 Ga0495652_0303005
362 Ga0495640_0117064
363 Ga0495621_0015061
364 Ga0495645_0007571
365 Ga0495667_0345687
366 Ga0495656_0190928
367 Ga0495658_0121732
368 Ga0495669_0030611
369 Ga0496107_0058518
370 Ga0496109_0255286
371 Ga0496112_0519278
372 Ga0501034_0028992
373 Ga0501043_0337772
374 Ga0501047_0020209
375 Ga0501070_0268760
376 Ga0501071_0347962
377 Ga0501073_0138713
378 Ga0501073_0186865
379 Ga0501080_0482480
380 Ga0501083_0258684
381 Ga0501044_0005869
382 nmdc:mga05p37_184918_c1
383 nmdc:mga05p37_224947_c1
384 nmdc:mga05p37_257816_c1
385 nmdc:mga05p37_386278_c1
386 nmdc:mga05p37_4912_c1
387 nmdc:mga05p37_574688_c1
388 nmdc:mga05p37_70346_c1
389 nmdc:mga05p37_980264_c1
390 nmdc:mga08y16_180040_c1
391 nmdc:mga08y16_22172_c1
392 nmdc:mga08y16_45739_c1
393 nmdc:mga0n895_27247_c1
394 nmdc:mga0n895_460449_c1
395 nmdc:mga0n895_557959_c1
396 nmdc:mga0rr50_103916_c1
397 nmdc:mga0rr50_169541_c1
398 nmdc:mga0rr50_18453_c1
399 nmdc:mga08x19_281345_c1
400 nmdc:mga08x19_48610_c1
401 nmdc:mga08x19_59939_c1
402 nmdc:mga08x19_81533_c1
403 nmdc:mga0a205_20402_c1
404 nmdc:mga0a205_35932_c1
405 nmdc:mga0a205_5457_c2
406 nmdc:mga0a205_60420_c1
407 nmdc:mga0a205_65063_c1
408 Ga0495619_0071301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20260

PUA_4

RNA methyltransferase PUA domain

54

101

0.95

PF04452

Methyltrans_RNA

RNA methyltransferase domain

108

276

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vm8-assembly3.cif.gz_B crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine 0.9002 1 240
1nxz-assembly1.cif.gz_B x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. 0.8891 1 240
5o96-assembly4.cif.gz_G structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam 0.8827 1 238
1vhy-assembly3.cif.gz_A crystal structure of haemophilus influenzae protein hi0303, pfam duf558 0.8824 2 240
5vm8-assembly3.cif.gz_B crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine 0.8824 1 240
ID Description Score Start End Superfamily
1z85B01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.9328 4 69 2.40.240.20
5vm8B02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9327 73 240 3.40.1280.10
5o96E02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9177 73 238 3.40.1280.10
1vhkA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9153 73 238 3.40.1280.10
2egwA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9146 73 236 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2V8A9D5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9493 4 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A6L8GK35-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.9466 2 201 GO:0005737
GO:0070042
GO:0070475
AF-A0A3N5NJ30-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9353 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A520W710-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.935 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A2V8A9D5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9343 4 243 GO:0005737
GO:0070042
GO:0070475

Map