F311929

General Info

Members Datasets Scaffolds Average Seq Length
203 163 406 326

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006427240
Length 385
Sequence QPSAEHRTGLLFGFAAYGIWGLFPLYWPLLEPAGAAEILAHRMVWSLVVMAVVMLVLRRRSWIRPLLRQPKRLGLIALAATAISANWGLYIWSVNSGHVVEAALGYFINPLVSIAFGVLLLRERLRPAQWVAVATGAVAVAVLTVGYGQLPWIALCLAFSFALYGLLKKHIGLDGLESLTAETTIQFLPALGFLFFLASRGDSTFTTQGTGHALLLATAGAVTALPLVCFGGAAVRLPLSTIGLLQYLTPLSQFVLGVTVFREEMPPERWAGFSLVWLALSILTWDALRTARRTRVQLRGARAAAAERAALPATALPAAEPPAAETAGTTAAEAALEIGTAAGTLPPGSGKAAAGPVAATPEHPGAAAAGAHGPAGGAETRRTSG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
22 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
23 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
27 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
28 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
29 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
30 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
31 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
32 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
33 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
34 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
35 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
43 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
46 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
47 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
48 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
49 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
53 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
56 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
57 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
58 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
62 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
68 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
104 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
107 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
108 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
109 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
110 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
111 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
112 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
113 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
114 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
117 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
118 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
119 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
120 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
121 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
122 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
123 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
124 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
125 2643221670 Streptomyces sp. Root431 Isolate Unclassified
126 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
127 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
128 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
129 2643221714 Streptomyces sp. Root264 Isolate Unclassified
130 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
131 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
132 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
133 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
134 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
135 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
136 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
137 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
138 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
139 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
140 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
141 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
142 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
143 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
144 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
145 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
146 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
147 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
148 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
149 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
150 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
151 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
152 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
153 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
154 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
155 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
156 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
157 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
158 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
159 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
160 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
161 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
162 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
163 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.85
Metatranscriptomes 0
Isolates 23.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 0
Rhizoplane 0.49
Rhizosphere 72.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000891 3300003316 Bacteria 4248
2 rootH2_10050410 3300003320 Bacteria 2552
3 rootH2_10054684 3300003320 Bacteria 10517
4 rootH2_10063510 3300003320 Bacteria 3676
5 rootH1_10042741 3300003323 Bacteria 5329
6 rootH1_10042742 3300003323 Bacteria 3978
7 Ga0070681_10400135 3300005458 Bacteria 1284
8 Ga0068853_100161049 3300005539 Bacteria 2025
9 Ga0068852_100195907 3300005616 Bacteria 1909
10 Ga0081455_10331890 3300005937 Bacteria 1079
11 Ga0075363_100073451 3300006048 Bacteria 1861
12 Ga0105241_10036916 3300009174 Bacteria 3679
13 Ga0105246_10000209 3300011119 Bacteria 29632
14 Ga0183367_1002 3300015688 Bacteria 1101531
15 Ga0207647_10026866 3300025904 Bacteria 3760
16 Ga0207654_10049723 3300025911 Bacteria 2406
17 Ga0207702_10049251 3300026078 Bacteria 3555
18 Ga0207698_10006809 3300026142 Bacteria 7146
19 Ga0307517_10017237 3300028786 Bacteria 9430
20 Ga0307515_10012023 3300028794 Bacteria 16342
21 Ga0307511_10008707 3300030521 Bacteria 10143
22 Ga0307511_10043629 3300030521 Bacteria 3742
23 Ga0307509_10067682 3300031507 Bacteria 3740
24 Ga0307509_10192393 3300031507 Bacteria 1889
25 Ga0307508_10007857 3300031616 Bacteria 9902
26 Ga0307508_10037554 3300031616 Bacteria 4355
27 Ga0307516_10023926 3300031730 Bacteria 6248
28 Ga0307516_10203814 3300031730 Bacteria 1696
29 Ga0307507_10031820 3300033179 Bacteria 5526
30 Ga0307507_10039475 3300033179 Bacteria 4764
31 Ga0307510_10017705 3300033180 Bacteria 8396
32 Ga0307510_10029505 3300033180 Bacteria 6241
33 Ga0307510_10047232 3300033180 Bacteria 4616
34 Ga0395900_0055039 3300037418 Bacteria 4096
35 Ga0395898_0324226 3300037466 Bacteria 1469
36 Ga0439436_0027172 3300041404 Bacteria 1675
37 Ga0439439_0030303 3300041406 Bacteria 1375
38 Ga0439433_0004760 3300041999 Bacteria 2917
39 Ga0439449_0000253 3300042007 Bacteria 19123
40 Ga0439449_0016767 3300042007 Bacteria 2752
41 Ga0439449_0020371 3300042007 Bacteria 2485
42 Ga0439457_000218 3300042014 Bacteria 15307
43 Ga0439457_008488 3300042014 Bacteria 2419
44 Ga0466969_0000470 3300044656 Bacteria 22150
45 Ga0466972_0006265 3300044658 Bacteria 5977
46 Ga0466972_0013944 3300044658 Bacteria 4031
47 Ga0466965_0076841 3300044683 Bacteria 1685
48 Ga0466966_0002647 3300044684 Bacteria 11730
49 Ga0466966_0009557 3300044684 Bacteria 6416
50 Ga0466961_0022457 3300044693 Bacteria 4059
51 Ga0466961_0063942 3300044693 Bacteria 2338
52 Ga0466971_0063333 3300044719 Bacteria 1674
53 Ga0466970_0153235 3300044765 Bacteria 1273
54 Ga0466957_0056205 3300044842 Bacteria 2406
55 Ga0466960_0007749 3300044901 Bacteria 4374
56 Ga0466959_0004839 3300045049 Bacteria 9102
57 Ga0466967_0051146 3300045976 Bacteria 3620
58 Ga0495617_016400 3300046452 Bacteria 2504
59 Ga0495592_0048228 3300046454 Bacteria 3169
60 Ga0495603_0014639 3300046455 Bacteria 4741
61 Ga0495629_0001337 3300046459 Bacteria 19390
62 Ga0495629_0002558 3300046459 Bacteria 13949
63 Ga0495629_0005074 3300046459 Bacteria 9853
64 Ga0495638_0062255 3300046460 Bacteria 2304
65 Ga0495651_0054662 3300046462 Bacteria 3069
66 Ga0495653_0154920 3300046463 Bacteria 1597
67 Ga0495664_0000225 3300046477 Bacteria 26888
68 Ga0495585_0054489 3300046492 Bacteria 2211
69 Ga0495594_0001573 3300046499 Bacteria 11858
70 Ga0495594_0024663 3300046499 Bacteria 3232
71 Ga0495616_0008308 3300046513 Bacteria 6158
72 Ga0495618_0050372 3300046514 Bacteria 2630
73 Ga0495628_0107012 3300046516 Bacteria 2153
74 Ga0495630_0056280 3300046517 Bacteria 2947
75 Ga0495631_0005347 3300046518 Bacteria 6738
76 Ga0495643_0007340 3300046522 Bacteria 7124
77 Ga0495666_0048654 3300046526 Bacteria 2041
78 Ga0495652_0114908 3300046529 Bacteria 2158
79 Ga0495654_0032105 3300046530 Bacteria 2662
80 Ga0495586_0020238 3300046535 Bacteria 3544
81 Ga0495587_0004120 3300046536 Bacteria 9611
82 Ga0495609_0071886 3300046538 Bacteria 1519
83 Ga0495622_0053297 3300046557 Bacteria 1876
84 Ga0495668_0039354 3300046616 Bacteria 2639
85 Ga0495634_0002030 3300046642 Bacteria 17195
86 Ga0495634_0101997 3300046642 Bacteria 1853
87 Ga0495611_0022478 3300046648 Bacteria 2729
88 Ga0495625_0022970 3300046660 Bacteria 4771
89 Ga0495625_0189793 3300046660 Bacteria 1362
90 Ga0495635_0008056 3300046663 Bacteria 7360
91 Ga0495588_0014193 3300046674 Bacteria 3809
92 Ga0495657_0039204 3300046675 Bacteria 3256
93 Ga0495646_0010192 3300046680 Bacteria 5975
94 Ga0495613_0030966 3300046689 Bacteria 3973
95 Ga0495624_0044054 3300046690 Bacteria 2845
96 Ga0495670_0022860 3300046691 Bacteria 3087
97 Ga0495671_0042553 3300046692 Bacteria 2282
98 Ga0495671_0137411 3300046692 Bacteria 1191
99 Ga0495600_0072779 3300046809 Bacteria 2244
100 Ga0495660_0068364 3300046810 Bacteria 1890
101 Ga0495581_0007557 3300047315 Bacteria 6286
102 Ga0495581_0011988 3300047315 Bacteria 5015
103 Ga0495604_0000502 3300047317 Bacteria 34488
104 Ga0495636_0046572 3300047318 Bacteria 1809
105 Ga0495676_0006189 3300047321 Bacteria 11004
106 Ga0495676_0008041 3300047321 Bacteria 9667
107 Ga0495676_0045750 3300047321 Bacteria 3558
108 Ga0495676_0081798 3300047321 Bacteria 2446
109 Ga0495676_0130142 3300047321 Bacteria 1818
110 Ga0495687_012682 3300047443 Bacteria 4443
111 Ga0495687_037507 3300047443 Bacteria 2158
112 Ga0495687_073479 3300047443 Bacteria 1363
113 Ga0495685_008550 3300047447 Bacteria 3402
114 Ga0495681_0015327 3300047470 Bacteria 4340
115 Ga0495681_0040873 3300047470 Bacteria 2254
116 Ga0495684_0125871 3300047471 Bacteria 1928
117 Ga0495593_0028792 3300047673 Bacteria 3049
118 Ga0495593_0125649 3300047673 Bacteria 1304
119 Ga0495602_0257869 3300048088 Bacteria 1295
120 Ga0495614_0000238 3300048089 Bacteria 21398
121 Ga0495614_0015885 3300048089 Bacteria 3278
122 Ga0495614_0046175 3300048089 Bacteria 1867
123 Ga0495626_0048100 3300048091 Bacteria 1980
124 Ga0501033_0007205 3300049570 Bacteria 8680
125 Ga0501033_0064342 3300049570 Bacteria 2699
126 Ga0501036_0000337 3300049572 Bacteria 32891
127 Ga0501036_0083926 3300049572 Bacteria 2693
128 Ga0501039_0060722 3300049575 Bacteria 2927
129 Ga0501043_0005221 3300049579 Bacteria 10513
130 Ga0501043_0028522 3300049579 Bacteria 4383
131 Ga0501047_0229074 3300049581 Bacteria 1712
132 Ga0501070_0001714 3300049586 Bacteria 19423
133 Ga0501072_0086283 3300049588 Bacteria 2491
134 Ga0501074_0001186 3300049590 Bacteria 17124
135 Ga0501081_0284596 3300049743 Bacteria 1211
136 Ga0501035_0040572 3300049822 Bacteria 4204
137 Ga0501035_0112144 3300049822 Bacteria 2389
138 Ga0501035_0116919 3300049822 Bacteria 2333
139 Ga0501044_0008212 3300049823 Bacteria 11455
140 Ga0501044_0051975 3300049823 Bacteria 4225
141 Ga0501044_0257911 3300049823 Bacteria 1682
142 nmdc:mga06z11_1811_c1 3300050494 Bacteria 8049
143 Ga0495612_0027121 3300053078 Bacteria 2303
144 Ga0500578_0182208 3300053086 Bacteria 1293
145 Ga0500644_0047790 3300053088 Bacteria 1453
146 Ga0500640_047706 3300053095 Bacteria 1877
147 Ga0500654_033519 3300053099 Bacteria 3046
148 Ga0500660_067241 3300053100 Bacteria 1697
149 Ga0500556_0109408 3300053104 Bacteria 1071
150 Ga0500628_034605 3300053129 Bacteria 1118
151 Ga0500652_011860 3300053131 Bacteria 3036
152 Ga0500658_0010641 3300053134 Bacteria 3393
153 Ga0500561_0001571 3300053137 Bacteria 3727
154 Ga0500600_0140872 3300053149 Bacteria 1214
155 Ga0500616_0047627 3300053153 Bacteria 2275
156 Ga0500624_017575 3300053157 Bacteria 1117
157 3006427240 3006425503 Bacteria 6491253
158 2547410034 2547132111 Bacteria 8013147
159 2585299443 2582581312 Bacteria 7308206
160 2585319528 2582581314 Bacteria 11452267
161 2616902000 2616644941 Bacteria 8510691
162 2643942059 2643221587 Bacteria 7586415
163 2644017250 2643221601 Bacteria 7493239
164 2644173789 2643221631 Bacteria 8168043
165 2644389707 2643221670 Bacteria 6497041
166 2644404643 2643221673 Bacteria 9196637
167 2644429142 2643221677 Bacteria 7584031
168 2644461321 2643221682 Bacteria 6743283
169 2644633438 2643221714 Bacteria 9015452
170 2784589654 2784132148 Bacteria 8627943
171 2785341942 2784746763 Bacteria 9783172
172 2785370709 2784746768 Bacteria 10036182
173 2786671892 2786546132 Bacteria 10419719
174 2808912839 2808606375 Bacteria 9466072
175 2811845158 2808606982 Bacteria 7791042
176 2812479504 2811994917 Bacteria 7761064
177 2852640402 2852635781 Bacteria 8251373
178 2862181706 2862178590 Bacteria 8583590
179 2873154759 2873151551 Bacteria 8625867
180 2875395961 2875391855 Bacteria 7600475
181 2912718536 2912715099 Bacteria 9460473
182 2912730861 2912723979 Bacteria 8557534
183 2946048651 2946045630 Bacteria 8527308
184 2946077025 2946072368 Bacteria 8999607
185 2954678165 2954673503 Bacteria 9685905
186 2954685994 2954682443 Bacteria 9862841
187 2954715070 2954711539 Bacteria 10867210
188 2954725012 2954721474 Bacteria 10456478
189 2954736806 2954731030 Bacteria 10243860
190 2954743945 2954740390 Bacteria 10229294
191 2954755654 2954749733 Bacteria 10366972
192 2954762886 2954759201 Bacteria 9358192
193 2966601524 2966598605 Bacteria 7676064
194 2995468627 2995463766 Bacteria 8577691
195 8023626444 8023623736 Bacteria 8593882
196 8047897043 8047893842 Bacteria 11723082
197 8048361909 8048356638 Bacteria 11044339
198 8048374027 8048369669 Bacteria 11666822
199 8048384199 8048379754 Bacteria 11877923
200 8048410768 8048406513 Bacteria 8936924
201 8056448889 8056447290 Bacteria 7680491
202 8056667939 8056667051 Bacteria 6953971
203 8056833897 8056829672 Bacteria 9045328
204 rootH1_10000891
205 rootH2_10050410
206 rootH2_10054684
207 rootH2_10063510
208 rootH1_10042741
209 rootH1_10042742
210 Ga0070681_10400135
211 Ga0068853_100161049
212 Ga0068852_100195907
213 Ga0081455_10331890
214 Ga0075363_100073451
215 Ga0105241_10036916
216 Ga0105246_10000209
217 Ga0183367_1002
218 Ga0207647_10026866
219 Ga0207654_10049723
220 Ga0207702_10049251
221 Ga0207698_10006809
222 Ga0307517_10017237
223 Ga0307515_10012023
224 Ga0307511_10008707
225 Ga0307511_10043629
226 Ga0307509_10067682
227 Ga0307509_10192393
228 Ga0307508_10007857
229 Ga0307508_10037554
230 Ga0307516_10023926
231 Ga0307516_10203814
232 Ga0307507_10031820
233 Ga0307507_10039475
234 Ga0307510_10017705
235 Ga0307510_10029505
236 Ga0307510_10047232
237 Ga0395900_0055039
238 Ga0395898_0324226
239 Ga0439436_0027172
240 Ga0439439_0030303
241 Ga0439433_0004760
242 Ga0439449_0000253
243 Ga0439449_0016767
244 Ga0439449_0020371
245 Ga0439457_000218
246 Ga0439457_008488
247 Ga0466969_0000470
248 Ga0466972_0006265
249 Ga0466972_0013944
250 Ga0466965_0076841
251 Ga0466966_0002647
252 Ga0466966_0009557
253 Ga0466961_0022457
254 Ga0466961_0063942
255 Ga0466971_0063333
256 Ga0466970_0153235
257 Ga0466957_0056205
258 Ga0466960_0007749
259 Ga0466959_0004839
260 Ga0466967_0051146
261 Ga0495617_016400
262 Ga0495592_0048228
263 Ga0495603_0014639
264 Ga0495629_0001337
265 Ga0495629_0002558
266 Ga0495629_0005074
267 Ga0495638_0062255
268 Ga0495651_0054662
269 Ga0495653_0154920
270 Ga0495664_0000225
271 Ga0495585_0054489
272 Ga0495594_0001573
273 Ga0495594_0024663
274 Ga0495616_0008308
275 Ga0495618_0050372
276 Ga0495628_0107012
277 Ga0495630_0056280
278 Ga0495631_0005347
279 Ga0495643_0007340
280 Ga0495666_0048654
281 Ga0495652_0114908
282 Ga0495654_0032105
283 Ga0495586_0020238
284 Ga0495587_0004120
285 Ga0495609_0071886
286 Ga0495622_0053297
287 Ga0495668_0039354
288 Ga0495634_0002030
289 Ga0495634_0101997
290 Ga0495611_0022478
291 Ga0495625_0022970
292 Ga0495625_0189793
293 Ga0495635_0008056
294 Ga0495588_0014193
295 Ga0495657_0039204
296 Ga0495646_0010192
297 Ga0495613_0030966
298 Ga0495624_0044054
299 Ga0495670_0022860
300 Ga0495671_0042553
301 Ga0495671_0137411
302 Ga0495600_0072779
303 Ga0495660_0068364
304 Ga0495581_0007557
305 Ga0495581_0011988
306 Ga0495604_0000502
307 Ga0495636_0046572
308 Ga0495676_0006189
309 Ga0495676_0008041
310 Ga0495676_0045750
311 Ga0495676_0081798
312 Ga0495676_0130142
313 Ga0495687_012682
314 Ga0495687_037507
315 Ga0495687_073479
316 Ga0495685_008550
317 Ga0495681_0015327
318 Ga0495681_0040873
319 Ga0495684_0125871
320 Ga0495593_0028792
321 Ga0495593_0125649
322 Ga0495602_0257869
323 Ga0495614_0000238
324 Ga0495614_0015885
325 Ga0495614_0046175
326 Ga0495626_0048100
327 Ga0501033_0007205
328 Ga0501033_0064342
329 Ga0501036_0000337
330 Ga0501036_0083926
331 Ga0501039_0060722
332 Ga0501043_0005221
333 Ga0501043_0028522
334 Ga0501047_0229074
335 Ga0501070_0001714
336 Ga0501072_0086283
337 Ga0501074_0001186
338 Ga0501081_0284596
339 Ga0501035_0040572
340 Ga0501035_0112144
341 Ga0501035_0116919
342 Ga0501044_0008212
343 Ga0501044_0051975
344 Ga0501044_0257911
345 nmdc:mga06z11_1811_c1
346 Ga0495612_0027121
347 Ga0500578_0182208
348 Ga0500644_0047790
349 Ga0500640_047706
350 Ga0500654_033519
351 Ga0500660_067241
352 Ga0500556_0109408
353 Ga0500628_034605
354 Ga0500652_011860
355 Ga0500658_0010641
356 Ga0500561_0001571
357 Ga0500600_0140872
358 Ga0500616_0047627
359 Ga0500624_017575
360 3006427240
361 2547410034
362 2585299443
363 2585319528
364 2616902000
365 2643942059
366 2644017250
367 2644173789
368 2644389707
369 2644404643
370 2644429142
371 2644461321
372 2644633438
373 2784589654
374 2785341942
375 2785370709
376 2786671892
377 2808912839
378 2811845158
379 2812479504
380 2852640402
381 2862181706
382 2873154759
383 2875395961
384 2912718536
385 2912730861
386 2946048651
387 2946077025
388 2954678165
389 2954685994
390 2954715070
391 2954725012
392 2954736806
393 2954743945
394 2954755654
395 2954762886
396 2966601524
397 2995468627
398 8023626444
399 8047897043
400 8048361909
401 8048374027
402 8048384199
403 8048410768
404 8056448889
405 8056667939
406 8056833897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

150

285

0.93

PF00892

EamA

EamA-like transporter family

7

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.6641 9 285
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.6565 9 285
7b0k-assembly1.cif.gz_A membrane protein structure 0.6449 9 287
7b0k-assembly1.cif.gz_A membrane protein structure 0.6389 9 287
5i20-assembly2.cif.gz_B crystal structure of protein 0.6366 12 285
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7421 14 285 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6789 8 294 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6521 14 285 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6259 8 294 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6054 9 287 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7Z0PXI5-F1-model_v4 EamA family transporter RarD 0.9876 4 289 GO:0005886
AF-A0A7Z7BEJ3-F1-model_v4 Chloramphenicol-sensitive protein RarD 0.978 11 298 GO:0005886
AF-A0A158AZH7-F1-model_v4 Transporter DMT superfamily protein 0.9779 11 298 GO:0005886
AF-A0A2U3H130-F1-model_v4 EamA family transporter RarD 0.9731 4 307 GO:0005886
AF-A0A0Q7K537-F1-model_v4 Protein rarD 0.972 8 306 GO:0005886

Map