F310990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 133 | 203 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100126638|Ga0068855_1001266382 |
| Length | 324 |
| Sequence | MLTGCSPEYFRGISPYTLTRLPSKALAAYSPAMPELPDITVYVEALQRRIAGATLDEVRLKTPFLLRTVDPPLSELIGRRVTAVERLGKRIVIALEGELFAVLHLMIAGRLHWKARGAKGGRSPLAEFDFSTGTLTLTEAGTKRRASLYLVRGRDGLTEHGRGGLEVLSATREEFAERLRSENHTIKRSLTDPRLFSGIGNAYSDEILHRARMSPVKLTSRLSDDEIARLFDATRSVLIEWTDRLRVEAGDGFPEKVTAFRDEMAVHGKFNQPCPVCGTPVQRIRYADNETNYCARCQTDGKLLADRALSRLLKGDWPKSIDEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 42 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 43 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 44 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 71 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 72 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 73 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 74 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 75 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 76 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 77 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 78 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 79 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 80 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 81 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 82 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 84 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 85 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 87 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 88 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 91 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 92 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 93 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 125 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 133 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 96.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10026769 | 3300005327 | Bacteria | 4630 |
| 2 | Ga0070658_10069869 | 3300005327 | Bacteria | 2874 |
| 3 | Ga0070683_100001395 | 3300005329 | Bacteria | 18548 |
| 4 | Ga0070683_100025738 | 3300005329 | Bacteria | 5289 |
| 5 | Ga0070683_100030076 | 3300005329 | Bacteria | 4925 |
| 6 | Ga0070683_100114065 | 3300005329 | Bacteria | 2551 |
| 7 | Ga0070680_100000381 | 3300005336 | Bacteria | 30057 |
| 8 | Ga0070680_100189389 | 3300005336 | Bacteria | 1733 |
| 9 | Ga0070682_100000669 | 3300005337 | Bacteria | 20609 |
| 10 | Ga0070682_100012743 | 3300005337 | Bacteria | 4826 |
| 11 | Ga0070661_100011235 | 3300005344 | Bacteria | 6239 |
| 12 | Ga0070661_100180212 | 3300005344 | Bacteria | 1607 |
| 13 | Ga0070661_100264384 | 3300005344 | Bacteria | 1331 |
| 14 | Ga0070667_100198566 | 3300005367 | Bacteria | 1779 |
| 15 | Ga0070708_100130946 | 3300005445 | Bacteria | 2321 |
| 16 | Ga0070708_100377107 | 3300005445 | Bacteria | 1337 |
| 17 | Ga0070678_100001762 | 3300005456 | Bacteria | 11660 |
| 18 | Ga0070678_100066239 | 3300005456 | Bacteria | 2685 |
| 19 | Ga0070681_10062299 | 3300005458 | Bacteria | 3704 |
| 20 | Ga0070681_10179874 | 3300005458 | Bacteria | 2036 |
| 21 | Ga0070707_100003225 | 3300005468 | Bacteria | 15444 |
| 22 | Ga0070698_100056654 | 3300005471 | Bacteria | 3971 |
| 23 | Ga0070698_100424620 | 3300005471 | Bacteria | 1264 |
| 24 | Ga0070699_100017764 | 3300005518 | Bacteria | 6108 |
| 25 | Ga0070679_100003741 | 3300005530 | Bacteria | 13951 |
| 26 | Ga0070679_100007268 | 3300005530 | Bacteria | 10343 |
| 27 | Ga0070679_100038437 | 3300005530 | Bacteria | 4758 |
| 28 | Ga0070679_100255109 | 3300005530 | Bacteria | 1709 |
| 29 | Ga0070684_100014871 | 3300005535 | Bacteria | 6316 |
| 30 | Ga0070684_100017301 | 3300005535 | Bacteria | 5913 |
| 31 | Ga0070684_100027210 | 3300005535 | Bacteria | 4824 |
| 32 | Ga0070697_100006211 | 3300005536 | Bacteria | 9246 |
| 33 | Ga0070697_100306289 | 3300005536 | Bacteria | 1366 |
| 34 | Ga0070686_100032927 | 3300005544 | Bacteria | 3182 |
| 35 | Ga0070696_100007776 | 3300005546 | Bacteria | 7153 |
| 36 | Ga0070696_100034835 | 3300005546 | Bacteria | 3465 |
| 37 | Ga0070665_100047102 | 3300005548 | Bacteria | 4328 |
| 38 | Ga0068855_100004430 | 3300005563 | Bacteria | 17159 |
| 39 | Ga0068855_100118629 | 3300005563 | Bacteria | 3030 |
| 40 | Ga0068855_100126638 | 3300005563 | Bacteria | 2920 |
| 41 | Ga0068855_100198504 | 3300005563 | Unclassified | 2260 |
| 42 | Ga0068855_100219875 | 3300005563 | Bacteria | 2131 |
| 43 | Ga0068855_100373801 | 3300005563 | Bacteria | 1566 |
| 44 | Ga0068857_100137964 | 3300005577 | Bacteria | 2203 |
| 45 | Ga0068857_100172338 | 3300005577 | Bacteria | 1967 |
| 46 | Ga0068854_100135101 | 3300005578 | Bacteria | 1887 |
| 47 | Ga0068856_100098011 | 3300005614 | Bacteria | 2921 |
| 48 | Ga0068856_100160965 | 3300005614 | Bacteria | 2255 |
| 49 | Ga0068852_100205193 | 3300005616 | Bacteria | 1867 |
| 50 | Ga0068863_100130819 | 3300005841 | Bacteria | 2396 |
| 51 | Ga0068860_100080369 | 3300005843 | Bacteria | 3101 |
| 52 | Ga0068862_100036680 | 3300005844 | Bacteria | 4156 |
| 53 | Ga0081539_10018124 | 3300005985 | Bacteria | 4902 |
| 54 | Ga0070717_10047955 | 3300006028 | Bacteria | 3502 |
| 55 | Ga0070717_10267123 | 3300006028 | Bacteria | 1515 |
| 56 | Ga0070716_100063271 | 3300006173 | Bacteria | 2148 |
| 57 | Ga0075428_100035359 | 3300006844 | Bacteria | 5507 |
| 58 | Ga0105240_10003333 | 3300009093 | Bacteria | 25003 |
| 59 | Ga0105245_10000047 | 3300009098 | Bacteria | 131670 |
| 60 | Ga0105242_10243441 | 3300009176 | Bacteria | 1618 |
| 61 | Ga0105237_10189901 | 3300009545 | Bacteria | 2054 |
| 62 | Ga0157373_10022235 | 3300013100 | Bacteria | 4602 |
| 63 | Ga0157370_10023807 | 3300013104 | Bacteria | 6075 |
| 64 | Ga0157370_10034565 | 3300013104 | Bacteria | 4919 |
| 65 | Ga0157370_10070200 | 3300013104 | Bacteria | 3307 |
| 66 | Ga0157370_10573579 | 3300013104 | Bacteria | 1034 |
| 67 | Ga0157369_10126014 | 3300013105 | Bacteria | 2715 |
| 68 | Ga0157372_10047198 | 3300013307 | Bacteria | 4784 |
| 69 | Ga0157372_10157378 | 3300013307 | Bacteria | 2625 |
| 70 | Ga0157372_10167039 | 3300013307 | Bacteria | 2545 |
| 71 | Ga0157376_10108571 | 3300014969 | Bacteria | 2438 |
| 72 | Ga0157376_10112637 | 3300014969 | Bacteria | 2397 |
| 73 | Ga0157376_10126677 | 3300014969 | Bacteria | 2272 |
| 74 | Ga0163161_10406188 | 3300017792 | Bacteria | 1093 |
| 75 | Ga0213873_10000003 | 3300021358 | Bacteria | 973849 |
| 76 | Ga0213872_10039347 | 3300021361 | Bacteria | 2158 |
| 77 | Ga0213876_10000003 | 3300021384 | Bacteria | 973849 |
| 78 | Ga0207705_10045660 | 3300025909 | Bacteria | 3148 |
| 79 | Ga0207684_10295397 | 3300025910 | Bacteria | 1397 |
| 80 | Ga0207707_10000603 | 3300025912 | Bacteria | 36181 |
| 81 | Ga0207707_10058135 | 3300025912 | Bacteria | 3365 |
| 82 | Ga0207707_10132618 | 3300025912 | Bacteria | 2179 |
| 83 | Ga0207695_10009615 | 3300025913 | Bacteria | 11935 |
| 84 | Ga0207695_10018569 | 3300025913 | Bacteria | 8034 |
| 85 | Ga0207695_10030675 | 3300025913 | Bacteria | 5915 |
| 86 | Ga0207693_10123414 | 3300025915 | Bacteria | 2034 |
| 87 | Ga0207660_10007324 | 3300025917 | Bacteria | 7141 |
| 88 | Ga0207660_10043722 | 3300025917 | Bacteria | 3148 |
| 89 | Ga0207652_10010591 | 3300025921 | Bacteria | 7421 |
| 90 | Ga0207652_10020586 | 3300025921 | Bacteria | 5435 |
| 91 | Ga0207652_10041593 | 3300025921 | Bacteria | 3908 |
| 92 | Ga0207646_10004978 | 3300025922 | Bacteria | 14192 |
| 93 | Ga0207646_10275710 | 3300025922 | Bacteria | 1520 |
| 94 | Ga0207687_10000402 | 3300025927 | Bacteria | 29381 |
| 95 | Ga0207700_10141388 | 3300025928 | Bacteria | 1978 |
| 96 | Ga0207686_10025717 | 3300025934 | Bacteria | 3428 |
| 97 | Ga0207711_10132972 | 3300025941 | Bacteria | 2232 |
| 98 | Ga0207661_10021341 | 3300025944 | Bacteria | 4850 |
| 99 | Ga0207661_10066030 | 3300025944 | Bacteria | 2938 |
| 100 | Ga0207661_10085451 | 3300025944 | Bacteria | 2615 |
| 101 | Ga0207661_10127201 | 3300025944 | Bacteria | 2177 |
| 102 | Ga0207661_10156432 | 3300025944 | Bacteria | 1975 |
| 103 | Ga0207667_10016868 | 3300025949 | Bacteria | 8238 |
| 104 | Ga0207667_10216625 | 3300025949 | Bacteria | 1962 |
| 105 | Ga0207640_10003897 | 3300025981 | Bacteria | 8055 |
| 106 | Ga0207678_10363761 | 3300026067 | Bacteria | 1249 |
| 107 | Ga0207702_10060610 | 3300026078 | Bacteria | 3225 |
| 108 | Ga0207702_10101418 | 3300026078 | Bacteria | 2541 |
| 109 | Ga0207641_10056353 | 3300026088 | Bacteria | 3340 |
| 110 | Ga0207641_10165503 | 3300026088 | Bacteria | 2014 |
| 111 | Ga0207674_10089191 | 3300026116 | Bacteria | 3076 |
| 112 | Ga0207674_10106471 | 3300026116 | Bacteria | 2782 |
| 113 | Ga0207683_10016260 | 3300026121 | Bacteria | 6330 |
| 114 | Ga0207698_10118151 | 3300026142 | Bacteria | 2239 |
| 115 | Ga0268266_10019817 | 3300028379 | Bacteria | 5732 |
| 116 | Ga0268265_10102292 | 3300028380 | Bacteria | 2317 |
| 117 | Ga0265338_10070629 | 3300028800 | Bacteria | 2992 |
| 118 | Ga0265338_10075941 | 3300028800 | Bacteria | 2849 |
| 119 | Ga0265327_10000579 | 3300031251 | Bacteria | 61985 |
| 120 | Ga0307408_100292772 | 3300031548 | Bacteria | 1360 |
| 121 | Ga0316575_10041954 | 3300031665 | Bacteria | 1811 |
| 122 | Ga0307413_10006281 | 3300031824 | Bacteria | 5402 |
| 123 | Ga0307406_10053862 | 3300031901 | Bacteria | 2565 |
| 124 | Ga0307407_10013372 | 3300031903 | Bacteria | 3982 |
| 125 | Ga0307409_100014362 | 3300031995 | Bacteria | 5148 |
| 126 | Ga0307416_100082656 | 3300032002 | Bacteria | 2721 |
| 127 | Ga0307411_10098746 | 3300032005 | Bacteria | 2059 |
| 128 | Ga0307415_100273635 | 3300032126 | Unclassified | 1384 |
| 129 | Ga0373934_0001505 | 3300035086 | Bacteria | 8552 |
| 130 | Ga0373953_0107451 | 3300035117 | Bacteria | 1178 |
| 131 | Ga0373956_0006576 | 3300035119 | Bacteria | 4658 |
| 132 | Ga0373955_0000446 | 3300035172 | Bacteria | 17485 |
| 133 | Ga0373942_0046619 | 3300035207 | Bacteria | 1202 |
| 134 | Ga0316574_0007817 | 3300035398 | Bacteria | 5893 |
| 135 | Ga0373931_0000575 | 3300035691 | Bacteria | 15197 |
| 136 | Ga0373935_0212268 | 3300035692 | Bacteria | 1342 |
| 137 | Ga0373933_0015825 | 3300035724 | Bacteria | 4209 |
| 138 | Ga0373933_0035607 | 3300035724 | Bacteria | 2908 |
| 139 | Ga0373947_0116033 | 3300035725 | Bacteria | 1697 |
| 140 | Ga0373937_0000114 | 3300036401 | Bacteria | 76751 |
| 141 | Ga0373937_0189828 | 3300036401 | Bacteria | 1930 |
| 142 | Ga0373937_0272236 | 3300036401 | Bacteria | 1598 |
| 143 | Ga0373925_0123216 | 3300037068 | Bacteria | 2014 |
| 144 | Ga0395899_0016871 | 3300037312 | Bacteria | 5567 |
| 145 | Ga0395905_0166614 | 3300037471 | Bacteria | 2071 |
| 146 | Ga0436365_0537254 | 3300039437 | Bacteria | 270734 |
| 147 | Ga0436365_1273304 | 3300039437 | Bacteria | 1636 |
| 148 | Ga0436362_0835337 | 3300039453 | Bacteria | 281342 |
| 149 | Ga0466967_0217206 | 3300045976 | Bacteria | 1815 |
| 150 | Ga0495651_0012269 | 3300046462 | Bacteria | 6604 |
| 151 | Ga0495651_0080262 | 3300046462 | Bacteria | 2465 |
| 152 | Ga0495653_0114877 | 3300046463 | Bacteria | 1928 |
| 153 | Ga0495580_0018253 | 3300046472 | Bacteria | 5225 |
| 154 | Ga0495582_0170919 | 3300046473 | Bacteria | 1237 |
| 155 | Ga0495639_0016423 | 3300046475 | Bacteria | 3214 |
| 156 | Ga0495662_0068287 | 3300046476 | Bacteria | 1721 |
| 157 | Ga0495594_0008741 | 3300046499 | Bacteria | 5221 |
| 158 | Ga0495594_0046737 | 3300046499 | Bacteria | 2377 |
| 159 | Ga0495608_0045330 | 3300046511 | Bacteria | 2931 |
| 160 | Ga0495618_0130630 | 3300046514 | Bacteria | 1607 |
| 161 | Ga0495628_0035825 | 3300046516 | Bacteria | 3986 |
| 162 | Ga0495628_0286809 | 3300046516 | Bacteria | 1221 |
| 163 | Ga0495666_0064205 | 3300046526 | Bacteria | 1753 |
| 164 | Ga0495652_0011432 | 3300046529 | Bacteria | 8030 |
| 165 | Ga0495652_0034358 | 3300046529 | Bacteria | 4419 |
| 166 | Ga0495665_0001106 | 3300046531 | Bacteria | 14258 |
| 167 | Ga0495640_0160453 | 3300046533 | Bacteria | 1441 |
| 168 | Ga0495587_0001717 | 3300046536 | Bacteria | 14625 |
| 169 | Ga0495587_0009670 | 3300046536 | Bacteria | 6167 |
| 170 | Ga0495645_0000094 | 3300046543 | Bacteria | 62240 |
| 171 | Ga0495645_0044641 | 3300046543 | Bacteria | 3232 |
| 172 | Ga0495645_0235787 | 3300046543 | Bacteria | 1223 |
| 173 | Ga0495667_0001811 | 3300046559 | Bacteria | 14191 |
| 174 | Ga0495657_0033293 | 3300046675 | Bacteria | 3589 |
| 175 | Ga0495599_0129384 | 3300046678 | Bacteria | 1568 |
| 176 | Ga0495623_0002651 | 3300046679 | Bacteria | 11814 |
| 177 | Ga0495623_0014994 | 3300046679 | Bacteria | 5009 |
| 178 | Ga0495623_0022090 | 3300046679 | Bacteria | 4109 |
| 179 | Ga0495658_0154424 | 3300046683 | Bacteria | 1412 |
| 180 | Ga0495658_0200233 | 3300046683 | Bacteria | 1244 |
| 181 | Ga0495600_0024488 | 3300046809 | Bacteria | 3886 |
| 182 | Ga0495581_0081356 | 3300047315 | Bacteria | 1875 |
| 183 | Ga0495604_0011072 | 3300047317 | Bacteria | 7159 |
| 184 | Ga0495674_0144553 | 3300047319 | Bacteria | 1997 |
| 185 | Ga0495675_0015246 | 3300047444 | Unclassified | 4858 |
| 186 | Ga0495675_0127434 | 3300047444 | Bacteria | 1583 |
| 187 | Ga0495684_0029020 | 3300047471 | Bacteria | 4245 |
| 188 | Ga0495684_0088259 | 3300047471 | Bacteria | 2350 |
| 189 | Ga0495602_0150380 | 3300048088 | Bacteria | 1831 |
| 190 | Ga0496104_0381902 | 3300048907 | Bacteria | 1321 |
| 191 | Ga0496104_0446725 | 3300048907 | Bacteria | 1205 |
| 192 | Ga0496114_0103906 | 3300048917 | Bacteria | 2429 |
| 193 | Ga0501047_0036769 | 3300049581 | Bacteria | 4733 |
| 194 | Ga0501047_0188740 | 3300049581 | Bacteria | 1925 |
| 195 | Ga0501070_0041546 | 3300049586 | Bacteria | 3831 |
| 196 | Ga0501075_0104330 | 3300049591 | Bacteria | 2154 |
| 197 | Ga0501044_0015975 | 3300049823 | Bacteria | 8077 |
| 198 | Ga0501044_0166918 | 3300049823 | Bacteria | 2175 |
| 199 | Ga0501045_0255248 | 3300049824 | Bacteria | 1305 |
| 200 | nmdc:mga05p37_272294_c1 | 3300050507 | Bacteria | 2022 |
| 201 | Ga0495612_0017339 | 3300053078 | Bacteria | 2884 |
| 202 | Ga0500568_0041671 | 3300053139 | Bacteria | 1844 |
| 203 | Ga0530510_0350907 | 3300061734 | Bacteria | 1108 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10275710 | Ga0207646_102757102 | 253 |
| 2 | 3300046683 | Ga0495658_0200233 | Ga0495658_0200233_256_1056 | 259 |
| 3 | 3300049591 | Ga0501075_0104330 | Ga0501075_0104330_25_813 | 260 |
| 4 | 3300009176 | Ga0105242_10243441 | Ga0105242_102434412 | 261 |
| 5 | 3300025934 | Ga0207686_10025717 | Ga0207686_100257171 | 261 |
| 6 | 3300005544 | Ga0070686_100032927 | Ga0070686_1000329272 | 262 |
| 7 | 3300061734 | Ga0530510_0350907 | Ga0530510_0350907_23_817 | 262 |
| 8 | 3300035207 | Ga0373942_0046619 | Ga0373942_0046619_15_839 | 267 |
| 9 | 3300032005 | Ga0307411_10098746 | Ga0307411_100987462 | 281 |
| 10 | 3300035692 | Ga0373935_0212268 | Ga0373935_0212268_14_883 | 282 |
| 11 | 3300048917 | Ga0496114_0103906 | Ga0496114_0103906_525_1406 | 282 |
| 12 | 3300005841 | Ga0068863_100130819 | Ga0068863_1001308192 | 290 |
| 13 | 3300005844 | Ga0068862_100036680 | Ga0068862_1000366803 | 290 |
| 14 | 3300026088 | Ga0207641_10056353 | Ga0207641_100563532 | 290 |
| 15 | 3300028380 | Ga0268265_10102292 | Ga0268265_101022922 | 290 |
| 16 | 3300005445 | Ga0070708_100130946 | Ga0070708_1001309462 | 291 |
| 17 | 3300005456 | Ga0070678_100066239 | Ga0070678_1000662392 | 291 |
| 18 | 3300005471 | Ga0070698_100056654 | Ga0070698_1000566544 | 291 |
| 19 | 3300005536 | Ga0070697_100306289 | Ga0070697_1003062891 | 291 |
| 20 | 3300005546 | Ga0070696_100034835 | Ga0070696_1000348352 | 291 |
| 21 | 3300005577 | Ga0068857_100172338 | Ga0068857_1001723382 | 291 |
| 22 | 3300025910 | Ga0207684_10295397 | Ga0207684_102953972 | 291 |
| 23 | 3300025941 | Ga0207711_10132972 | Ga0207711_101329722 | 291 |
| 24 | 3300026121 | Ga0207683_10016260 | Ga0207683_100162606 | 291 |
| 25 | 3300005327 | Ga0070658_10026769 | Ga0070658_100267693 | 292 |
| 26 | 3300005327 | Ga0070658_10069869 | Ga0070658_100698691 | 292 |
| 27 | 3300005329 | Ga0070683_100001395 | Ga0070683_1000013958 | 292 |
| 28 | 3300005329 | Ga0070683_100025738 | Ga0070683_1000257384 | 292 |
| 29 | 3300005329 | Ga0070683_100030076 | Ga0070683_1000300763 | 292 |
| 30 | 3300005329 | Ga0070683_100114065 | Ga0070683_1001140652 | 292 |
| 31 | 3300005336 | Ga0070680_100000381 | Ga0070680_1000003819 | 292 |
| 32 | 3300005336 | Ga0070680_100189389 | Ga0070680_1001893892 | 292 |
| 33 | 3300005337 | Ga0070682_100000669 | Ga0070682_1000006692 | 292 |
| 34 | 3300005337 | Ga0070682_100012743 | Ga0070682_1000127431 | 292 |
| 35 | 3300005344 | Ga0070661_100011235 | Ga0070661_1000112353 | 292 |
| 36 | 3300005344 | Ga0070661_100180212 | Ga0070661_1001802122 | 292 |
| 37 | 3300005344 | Ga0070661_100264384 | Ga0070661_1002643841 | 292 |
| 38 | 3300005367 | Ga0070667_100198566 | Ga0070667_1001985662 | 292 |
| 39 | 3300005445 | Ga0070708_100377107 | Ga0070708_1003771072 | 292 |
| 40 | 3300005456 | Ga0070678_100001762 | Ga0070678_1000017629 | 292 |
| 41 | 3300005458 | Ga0070681_10062299 | Ga0070681_100622993 | 292 |
| 42 | 3300005458 | Ga0070681_10179874 | Ga0070681_101798741 | 292 |
| 43 | 3300005468 | Ga0070707_100003225 | Ga0070707_1000032252 | 292 |
| 44 | 3300005471 | Ga0070698_100424620 | Ga0070698_1004246202 | 292 |
| 45 | 3300005518 | Ga0070699_100017764 | Ga0070699_1000177642 | 292 |
| 46 | 3300005530 | Ga0070679_100003741 | Ga0070679_1000037411 | 292 |
| 47 | 3300005530 | Ga0070679_100007268 | Ga0070679_1000072681 | 292 |
| 48 | 3300005530 | Ga0070679_100038437 | Ga0070679_1000384373 | 292 |
| 49 | 3300005530 | Ga0070679_100255109 | Ga0070679_1002551092 | 292 |
| 50 | 3300005535 | Ga0070684_100014871 | Ga0070684_1000148713 | 292 |
| 51 | 3300005535 | Ga0070684_100017301 | Ga0070684_1000173013 | 292 |
| 52 | 3300005535 | Ga0070684_100027210 | Ga0070684_1000272104 | 292 |
| 53 | 3300005536 | Ga0070697_100006211 | Ga0070697_1000062117 | 292 |
| 54 | 3300005546 | Ga0070696_100007776 | Ga0070696_1000077766 | 292 |
| 55 | 3300005548 | Ga0070665_100047102 | Ga0070665_1000471023 | 292 |
| 56 | 3300005563 | Ga0068855_100004430 | Ga0068855_1000044306 | 292 |
| 57 | 3300005563 | Ga0068855_100118629 | Ga0068855_1001186291 | 292 |
| 58 | 3300005563 | Ga0068855_100126638 | Ga0068855_1001266382 | 292 |
| 59 | 3300005563 | Ga0068855_100198504 | Ga0068855_1001985042 | 292 |
| 60 | 3300005563 | Ga0068855_100219875 | Ga0068855_1002198753 | 292 |
| 61 | 3300005563 | Ga0068855_100373801 | Ga0068855_1003738012 | 292 |
| 62 | 3300005577 | Ga0068857_100137964 | Ga0068857_1001379642 | 292 |
| 63 | 3300005578 | Ga0068854_100135101 | Ga0068854_1001351012 | 292 |
| 64 | 3300005614 | Ga0068856_100098011 | Ga0068856_1000980112 | 292 |
| 65 | 3300005614 | Ga0068856_100160965 | Ga0068856_1001609651 | 292 |
| 66 | 3300005616 | Ga0068852_100205193 | Ga0068852_1002051932 | 292 |
| 67 | 3300005843 | Ga0068860_100080369 | Ga0068860_1000803692 | 292 |
| 68 | 3300005985 | Ga0081539_10018124 | Ga0081539_100181242 | 292 |
| 69 | 3300006028 | Ga0070717_10047955 | Ga0070717_100479552 | 292 |
| 70 | 3300006028 | Ga0070717_10267123 | Ga0070717_102671232 | 292 |
| 71 | 3300006173 | Ga0070716_100063271 | Ga0070716_1000632712 | 292 |
| 72 | 3300006844 | Ga0075428_100035359 | Ga0075428_1000353595 | 292 |
| 73 | 3300009093 | Ga0105240_10003333 | Ga0105240_1000333317 | 292 |
| 74 | 3300009098 | Ga0105245_10000047 | Ga0105245_100000473 | 292 |
| 75 | 3300009545 | Ga0105237_10189901 | Ga0105237_101899012 | 292 |
| 76 | 3300013100 | Ga0157373_10022235 | Ga0157373_100222352 | 292 |
| 77 | 3300013104 | Ga0157370_10023807 | Ga0157370_100238073 | 292 |
| 78 | 3300013104 | Ga0157370_10034565 | Ga0157370_100345653 | 292 |
| 79 | 3300013104 | Ga0157370_10070200 | Ga0157370_100702004 | 292 |
| 80 | 3300013104 | Ga0157370_10573579 | Ga0157370_105735791 | 292 |
| 81 | 3300013105 | Ga0157369_10126014 | Ga0157369_101260142 | 292 |
| 82 | 3300013307 | Ga0157372_10047198 | Ga0157372_100471983 | 292 |
| 83 | 3300013307 | Ga0157372_10157378 | Ga0157372_101573782 | 292 |
| 84 | 3300013307 | Ga0157372_10167039 | Ga0157372_101670393 | 292 |
| 85 | 3300014969 | Ga0157376_10108571 | Ga0157376_101085713 | 292 |
| 86 | 3300014969 | Ga0157376_10112637 | Ga0157376_101126372 | 292 |
| 87 | 3300014969 | Ga0157376_10126677 | Ga0157376_101266772 | 292 |
| 88 | 3300017792 | Ga0163161_10406188 | Ga0163161_104061881 | 292 |
| 89 | 3300021358 | Ga0213873_10000003 | Ga0213873_10000003284 | 292 |
| 90 | 3300021361 | Ga0213872_10039347 | Ga0213872_100393472 | 292 |
| 91 | 3300021384 | Ga0213876_10000003 | Ga0213876_10000003584 | 292 |
| 92 | 3300025909 | Ga0207705_10045660 | Ga0207705_100456603 | 292 |
| 93 | 3300025912 | Ga0207707_10000603 | Ga0207707_100006036 | 292 |
| 94 | 3300025912 | Ga0207707_10058135 | Ga0207707_100581352 | 292 |
| 95 | 3300025912 | Ga0207707_10132618 | Ga0207707_101326183 | 292 |
| 96 | 3300025913 | Ga0207695_10009615 | Ga0207695_1000961510 | 292 |
| 97 | 3300025913 | Ga0207695_10018569 | Ga0207695_100185695 | 292 |
| 98 | 3300025913 | Ga0207695_10030675 | Ga0207695_100306754 | 292 |
| 99 | 3300025915 | Ga0207693_10123414 | Ga0207693_101234142 | 292 |
| 100 | 3300025917 | Ga0207660_10007324 | Ga0207660_100073243 | 292 |
| 101 | 3300025917 | Ga0207660_10043722 | Ga0207660_100437222 | 292 |
| 102 | 3300025921 | Ga0207652_10010591 | Ga0207652_100105912 | 292 |
| 103 | 3300025921 | Ga0207652_10020586 | Ga0207652_100205863 | 292 |
| 104 | 3300025921 | Ga0207652_10041593 | Ga0207652_100415931 | 292 |
| 105 | 3300025922 | Ga0207646_10004978 | Ga0207646_100049781 | 292 |
| 106 | 3300025927 | Ga0207687_10000402 | Ga0207687_1000040213 | 292 |
| 107 | 3300025928 | Ga0207700_10141388 | Ga0207700_101413881 | 292 |
| 108 | 3300025944 | Ga0207661_10021341 | Ga0207661_100213413 | 292 |
| 109 | 3300025944 | Ga0207661_10066030 | Ga0207661_100660304 | 292 |
| 110 | 3300025944 | Ga0207661_10085451 | Ga0207661_100854512 | 292 |
| 111 | 3300025944 | Ga0207661_10127201 | Ga0207661_101272012 | 292 |
| 112 | 3300025944 | Ga0207661_10156432 | Ga0207661_101564323 | 292 |
| 113 | 3300025949 | Ga0207667_10016868 | Ga0207667_100168685 | 292 |
| 114 | 3300025949 | Ga0207667_10216625 | Ga0207667_102166252 | 292 |
| 115 | 3300025981 | Ga0207640_10003897 | Ga0207640_100038976 | 292 |
| 116 | 3300026067 | Ga0207678_10363761 | Ga0207678_103637611 | 292 |
| 117 | 3300026078 | Ga0207702_10060610 | Ga0207702_100606103 | 292 |
| 118 | 3300026078 | Ga0207702_10101418 | Ga0207702_101014181 | 292 |
| 119 | 3300026088 | Ga0207641_10165503 | Ga0207641_101655032 | 292 |
| 120 | 3300026116 | Ga0207674_10089191 | Ga0207674_100891912 | 292 |
| 121 | 3300026116 | Ga0207674_10106471 | Ga0207674_101064713 | 292 |
| 122 | 3300026142 | Ga0207698_10118151 | Ga0207698_101181512 | 292 |
| 123 | 3300028379 | Ga0268266_10019817 | Ga0268266_100198172 | 292 |
| 124 | 3300028800 | Ga0265338_10070629 | Ga0265338_100706293 | 292 |
| 125 | 3300028800 | Ga0265338_10075941 | Ga0265338_100759412 | 292 |
| 126 | 3300031251 | Ga0265327_10000579 | Ga0265327_100005792 | 292 |
| 127 | 3300031548 | Ga0307408_100292772 | Ga0307408_1002927722 | 292 |
| 128 | 3300031665 | Ga0316575_10041954 | Ga0316575_100419541 | 292 |
| 129 | 3300031824 | Ga0307413_10006281 | Ga0307413_100062814 | 292 |
| 130 | 3300031901 | Ga0307406_10053862 | Ga0307406_100538622 | 292 |
| 131 | 3300031903 | Ga0307407_10013372 | Ga0307407_100133722 | 292 |
| 132 | 3300031995 | Ga0307409_100014362 | Ga0307409_1000143623 | 292 |
| 133 | 3300032002 | Ga0307416_100082656 | Ga0307416_1000826562 | 292 |
| 134 | 3300032126 | Ga0307415_100273635 | Ga0307415_1002736352 | 292 |
| 135 | 3300035086 | Ga0373934_0001505 | Ga0373934_0001505_4229_5128 | 292 |
| 136 | 3300035117 | Ga0373953_0107451 | Ga0373953_0107451_132_1031 | 292 |
| 137 | 3300035119 | Ga0373956_0006576 | Ga0373956_0006576_2806_3690 | 292 |
| 138 | 3300035172 | Ga0373955_0000446 | Ga0373955_0000446_10131_11015 | 292 |
| 139 | 3300035398 | Ga0316574_0007817 | Ga0316574_0007817_4909_5811 | 292 |
| 140 | 3300035691 | Ga0373931_0000575 | Ga0373931_0000575_6980_7867 | 292 |
| 141 | 3300035724 | Ga0373933_0015825 | Ga0373933_0015825_553_1452 | 292 |
| 142 | 3300035724 | Ga0373933_0035607 | Ga0373933_0035607_961_1845 | 292 |
| 143 | 3300035725 | Ga0373947_0116033 | Ga0373947_0116033_24_938 | 292 |
| 144 | 3300036401 | Ga0373937_0000114 | Ga0373937_0000114_24801_25685 | 292 |
| 145 | 3300036401 | Ga0373937_0189828 | Ga0373937_0189828_326_1225 | 292 |
| 146 | 3300036401 | Ga0373937_0272236 | Ga0373937_0272236_123_1022 | 292 |
| 147 | 3300037068 | Ga0373925_0123216 | Ga0373925_0123216_1080_1997 | 292 |
| 148 | 3300037312 | Ga0395899_0016871 | Ga0395899_0016871_2853_3800 | 292 |
| 149 | 3300037471 | Ga0395905_0166614 | Ga0395905_0166614_1061_1972 | 292 |
| 150 | 3300039437 | Ga0436365_0537254 | Ga0436365_0537254_222418_223299 | 292 |
| 151 | 3300039437 | Ga0436365_1273304 | Ga0436365_1273304_228_1109 | 292 |
| 152 | 3300039453 | Ga0436362_0835337 | Ga0436362_0835337_51221_52102 | 292 |
| 153 | 3300045976 | Ga0466967_0217206 | Ga0466967_0217206_634_1542 | 292 |
| 154 | 3300046462 | Ga0495651_0012269 | Ga0495651_0012269_272_1171 | 292 |
| 155 | 3300046462 | Ga0495651_0080262 | Ga0495651_0080262_664_1548 | 292 |
| 156 | 3300046463 | Ga0495653_0114877 | Ga0495653_0114877_510_1409 | 292 |
| 157 | 3300046472 | Ga0495580_0018253 | Ga0495580_0018253_3702_4601 | 292 |
| 158 | 3300046473 | Ga0495582_0170919 | Ga0495582_0170919_128_1045 | 292 |
| 159 | 3300046475 | Ga0495639_0016423 | Ga0495639_0016423_792_1691 | 292 |
| 160 | 3300046476 | Ga0495662_0068287 | Ga0495662_0068287_297_1214 | 292 |
| 161 | 3300046499 | Ga0495594_0008741 | Ga0495594_0008741_2772_3671 | 292 |
| 162 | 3300046499 | Ga0495594_0046737 | Ga0495594_0046737_26_910 | 292 |
| 163 | 3300046511 | Ga0495608_0045330 | Ga0495608_0045330_2013_2912 | 292 |
| 164 | 3300046514 | Ga0495618_0130630 | Ga0495618_0130630_338_1237 | 292 |
| 165 | 3300046516 | Ga0495628_0035825 | Ga0495628_0035825_2196_3095 | 292 |
| 166 | 3300046516 | Ga0495628_0286809 | Ga0495628_0286809_12_896 | 292 |
| 167 | 3300046526 | Ga0495666_0064205 | Ga0495666_0064205_670_1569 | 292 |
| 168 | 3300046529 | Ga0495652_0011432 | Ga0495652_0011432_3095_3979 | 292 |
| 169 | 3300046529 | Ga0495652_0034358 | Ga0495652_0034358_1148_2047 | 292 |
| 170 | 3300046531 | Ga0495665_0001106 | Ga0495665_0001106_2899_3798 | 292 |
| 171 | 3300046533 | Ga0495640_0160453 | Ga0495640_0160453_373_1272 | 292 |
| 172 | 3300046536 | Ga0495587_0001717 | Ga0495587_0001717_4796_5680 | 292 |
| 173 | 3300046536 | Ga0495587_0009670 | Ga0495587_0009670_4252_5151 | 292 |
| 174 | 3300046543 | Ga0495645_0000094 | Ga0495645_0000094_13826_14710 | 292 |
| 175 | 3300046543 | Ga0495645_0044641 | Ga0495645_0044641_377_1276 | 292 |
| 176 | 3300046543 | Ga0495645_0235787 | Ga0495645_0235787_32_931 | 292 |
| 177 | 3300046559 | Ga0495667_0001811 | Ga0495667_0001811_4581_5465 | 292 |
| 178 | 3300046675 | Ga0495657_0033293 | Ga0495657_0033293_1243_2142 | 292 |
| 179 | 3300046678 | Ga0495599_0129384 | Ga0495599_0129384_105_1004 | 292 |
| 180 | 3300046679 | Ga0495623_0002651 | Ga0495623_0002651_7908_8792 | 292 |
| 181 | 3300046679 | Ga0495623_0014994 | Ga0495623_0014994_3846_4745 | 292 |
| 182 | 3300046679 | Ga0495623_0022090 | Ga0495623_0022090_2194_3093 | 292 |
| 183 | 3300046683 | Ga0495658_0154424 | Ga0495658_0154424_38_955 | 292 |
| 184 | 3300046809 | Ga0495600_0024488 | Ga0495600_0024488_2869_3753 | 292 |
| 185 | 3300047315 | Ga0495581_0081356 | Ga0495581_0081356_642_1559 | 292 |
| 186 | 3300047317 | Ga0495604_0011072 | Ga0495604_0011072_3273_4172 | 292 |
| 187 | 3300047319 | Ga0495674_0144553 | Ga0495674_0144553_735_1652 | 292 |
| 188 | 3300047444 | Ga0495675_0015246 | Ga0495675_0015246_1101_1985 | 292 |
| 189 | 3300047444 | Ga0495675_0127434 | Ga0495675_0127434_132_1031 | 292 |
| 190 | 3300047471 | Ga0495684_0029020 | Ga0495684_0029020_1692_2591 | 292 |
| 191 | 3300047471 | Ga0495684_0088259 | Ga0495684_0088259_1178_2062 | 292 |
| 192 | 3300048088 | Ga0495602_0150380 | Ga0495602_0150380_377_1276 | 292 |
| 193 | 3300048907 | Ga0496104_0381902 | Ga0496104_0381902_31_963 | 292 |
| 194 | 3300048907 | Ga0496104_0446725 | Ga0496104_0446725_243_1127 | 292 |
| 195 | 3300049581 | Ga0501047_0036769 | Ga0501047_0036769_3678_4601 | 292 |
| 196 | 3300049581 | Ga0501047_0188740 | Ga0501047_0188740_133_1146 | 292 |
| 197 | 3300049586 | Ga0501070_0041546 | Ga0501070_0041546_2371_3294 | 292 |
| 198 | 3300049823 | Ga0501044_0015975 | Ga0501044_0015975_1353_2276 | 292 |
| 199 | 3300049823 | Ga0501044_0166918 | Ga0501044_0166918_1185_2096 | 292 |
| 200 | 3300049824 | Ga0501045_0255248 | Ga0501045_0255248_57_941 | 292 |
| 201 | 3300050507 | nmdc:mga05p37_272294_c1 | nmdc:mga05p37_272294_c1_1051_1950 | 292 |
| 202 | 3300053078 | Ga0495612_0017339 | Ga0495612_0017339_252_1151 | 292 |
| 203 | 3300053139 | Ga0500568_0041671 | Ga0500568_0041671_116_1153 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7af3-assembly1.cif.gz_M | bacterial 30s ribosomal subunit assembly complex state m (head domain) | 0.9446 | 150 | 204 |
| 4v5z-assembly1.cif.gz_Am | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.928 | 152 | 200 |
| 4v7h-assembly1.cif.gz_AM | structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution | 0.8876 | 151 | 200 |
| 8qpp-assembly1.cif.gz_M | bacillus subtilis muts2-collided disome complex (stalled 70s) | 0.8797 | 151 | 204 |
| 2xzu-assembly1.cif.gz_A | crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k | 0.8776 | 2 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xnqM01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9272 | 150 | 200 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9208 | 166 | 204 | 1.10.8.50 |
| 2y10M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9184 | 151 | 205 | 1.10.8.50 |
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8875 | 132 | 266 | 1.10.8.50 |
| af_P9WH61_1_72_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8867 | 151 | 204 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6X5E8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9858 | 1 | 213 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7C4U9B8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.979 | 1 | 266 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A536SPC1-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.978 | 1 | 292 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A538QIF5-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9778 | 1 | 291 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7Y1SVG2-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9774 | 1 | 209 |
GO:0003684
GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0034039 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar