F310990

General Info

Members Datasets Scaffolds Average Seq Length
203 133 203 297

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100126638|Ga0068855_1001266382
Length 324
Sequence MLTGCSPEYFRGISPYTLTRLPSKALAAYSPAMPELPDITVYVEALQRRIAGATLDEVRLKTPFLLRTVDPPLSELIGRRVTAVERLGKRIVIALEGELFAVLHLMIAGRLHWKARGAKGGRSPLAEFDFSTGTLTLTEAGTKRRASLYLVRGRDGLTEHGRGGLEVLSATREEFAERLRSENHTIKRSLTDPRLFSGIGNAYSDEILHRARMSPVKLTSRLSDDEIARLFDATRSVLIEWTDRLRVEAGDGFPEKVTAFRDEMAVHGKFNQPCPVCGTPVQRIRYADNETNYCARCQTDGKLLADRALSRLLKGDWPKSIDEL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10026769 3300005327 Bacteria 4630
2 Ga0070658_10069869 3300005327 Bacteria 2874
3 Ga0070683_100001395 3300005329 Bacteria 18548
4 Ga0070683_100025738 3300005329 Bacteria 5289
5 Ga0070683_100030076 3300005329 Bacteria 4925
6 Ga0070683_100114065 3300005329 Bacteria 2551
7 Ga0070680_100000381 3300005336 Bacteria 30057
8 Ga0070680_100189389 3300005336 Bacteria 1733
9 Ga0070682_100000669 3300005337 Bacteria 20609
10 Ga0070682_100012743 3300005337 Bacteria 4826
11 Ga0070661_100011235 3300005344 Bacteria 6239
12 Ga0070661_100180212 3300005344 Bacteria 1607
13 Ga0070661_100264384 3300005344 Bacteria 1331
14 Ga0070667_100198566 3300005367 Bacteria 1779
15 Ga0070708_100130946 3300005445 Bacteria 2321
16 Ga0070708_100377107 3300005445 Bacteria 1337
17 Ga0070678_100001762 3300005456 Bacteria 11660
18 Ga0070678_100066239 3300005456 Bacteria 2685
19 Ga0070681_10062299 3300005458 Bacteria 3704
20 Ga0070681_10179874 3300005458 Bacteria 2036
21 Ga0070707_100003225 3300005468 Bacteria 15444
22 Ga0070698_100056654 3300005471 Bacteria 3971
23 Ga0070698_100424620 3300005471 Bacteria 1264
24 Ga0070699_100017764 3300005518 Bacteria 6108
25 Ga0070679_100003741 3300005530 Bacteria 13951
26 Ga0070679_100007268 3300005530 Bacteria 10343
27 Ga0070679_100038437 3300005530 Bacteria 4758
28 Ga0070679_100255109 3300005530 Bacteria 1709
29 Ga0070684_100014871 3300005535 Bacteria 6316
30 Ga0070684_100017301 3300005535 Bacteria 5913
31 Ga0070684_100027210 3300005535 Bacteria 4824
32 Ga0070697_100006211 3300005536 Bacteria 9246
33 Ga0070697_100306289 3300005536 Bacteria 1366
34 Ga0070686_100032927 3300005544 Bacteria 3182
35 Ga0070696_100007776 3300005546 Bacteria 7153
36 Ga0070696_100034835 3300005546 Bacteria 3465
37 Ga0070665_100047102 3300005548 Bacteria 4328
38 Ga0068855_100004430 3300005563 Bacteria 17159
39 Ga0068855_100118629 3300005563 Bacteria 3030
40 Ga0068855_100126638 3300005563 Bacteria 2920
41 Ga0068855_100198504 3300005563 Unclassified 2260
42 Ga0068855_100219875 3300005563 Bacteria 2131
43 Ga0068855_100373801 3300005563 Bacteria 1566
44 Ga0068857_100137964 3300005577 Bacteria 2203
45 Ga0068857_100172338 3300005577 Bacteria 1967
46 Ga0068854_100135101 3300005578 Bacteria 1887
47 Ga0068856_100098011 3300005614 Bacteria 2921
48 Ga0068856_100160965 3300005614 Bacteria 2255
49 Ga0068852_100205193 3300005616 Bacteria 1867
50 Ga0068863_100130819 3300005841 Bacteria 2396
51 Ga0068860_100080369 3300005843 Bacteria 3101
52 Ga0068862_100036680 3300005844 Bacteria 4156
53 Ga0081539_10018124 3300005985 Bacteria 4902
54 Ga0070717_10047955 3300006028 Bacteria 3502
55 Ga0070717_10267123 3300006028 Bacteria 1515
56 Ga0070716_100063271 3300006173 Bacteria 2148
57 Ga0075428_100035359 3300006844 Bacteria 5507
58 Ga0105240_10003333 3300009093 Bacteria 25003
59 Ga0105245_10000047 3300009098 Bacteria 131670
60 Ga0105242_10243441 3300009176 Bacteria 1618
61 Ga0105237_10189901 3300009545 Bacteria 2054
62 Ga0157373_10022235 3300013100 Bacteria 4602
63 Ga0157370_10023807 3300013104 Bacteria 6075
64 Ga0157370_10034565 3300013104 Bacteria 4919
65 Ga0157370_10070200 3300013104 Bacteria 3307
66 Ga0157370_10573579 3300013104 Bacteria 1034
67 Ga0157369_10126014 3300013105 Bacteria 2715
68 Ga0157372_10047198 3300013307 Bacteria 4784
69 Ga0157372_10157378 3300013307 Bacteria 2625
70 Ga0157372_10167039 3300013307 Bacteria 2545
71 Ga0157376_10108571 3300014969 Bacteria 2438
72 Ga0157376_10112637 3300014969 Bacteria 2397
73 Ga0157376_10126677 3300014969 Bacteria 2272
74 Ga0163161_10406188 3300017792 Bacteria 1093
75 Ga0213873_10000003 3300021358 Bacteria 973849
76 Ga0213872_10039347 3300021361 Bacteria 2158
77 Ga0213876_10000003 3300021384 Bacteria 973849
78 Ga0207705_10045660 3300025909 Bacteria 3148
79 Ga0207684_10295397 3300025910 Bacteria 1397
80 Ga0207707_10000603 3300025912 Bacteria 36181
81 Ga0207707_10058135 3300025912 Bacteria 3365
82 Ga0207707_10132618 3300025912 Bacteria 2179
83 Ga0207695_10009615 3300025913 Bacteria 11935
84 Ga0207695_10018569 3300025913 Bacteria 8034
85 Ga0207695_10030675 3300025913 Bacteria 5915
86 Ga0207693_10123414 3300025915 Bacteria 2034
87 Ga0207660_10007324 3300025917 Bacteria 7141
88 Ga0207660_10043722 3300025917 Bacteria 3148
89 Ga0207652_10010591 3300025921 Bacteria 7421
90 Ga0207652_10020586 3300025921 Bacteria 5435
91 Ga0207652_10041593 3300025921 Bacteria 3908
92 Ga0207646_10004978 3300025922 Bacteria 14192
93 Ga0207646_10275710 3300025922 Bacteria 1520
94 Ga0207687_10000402 3300025927 Bacteria 29381
95 Ga0207700_10141388 3300025928 Bacteria 1978
96 Ga0207686_10025717 3300025934 Bacteria 3428
97 Ga0207711_10132972 3300025941 Bacteria 2232
98 Ga0207661_10021341 3300025944 Bacteria 4850
99 Ga0207661_10066030 3300025944 Bacteria 2938
100 Ga0207661_10085451 3300025944 Bacteria 2615
101 Ga0207661_10127201 3300025944 Bacteria 2177
102 Ga0207661_10156432 3300025944 Bacteria 1975
103 Ga0207667_10016868 3300025949 Bacteria 8238
104 Ga0207667_10216625 3300025949 Bacteria 1962
105 Ga0207640_10003897 3300025981 Bacteria 8055
106 Ga0207678_10363761 3300026067 Bacteria 1249
107 Ga0207702_10060610 3300026078 Bacteria 3225
108 Ga0207702_10101418 3300026078 Bacteria 2541
109 Ga0207641_10056353 3300026088 Bacteria 3340
110 Ga0207641_10165503 3300026088 Bacteria 2014
111 Ga0207674_10089191 3300026116 Bacteria 3076
112 Ga0207674_10106471 3300026116 Bacteria 2782
113 Ga0207683_10016260 3300026121 Bacteria 6330
114 Ga0207698_10118151 3300026142 Bacteria 2239
115 Ga0268266_10019817 3300028379 Bacteria 5732
116 Ga0268265_10102292 3300028380 Bacteria 2317
117 Ga0265338_10070629 3300028800 Bacteria 2992
118 Ga0265338_10075941 3300028800 Bacteria 2849
119 Ga0265327_10000579 3300031251 Bacteria 61985
120 Ga0307408_100292772 3300031548 Bacteria 1360
121 Ga0316575_10041954 3300031665 Bacteria 1811
122 Ga0307413_10006281 3300031824 Bacteria 5402
123 Ga0307406_10053862 3300031901 Bacteria 2565
124 Ga0307407_10013372 3300031903 Bacteria 3982
125 Ga0307409_100014362 3300031995 Bacteria 5148
126 Ga0307416_100082656 3300032002 Bacteria 2721
127 Ga0307411_10098746 3300032005 Bacteria 2059
128 Ga0307415_100273635 3300032126 Unclassified 1384
129 Ga0373934_0001505 3300035086 Bacteria 8552
130 Ga0373953_0107451 3300035117 Bacteria 1178
131 Ga0373956_0006576 3300035119 Bacteria 4658
132 Ga0373955_0000446 3300035172 Bacteria 17485
133 Ga0373942_0046619 3300035207 Bacteria 1202
134 Ga0316574_0007817 3300035398 Bacteria 5893
135 Ga0373931_0000575 3300035691 Bacteria 15197
136 Ga0373935_0212268 3300035692 Bacteria 1342
137 Ga0373933_0015825 3300035724 Bacteria 4209
138 Ga0373933_0035607 3300035724 Bacteria 2908
139 Ga0373947_0116033 3300035725 Bacteria 1697
140 Ga0373937_0000114 3300036401 Bacteria 76751
141 Ga0373937_0189828 3300036401 Bacteria 1930
142 Ga0373937_0272236 3300036401 Bacteria 1598
143 Ga0373925_0123216 3300037068 Bacteria 2014
144 Ga0395899_0016871 3300037312 Bacteria 5567
145 Ga0395905_0166614 3300037471 Bacteria 2071
146 Ga0436365_0537254 3300039437 Bacteria 270734
147 Ga0436365_1273304 3300039437 Bacteria 1636
148 Ga0436362_0835337 3300039453 Bacteria 281342
149 Ga0466967_0217206 3300045976 Bacteria 1815
150 Ga0495651_0012269 3300046462 Bacteria 6604
151 Ga0495651_0080262 3300046462 Bacteria 2465
152 Ga0495653_0114877 3300046463 Bacteria 1928
153 Ga0495580_0018253 3300046472 Bacteria 5225
154 Ga0495582_0170919 3300046473 Bacteria 1237
155 Ga0495639_0016423 3300046475 Bacteria 3214
156 Ga0495662_0068287 3300046476 Bacteria 1721
157 Ga0495594_0008741 3300046499 Bacteria 5221
158 Ga0495594_0046737 3300046499 Bacteria 2377
159 Ga0495608_0045330 3300046511 Bacteria 2931
160 Ga0495618_0130630 3300046514 Bacteria 1607
161 Ga0495628_0035825 3300046516 Bacteria 3986
162 Ga0495628_0286809 3300046516 Bacteria 1221
163 Ga0495666_0064205 3300046526 Bacteria 1753
164 Ga0495652_0011432 3300046529 Bacteria 8030
165 Ga0495652_0034358 3300046529 Bacteria 4419
166 Ga0495665_0001106 3300046531 Bacteria 14258
167 Ga0495640_0160453 3300046533 Bacteria 1441
168 Ga0495587_0001717 3300046536 Bacteria 14625
169 Ga0495587_0009670 3300046536 Bacteria 6167
170 Ga0495645_0000094 3300046543 Bacteria 62240
171 Ga0495645_0044641 3300046543 Bacteria 3232
172 Ga0495645_0235787 3300046543 Bacteria 1223
173 Ga0495667_0001811 3300046559 Bacteria 14191
174 Ga0495657_0033293 3300046675 Bacteria 3589
175 Ga0495599_0129384 3300046678 Bacteria 1568
176 Ga0495623_0002651 3300046679 Bacteria 11814
177 Ga0495623_0014994 3300046679 Bacteria 5009
178 Ga0495623_0022090 3300046679 Bacteria 4109
179 Ga0495658_0154424 3300046683 Bacteria 1412
180 Ga0495658_0200233 3300046683 Bacteria 1244
181 Ga0495600_0024488 3300046809 Bacteria 3886
182 Ga0495581_0081356 3300047315 Bacteria 1875
183 Ga0495604_0011072 3300047317 Bacteria 7159
184 Ga0495674_0144553 3300047319 Bacteria 1997
185 Ga0495675_0015246 3300047444 Unclassified 4858
186 Ga0495675_0127434 3300047444 Bacteria 1583
187 Ga0495684_0029020 3300047471 Bacteria 4245
188 Ga0495684_0088259 3300047471 Bacteria 2350
189 Ga0495602_0150380 3300048088 Bacteria 1831
190 Ga0496104_0381902 3300048907 Bacteria 1321
191 Ga0496104_0446725 3300048907 Bacteria 1205
192 Ga0496114_0103906 3300048917 Bacteria 2429
193 Ga0501047_0036769 3300049581 Bacteria 4733
194 Ga0501047_0188740 3300049581 Bacteria 1925
195 Ga0501070_0041546 3300049586 Bacteria 3831
196 Ga0501075_0104330 3300049591 Bacteria 2154
197 Ga0501044_0015975 3300049823 Bacteria 8077
198 Ga0501044_0166918 3300049823 Bacteria 2175
199 Ga0501045_0255248 3300049824 Bacteria 1305
200 nmdc:mga05p37_272294_c1 3300050507 Bacteria 2022
201 Ga0495612_0017339 3300053078 Bacteria 2884
202 Ga0500568_0041671 3300053139 Bacteria 1844
203 Ga0530510_0350907 3300061734 Bacteria 1108

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10275710 Ga0207646_102757102 253
2 3300046683 Ga0495658_0200233 Ga0495658_0200233_256_1056 259
3 3300049591 Ga0501075_0104330 Ga0501075_0104330_25_813 260
4 3300009176 Ga0105242_10243441 Ga0105242_102434412 261
5 3300025934 Ga0207686_10025717 Ga0207686_100257171 261
6 3300005544 Ga0070686_100032927 Ga0070686_1000329272 262
7 3300061734 Ga0530510_0350907 Ga0530510_0350907_23_817 262
8 3300035207 Ga0373942_0046619 Ga0373942_0046619_15_839 267
9 3300032005 Ga0307411_10098746 Ga0307411_100987462 281
10 3300035692 Ga0373935_0212268 Ga0373935_0212268_14_883 282
11 3300048917 Ga0496114_0103906 Ga0496114_0103906_525_1406 282
12 3300005841 Ga0068863_100130819 Ga0068863_1001308192 290
13 3300005844 Ga0068862_100036680 Ga0068862_1000366803 290
14 3300026088 Ga0207641_10056353 Ga0207641_100563532 290
15 3300028380 Ga0268265_10102292 Ga0268265_101022922 290
16 3300005445 Ga0070708_100130946 Ga0070708_1001309462 291
17 3300005456 Ga0070678_100066239 Ga0070678_1000662392 291
18 3300005471 Ga0070698_100056654 Ga0070698_1000566544 291
19 3300005536 Ga0070697_100306289 Ga0070697_1003062891 291
20 3300005546 Ga0070696_100034835 Ga0070696_1000348352 291
21 3300005577 Ga0068857_100172338 Ga0068857_1001723382 291
22 3300025910 Ga0207684_10295397 Ga0207684_102953972 291
23 3300025941 Ga0207711_10132972 Ga0207711_101329722 291
24 3300026121 Ga0207683_10016260 Ga0207683_100162606 291
25 3300005327 Ga0070658_10026769 Ga0070658_100267693 292
26 3300005327 Ga0070658_10069869 Ga0070658_100698691 292
27 3300005329 Ga0070683_100001395 Ga0070683_1000013958 292
28 3300005329 Ga0070683_100025738 Ga0070683_1000257384 292
29 3300005329 Ga0070683_100030076 Ga0070683_1000300763 292
30 3300005329 Ga0070683_100114065 Ga0070683_1001140652 292
31 3300005336 Ga0070680_100000381 Ga0070680_1000003819 292
32 3300005336 Ga0070680_100189389 Ga0070680_1001893892 292
33 3300005337 Ga0070682_100000669 Ga0070682_1000006692 292
34 3300005337 Ga0070682_100012743 Ga0070682_1000127431 292
35 3300005344 Ga0070661_100011235 Ga0070661_1000112353 292
36 3300005344 Ga0070661_100180212 Ga0070661_1001802122 292
37 3300005344 Ga0070661_100264384 Ga0070661_1002643841 292
38 3300005367 Ga0070667_100198566 Ga0070667_1001985662 292
39 3300005445 Ga0070708_100377107 Ga0070708_1003771072 292
40 3300005456 Ga0070678_100001762 Ga0070678_1000017629 292
41 3300005458 Ga0070681_10062299 Ga0070681_100622993 292
42 3300005458 Ga0070681_10179874 Ga0070681_101798741 292
43 3300005468 Ga0070707_100003225 Ga0070707_1000032252 292
44 3300005471 Ga0070698_100424620 Ga0070698_1004246202 292
45 3300005518 Ga0070699_100017764 Ga0070699_1000177642 292
46 3300005530 Ga0070679_100003741 Ga0070679_1000037411 292
47 3300005530 Ga0070679_100007268 Ga0070679_1000072681 292
48 3300005530 Ga0070679_100038437 Ga0070679_1000384373 292
49 3300005530 Ga0070679_100255109 Ga0070679_1002551092 292
50 3300005535 Ga0070684_100014871 Ga0070684_1000148713 292
51 3300005535 Ga0070684_100017301 Ga0070684_1000173013 292
52 3300005535 Ga0070684_100027210 Ga0070684_1000272104 292
53 3300005536 Ga0070697_100006211 Ga0070697_1000062117 292
54 3300005546 Ga0070696_100007776 Ga0070696_1000077766 292
55 3300005548 Ga0070665_100047102 Ga0070665_1000471023 292
56 3300005563 Ga0068855_100004430 Ga0068855_1000044306 292
57 3300005563 Ga0068855_100118629 Ga0068855_1001186291 292
58 3300005563 Ga0068855_100126638 Ga0068855_1001266382 292
59 3300005563 Ga0068855_100198504 Ga0068855_1001985042 292
60 3300005563 Ga0068855_100219875 Ga0068855_1002198753 292
61 3300005563 Ga0068855_100373801 Ga0068855_1003738012 292
62 3300005577 Ga0068857_100137964 Ga0068857_1001379642 292
63 3300005578 Ga0068854_100135101 Ga0068854_1001351012 292
64 3300005614 Ga0068856_100098011 Ga0068856_1000980112 292
65 3300005614 Ga0068856_100160965 Ga0068856_1001609651 292
66 3300005616 Ga0068852_100205193 Ga0068852_1002051932 292
67 3300005843 Ga0068860_100080369 Ga0068860_1000803692 292
68 3300005985 Ga0081539_10018124 Ga0081539_100181242 292
69 3300006028 Ga0070717_10047955 Ga0070717_100479552 292
70 3300006028 Ga0070717_10267123 Ga0070717_102671232 292
71 3300006173 Ga0070716_100063271 Ga0070716_1000632712 292
72 3300006844 Ga0075428_100035359 Ga0075428_1000353595 292
73 3300009093 Ga0105240_10003333 Ga0105240_1000333317 292
74 3300009098 Ga0105245_10000047 Ga0105245_100000473 292
75 3300009545 Ga0105237_10189901 Ga0105237_101899012 292
76 3300013100 Ga0157373_10022235 Ga0157373_100222352 292
77 3300013104 Ga0157370_10023807 Ga0157370_100238073 292
78 3300013104 Ga0157370_10034565 Ga0157370_100345653 292
79 3300013104 Ga0157370_10070200 Ga0157370_100702004 292
80 3300013104 Ga0157370_10573579 Ga0157370_105735791 292
81 3300013105 Ga0157369_10126014 Ga0157369_101260142 292
82 3300013307 Ga0157372_10047198 Ga0157372_100471983 292
83 3300013307 Ga0157372_10157378 Ga0157372_101573782 292
84 3300013307 Ga0157372_10167039 Ga0157372_101670393 292
85 3300014969 Ga0157376_10108571 Ga0157376_101085713 292
86 3300014969 Ga0157376_10112637 Ga0157376_101126372 292
87 3300014969 Ga0157376_10126677 Ga0157376_101266772 292
88 3300017792 Ga0163161_10406188 Ga0163161_104061881 292
89 3300021358 Ga0213873_10000003 Ga0213873_10000003284 292
90 3300021361 Ga0213872_10039347 Ga0213872_100393472 292
91 3300021384 Ga0213876_10000003 Ga0213876_10000003584 292
92 3300025909 Ga0207705_10045660 Ga0207705_100456603 292
93 3300025912 Ga0207707_10000603 Ga0207707_100006036 292
94 3300025912 Ga0207707_10058135 Ga0207707_100581352 292
95 3300025912 Ga0207707_10132618 Ga0207707_101326183 292
96 3300025913 Ga0207695_10009615 Ga0207695_1000961510 292
97 3300025913 Ga0207695_10018569 Ga0207695_100185695 292
98 3300025913 Ga0207695_10030675 Ga0207695_100306754 292
99 3300025915 Ga0207693_10123414 Ga0207693_101234142 292
100 3300025917 Ga0207660_10007324 Ga0207660_100073243 292
101 3300025917 Ga0207660_10043722 Ga0207660_100437222 292
102 3300025921 Ga0207652_10010591 Ga0207652_100105912 292
103 3300025921 Ga0207652_10020586 Ga0207652_100205863 292
104 3300025921 Ga0207652_10041593 Ga0207652_100415931 292
105 3300025922 Ga0207646_10004978 Ga0207646_100049781 292
106 3300025927 Ga0207687_10000402 Ga0207687_1000040213 292
107 3300025928 Ga0207700_10141388 Ga0207700_101413881 292
108 3300025944 Ga0207661_10021341 Ga0207661_100213413 292
109 3300025944 Ga0207661_10066030 Ga0207661_100660304 292
110 3300025944 Ga0207661_10085451 Ga0207661_100854512 292
111 3300025944 Ga0207661_10127201 Ga0207661_101272012 292
112 3300025944 Ga0207661_10156432 Ga0207661_101564323 292
113 3300025949 Ga0207667_10016868 Ga0207667_100168685 292
114 3300025949 Ga0207667_10216625 Ga0207667_102166252 292
115 3300025981 Ga0207640_10003897 Ga0207640_100038976 292
116 3300026067 Ga0207678_10363761 Ga0207678_103637611 292
117 3300026078 Ga0207702_10060610 Ga0207702_100606103 292
118 3300026078 Ga0207702_10101418 Ga0207702_101014181 292
119 3300026088 Ga0207641_10165503 Ga0207641_101655032 292
120 3300026116 Ga0207674_10089191 Ga0207674_100891912 292
121 3300026116 Ga0207674_10106471 Ga0207674_101064713 292
122 3300026142 Ga0207698_10118151 Ga0207698_101181512 292
123 3300028379 Ga0268266_10019817 Ga0268266_100198172 292
124 3300028800 Ga0265338_10070629 Ga0265338_100706293 292
125 3300028800 Ga0265338_10075941 Ga0265338_100759412 292
126 3300031251 Ga0265327_10000579 Ga0265327_100005792 292
127 3300031548 Ga0307408_100292772 Ga0307408_1002927722 292
128 3300031665 Ga0316575_10041954 Ga0316575_100419541 292
129 3300031824 Ga0307413_10006281 Ga0307413_100062814 292
130 3300031901 Ga0307406_10053862 Ga0307406_100538622 292
131 3300031903 Ga0307407_10013372 Ga0307407_100133722 292
132 3300031995 Ga0307409_100014362 Ga0307409_1000143623 292
133 3300032002 Ga0307416_100082656 Ga0307416_1000826562 292
134 3300032126 Ga0307415_100273635 Ga0307415_1002736352 292
135 3300035086 Ga0373934_0001505 Ga0373934_0001505_4229_5128 292
136 3300035117 Ga0373953_0107451 Ga0373953_0107451_132_1031 292
137 3300035119 Ga0373956_0006576 Ga0373956_0006576_2806_3690 292
138 3300035172 Ga0373955_0000446 Ga0373955_0000446_10131_11015 292
139 3300035398 Ga0316574_0007817 Ga0316574_0007817_4909_5811 292
140 3300035691 Ga0373931_0000575 Ga0373931_0000575_6980_7867 292
141 3300035724 Ga0373933_0015825 Ga0373933_0015825_553_1452 292
142 3300035724 Ga0373933_0035607 Ga0373933_0035607_961_1845 292
143 3300035725 Ga0373947_0116033 Ga0373947_0116033_24_938 292
144 3300036401 Ga0373937_0000114 Ga0373937_0000114_24801_25685 292
145 3300036401 Ga0373937_0189828 Ga0373937_0189828_326_1225 292
146 3300036401 Ga0373937_0272236 Ga0373937_0272236_123_1022 292
147 3300037068 Ga0373925_0123216 Ga0373925_0123216_1080_1997 292
148 3300037312 Ga0395899_0016871 Ga0395899_0016871_2853_3800 292
149 3300037471 Ga0395905_0166614 Ga0395905_0166614_1061_1972 292
150 3300039437 Ga0436365_0537254 Ga0436365_0537254_222418_223299 292
151 3300039437 Ga0436365_1273304 Ga0436365_1273304_228_1109 292
152 3300039453 Ga0436362_0835337 Ga0436362_0835337_51221_52102 292
153 3300045976 Ga0466967_0217206 Ga0466967_0217206_634_1542 292
154 3300046462 Ga0495651_0012269 Ga0495651_0012269_272_1171 292
155 3300046462 Ga0495651_0080262 Ga0495651_0080262_664_1548 292
156 3300046463 Ga0495653_0114877 Ga0495653_0114877_510_1409 292
157 3300046472 Ga0495580_0018253 Ga0495580_0018253_3702_4601 292
158 3300046473 Ga0495582_0170919 Ga0495582_0170919_128_1045 292
159 3300046475 Ga0495639_0016423 Ga0495639_0016423_792_1691 292
160 3300046476 Ga0495662_0068287 Ga0495662_0068287_297_1214 292
161 3300046499 Ga0495594_0008741 Ga0495594_0008741_2772_3671 292
162 3300046499 Ga0495594_0046737 Ga0495594_0046737_26_910 292
163 3300046511 Ga0495608_0045330 Ga0495608_0045330_2013_2912 292
164 3300046514 Ga0495618_0130630 Ga0495618_0130630_338_1237 292
165 3300046516 Ga0495628_0035825 Ga0495628_0035825_2196_3095 292
166 3300046516 Ga0495628_0286809 Ga0495628_0286809_12_896 292
167 3300046526 Ga0495666_0064205 Ga0495666_0064205_670_1569 292
168 3300046529 Ga0495652_0011432 Ga0495652_0011432_3095_3979 292
169 3300046529 Ga0495652_0034358 Ga0495652_0034358_1148_2047 292
170 3300046531 Ga0495665_0001106 Ga0495665_0001106_2899_3798 292
171 3300046533 Ga0495640_0160453 Ga0495640_0160453_373_1272 292
172 3300046536 Ga0495587_0001717 Ga0495587_0001717_4796_5680 292
173 3300046536 Ga0495587_0009670 Ga0495587_0009670_4252_5151 292
174 3300046543 Ga0495645_0000094 Ga0495645_0000094_13826_14710 292
175 3300046543 Ga0495645_0044641 Ga0495645_0044641_377_1276 292
176 3300046543 Ga0495645_0235787 Ga0495645_0235787_32_931 292
177 3300046559 Ga0495667_0001811 Ga0495667_0001811_4581_5465 292
178 3300046675 Ga0495657_0033293 Ga0495657_0033293_1243_2142 292
179 3300046678 Ga0495599_0129384 Ga0495599_0129384_105_1004 292
180 3300046679 Ga0495623_0002651 Ga0495623_0002651_7908_8792 292
181 3300046679 Ga0495623_0014994 Ga0495623_0014994_3846_4745 292
182 3300046679 Ga0495623_0022090 Ga0495623_0022090_2194_3093 292
183 3300046683 Ga0495658_0154424 Ga0495658_0154424_38_955 292
184 3300046809 Ga0495600_0024488 Ga0495600_0024488_2869_3753 292
185 3300047315 Ga0495581_0081356 Ga0495581_0081356_642_1559 292
186 3300047317 Ga0495604_0011072 Ga0495604_0011072_3273_4172 292
187 3300047319 Ga0495674_0144553 Ga0495674_0144553_735_1652 292
188 3300047444 Ga0495675_0015246 Ga0495675_0015246_1101_1985 292
189 3300047444 Ga0495675_0127434 Ga0495675_0127434_132_1031 292
190 3300047471 Ga0495684_0029020 Ga0495684_0029020_1692_2591 292
191 3300047471 Ga0495684_0088259 Ga0495684_0088259_1178_2062 292
192 3300048088 Ga0495602_0150380 Ga0495602_0150380_377_1276 292
193 3300048907 Ga0496104_0381902 Ga0496104_0381902_31_963 292
194 3300048907 Ga0496104_0446725 Ga0496104_0446725_243_1127 292
195 3300049581 Ga0501047_0036769 Ga0501047_0036769_3678_4601 292
196 3300049581 Ga0501047_0188740 Ga0501047_0188740_133_1146 292
197 3300049586 Ga0501070_0041546 Ga0501070_0041546_2371_3294 292
198 3300049823 Ga0501044_0015975 Ga0501044_0015975_1353_2276 292
199 3300049823 Ga0501044_0166918 Ga0501044_0166918_1185_2096 292
200 3300049824 Ga0501045_0255248 Ga0501045_0255248_57_941 292
201 3300050507 nmdc:mga05p37_272294_c1 nmdc:mga05p37_272294_c1_1051_1950 292
202 3300053078 Ga0495612_0017339 Ga0495612_0017339_252_1151 292
203 3300053139 Ga0500568_0041671 Ga0500568_0041671_116_1153 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

271

299

0.96

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

165

245

0.95

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

33

147

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7af3-assembly1.cif.gz_M bacterial 30s ribosomal subunit assembly complex state m (head domain) 0.9446 150 204
4v5z-assembly1.cif.gz_Am structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.928 152 200
4v7h-assembly1.cif.gz_AM structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution 0.8876 151 200
8qpp-assembly1.cif.gz_M bacillus subtilis muts2-collided disome complex (stalled 70s) 0.8797 151 204
2xzu-assembly1.cif.gz_A crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k 0.8776 2 266
ID Description Score Start End Superfamily
1xnqM01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9272 150 200 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9208 166 204 1.10.8.50
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9184 151 205 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8875 132 266 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8867 151 204 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9858 1 213 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.979 1 266 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A536SPC1-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.978 1 292 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A538QIF5-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9778 1 291 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7Y1SVG2-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9774 1 209 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Feature Viewer

pLDDT pTM Quality
90.45 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map