F308205

General Info

Members Datasets Scaffolds Average Seq Length
201 134 201 81

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_101945010|Ga0070705_1019450101
Length 87
Sequence MGAMLPLALQKIENEYLLFGAAGLVSLVAFVGLILMPAVSSYGRLWEKAAAGFLSLFVLAALVVFGVVVGLAIVYYYNDIVNLLHGK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
69 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 5.47
Rhizosphere 92.54
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100005054 3300005329 Bacteria 10953
2 Ga0070683_100545054 3300005329 Bacteria 1109
3 Ga0070682_100195906 3300005337 Bacteria 1422
4 Ga0070682_102065647 3300005337 Unclassified 502
5 Ga0070689_100299358 3300005340 Bacteria 1338
6 Ga0070661_100000005 3300005344 Bacteria 220455
7 Ga0070688_100115200 3300005365 Bacteria 1793
8 Ga0070659_100011357 3300005366 Bacteria 6586
9 Ga0070714_100026223 3300005435 Bacteria 4815
10 Ga0070713_100000022 3300005436 Bacteria 102527
11 Ga0070705_101945010 3300005440 Bacteria 501
12 Ga0070678_100417643 3300005456 Unclassified 1169
13 Ga0070685_10000047 3300005466 Bacteria 72690
14 Ga0070684_100012486 3300005535 Bacteria 6811
15 Ga0070684_100611160 3300005535 Bacteria 1014
16 Ga0070684_100753577 3300005535 Bacteria 909
17 Ga0068853_100026834 3300005539 Bacteria 4839
18 Ga0068853_100032420 3300005539 Unclassified 4426
19 Ga0070686_100236590 3300005544 Unclassified 1328
20 Ga0070693_101291030 3300005547 Bacteria 564
21 Ga0070665_100003628 3300005548 Bacteria 16353
22 Ga0068855_100078649 3300005563 Bacteria 3826
23 Ga0070664_100396248 3300005564 Bacteria 1262
24 Ga0068854_100079811 3300005578 Bacteria 2414
25 Ga0068852_100162106 3300005616 Bacteria 2089
26 Ga0068852_101447747 3300005616 Bacteria 709
27 Ga0068870_10361484 3300005840 Bacteria 934
28 Ga0068858_100000329 3300005842 Bacteria 50177
29 Ga0081455_10025731 3300005937 Bacteria 5427
30 Ga0081540_1000106 3300005983 Bacteria 89767
31 Ga0075430_100437756 3300006846 Bacteria 1079
32 Ga0075433_10000047 3300006852 Bacteria 50752
33 Ga0075433_10023785 3300006852 Bacteria 5160
34 Ga0068865_101172924 3300006881 Bacteria 679
35 Ga0075435_100604334 3300007076 Bacteria 951
36 Ga0105245_10774714 3300009098 Bacteria 996
37 Ga0105245_11510744 3300009098 Bacteria 723
38 Ga0105247_10003781 3300009101 Bacteria 9815
39 Ga0114129_10263661 3300009147 Bacteria 2308
40 Ga0105242_10049662 3300009176 Bacteria 3414
41 Ga0105248_10289333 3300009177 Bacteria 1845
42 Ga0157374_10015472 3300013296 Bacteria 6691
43 Ga0157374_10119827 3300013296 Bacteria 2538
44 Ga0157378_10418163 3300013297 Bacteria 1324
45 Ga0157372_10000770 3300013307 Bacteria 34695
46 Ga0157372_11462184 3300013307 Bacteria 787
47 Ga0157375_10065822 3300013308 Bacteria 3614
48 Ga0157375_13256893 3300013308 Bacteria 541
49 Ga0157380_10000273 3300014326 Bacteria 31035
50 Ga0157380_10201012 3300014326 Unclassified 1768
51 Ga0163161_10000018 3300017792 Bacteria 228801
52 Ga0207710_10001943 3300025900 Bacteria 9876
53 Ga0207680_10016173 3300025903 Bacteria 3910
54 Ga0207643_10037382 3300025908 Bacteria 2724
55 Ga0207654_10518666 3300025911 Bacteria 843
56 Ga0207662_10772231 3300025918 Unclassified 676
57 Ga0207657_10830356 3300025919 Unclassified 714
58 Ga0207649_10000005 3300025920 Bacteria 356179
59 Ga0207700_10000008 3300025928 Bacteria 341717
60 Ga0207664_10020557 3300025929 Bacteria 4895
61 Ga0207664_10428681 3300025929 Bacteria 1179
62 Ga0207690_10004158 3300025932 Bacteria 8552
63 Ga0207686_10067989 3300025934 Bacteria 2281
64 Ga0207704_10917776 3300025938 Bacteria 737
65 Ga0207665_10166177 3300025939 Unclassified 1591
66 Ga0207711_10376975 3300025941 Bacteria 1316
67 Ga0207661_10000848 3300025944 Bacteria 20032
68 Ga0207661_11292140 3300025944 Bacteria 670
69 Ga0207679_10740993 3300025945 Bacteria 893
70 Ga0207667_10333766 3300025949 Bacteria 1548
71 Ga0207640_10008463 3300025981 Bacteria 5717
72 Ga0207703_10000126 3300026035 Bacteria 91860
73 Ga0207639_10001873 3300026041 Bacteria 14146
74 Ga0207678_10557510 3300026067 Unclassified 1002
75 Ga0207683_10007770 3300026121 Bacteria 9175
76 Ga0268266_10000303 3300028379 Bacteria 78632
77 Ga0307511_10118153 3300030521 Bacteria 1653
78 Ga0373955_0277190 3300035172 Bacteria 1009
79 Ga0373947_0959493 3300035725 Bacteria 583
80 Ga0373937_0083929 3300036401 Bacteria 2947
81 Ga0395900_0371945 3300037418 Unclassified 1399
82 Ga0451800_0236026 3300041459 Bacteria 563
83 Ga0451839_1389348 3300041496 Bacteria 556
84 Ga0451853_0052401 3300041512 Bacteria 1347
85 Ga0466963_0000139 3300044694 Bacteria 28196
86 Ga0466957_0078742 3300044842 Bacteria 2050
87 Ga0466967_0120572 3300045976 Bacteria 2422
88 Ga0495592_0000324 3300046454 Bacteria 39852
89 Ga0495603_0006257 3300046455 Bacteria 7115
90 Ga0495629_0074120 3300046459 Bacteria 2377
91 Ga0495651_0246589 3300046462 Unclassified 1222
92 Ga0495651_0378302 3300046462 Unclassified 929
93 Ga0495653_0152071 3300046463 Bacteria 1616
94 Ga0495582_0000013 3300046473 Bacteria 110372
95 Ga0495662_0000250 3300046476 Bacteria 22726
96 Ga0495608_0000094 3300046511 Bacteria 64194
97 Ga0495608_0000707 3300046511 Bacteria 23232
98 Ga0495608_0004091 3300046511 Bacteria 10460
99 Ga0495608_0627757 3300046511 Bacteria 643
100 Ga0495618_0000075 3300046514 Bacteria 70236
101 Ga0495618_0483430 3300046514 Unclassified 748
102 Ga0495628_0084311 3300046516 Bacteria 2466
103 Ga0495628_0104331 3300046516 Bacteria 2185
104 Ga0495652_0920405 3300046529 Bacteria 576
105 Ga0495640_0094818 3300046533 Bacteria 1965
106 Ga0495640_0103784 3300046533 Bacteria 1864
107 Ga0495640_0654582 3300046533 Unclassified 632
108 Ga0495586_0045567 3300046535 Bacteria 2363
109 Ga0495587_0007568 3300046536 Bacteria 7028
110 Ga0495587_0226731 3300046536 Unclassified 1053
111 Ga0495645_0290408 3300046543 Unclassified 1072
112 Ga0495667_0027021 3300046559 Bacteria 3868
113 Ga0495667_0815888 3300046559 Bacteria 575
114 Ga0495634_0000063 3300046642 Bacteria 86878
115 Ga0495634_0000296 3300046642 Bacteria 47756
116 Ga0495634_0052837 3300046642 Bacteria 2723
117 Ga0495634_0105682 3300046642 Bacteria 1815
118 Ga0495634_0257403 3300046642 Bacteria 1066
119 Ga0495634_0303156 3300046642 Bacteria 965
120 Ga0495635_0000096 3300046663 Bacteria 52204
121 Ga0495635_0069201 3300046663 Bacteria 2420
122 Ga0495635_0264380 3300046663 Unclassified 1158
123 Ga0495588_0000250 3300046674 Bacteria 45010
124 Ga0495657_0000152 3300046675 Bacteria 62935
125 Ga0495657_0026223 3300046675 Bacteria 4127
126 Ga0495599_0022572 3300046678 Bacteria 3929
127 Ga0495599_0240842 3300046678 Bacteria 1103
128 Ga0495658_0000009 3300046683 Bacteria 110421
129 Ga0495613_0000068 3300046689 Bacteria 101803
130 Ga0495613_0000157 3300046689 Bacteria 66401
131 Ga0495624_0091972 3300046690 Bacteria 1871
132 Ga0495649_0011659 3300046694 Bacteria 5149
133 Ga0495600_0008308 3300046809 Bacteria 6371
134 Ga0495600_0095777 3300046809 Unclassified 1935
135 Ga0495600_0518756 3300046809 Bacteria 731
136 Ga0495600_0783808 3300046809 Unclassified 569
137 Ga0495604_0000346 3300047317 Bacteria 41587
138 Ga0495604_0002184 3300047317 Bacteria 15690
139 Ga0495604_0029544 3300047317 Bacteria 4360
140 Ga0495604_0077035 3300047317 Bacteria 2507
141 Ga0495604_0285970 3300047317 Unclassified 1112
142 Ga0495676_0005811 3300047321 Bacteria 11320
143 Ga0495676_0235762 3300047321 Bacteria 1255
144 Ga0495680_0000464 3300047322 Bacteria 45610
145 Ga0495680_0001366 3300047322 Bacteria 26489
146 Ga0495680_0103494 3300047322 Bacteria 2119
147 Ga0495680_0353112 3300047322 Bacteria 1023
148 Ga0495680_0419430 3300047322 Unclassified 921
149 Ga0495675_0000095 3300047444 Bacteria 62902
150 Ga0495679_007955 3300047446 Bacteria 4362
151 Ga0495684_0219906 3300047471 Bacteria 1393
152 Ga0495593_0070382 3300047673 Unclassified 1818
153 Ga0495593_0714123 3300047673 Bacteria 503
154 Ga0495602_0000009 3300048088 Bacteria 258991
155 Ga0495602_0658944 3300048088 Unclassified 714
156 Ga0496105_0074597 3300048908 Bacteria 2802
157 Ga0496110_0019219 3300048913 Bacteria 5745
158 Ga0496110_0202730 3300048913 Bacteria 1802
159 Ga0496111_0068038 3300048914 Bacteria 2588
160 Ga0496113_0830064 3300048916 Bacteria 733
161 Ga0496114_0000003 3300048917 Bacteria 630981
162 Ga0496114_0121693 3300048917 Bacteria 2245
163 Ga0496114_0542117 3300048917 Bacteria 1028
164 Ga0496115_0000036 3300048918 Bacteria 127774
165 Ga0496115_0112531 3300048918 Bacteria 2236
166 Ga0501032_0783212 3300049569 Unclassified 603
167 Ga0501038_1047846 3300049574 Unclassified 597
168 Ga0501039_0052514 3300049575 Bacteria 3154
169 Ga0501040_1082835 3300049576 Bacteria 581
170 Ga0501042_0930302 3300049578 Unclassified 633
171 Ga0501046_0736103 3300049580 Unclassified 693
172 Ga0501071_1109714 3300049587 Unclassified 611
173 Ga0501072_0609794 3300049588 Unclassified 860
174 Ga0501074_0494309 3300049590 Bacteria 867
175 Ga0501075_0605436 3300049591 Unclassified 836
176 Ga0501076_0242634 3300049592 Bacteria 1474
177 Ga0501081_0434598 3300049743 Bacteria 974
178 Ga0501081_0458192 3300049743 Bacteria 948
179 Ga0501045_0933172 3300049824 Unclassified 637
180 Ga0501045_1432912 3300049824 Unclassified 501
181 nmdc:mga0yw44_645445_c1 3300050492 Bacteria 719
182 nmdc:mga0qj67_208347_c1 3300050509 Bacteria 1588
183 nmdc:mga0qj67_55614_c1 3300050509 Bacteria 3135
184 nmdc:mga0rr50_585399_c1 3300050513 Bacteria 951
185 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
186 nmdc:mga0a205_2672_c1 3300050515 Bacteria 15769
187 Ga0495612_0000504 3300053078 Bacteria 15632
188 Ga0495612_0004318 3300053078 Bacteria 5899
189 Ga0495612_0142350 3300053078 Bacteria 1041
190 Ga0495595_0000046 3300053084 Bacteria 62935
191 Ga0495595_0000099 3300053084 Bacteria 39785
192 Ga0495595_0035599 3300053084 Bacteria 2255
193 Ga0495619_0000001 3300053085 Bacteria 586054
194 Ga0495619_0000258 3300053085 Bacteria 38636
195 Ga0495619_0002135 3300053085 Bacteria 13113
196 Ga0495619_0011063 3300053085 Bacteria 5676
197 Ga0495619_0065143 3300053085 Bacteria 2431
198 Ga0495619_0093831 3300053085 Unclassified 2035
199 Ga0495619_0513108 3300053085 Bacteria 824
200 Ga0495619_0536758 3300053085 Bacteria 803
201 Ga0501084_1337559 3300054114 Unclassified 600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047446 Ga0495679_007955 Ga0495679_007955_60_317 63
2 3300037418 Ga0395900_0371945 Ga0395900_0371945_530_760 65
3 3300047321 Ga0495676_0005811 Ga0495676_0005811_4912_5175 65
4 3300053085 Ga0495619_0513108 Ga0495619_0513108_356_604 65
5 3300046559 Ga0495667_0815888 Ga0495667_0815888_278_532 66
6 3300046678 Ga0495599_0240842 Ga0495599_0240842_411_665 66
7 3300049580 Ga0501046_0736103 Ga0501046_0736103_338_589 66
8 3300005337 Ga0070682_100195906 Ga0070682_1001959062 68
9 3300005535 Ga0070684_100611160 Ga0070684_1006111601 68
10 3300005616 Ga0068852_101447747 Ga0068852_1014477472 68
11 3300006852 Ga0075433_10000047 Ga0075433_1000004744 68
12 3300009098 Ga0105245_11510744 Ga0105245_115107442 68
13 3300046642 Ga0495634_0000296 Ga0495634_0000296_1392_1649 68
14 3300048913 Ga0496110_0019219 Ga0496110_0019219_3889_4146 68
15 3300049569 Ga0501032_0783212 Ga0501032_0783212_270_527 68
16 3300049574 Ga0501038_1047846 Ga0501038_1047846_143_400 68
17 3300049575 Ga0501039_0052514 Ga0501039_0052514_2404_2661 68
18 3300049578 Ga0501042_0930302 Ga0501042_0930302_194_451 68
19 3300049587 Ga0501071_1109714 Ga0501071_1109714_323_580 68
20 3300049588 Ga0501072_0609794 Ga0501072_0609794_371_628 68
21 3300049592 Ga0501076_0242634 Ga0501076_0242634_96_353 68
22 3300049743 Ga0501081_0434598 Ga0501081_0434598_632_889 68
23 3300049824 Ga0501045_0933172 Ga0501045_0933172_24_281 68
24 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_196318_196581 68
25 3300053078 Ga0495612_0000504 Ga0495612_0000504_5009_5266 68
26 3300054114 Ga0501084_1337559 Ga0501084_1337559_70_327 68
27 3300005337 Ga0070682_102065647 Ga0070682_1020656472 69
28 3300005435 Ga0070714_100026223 Ga0070714_1000262232 69
29 3300005456 Ga0070678_100417643 Ga0070678_1004176432 69
30 3300005616 Ga0068852_100162106 Ga0068852_1001621062 69
31 3300009101 Ga0105247_10003781 Ga0105247_1000378111 69
32 3300013297 Ga0157378_10418163 Ga0157378_104181632 69
33 3300013308 Ga0157375_10065822 Ga0157375_100658222 69
34 3300014326 Ga0157380_10201012 Ga0157380_102010122 69
35 3300025900 Ga0207710_10001943 Ga0207710_1000194311 69
36 3300025929 Ga0207664_10020557 Ga0207664_100205573 69
37 3300046514 Ga0495618_0000075 Ga0495618_0000075_37659_37922 69
38 3300046809 Ga0495600_0008308 Ga0495600_0008308_3502_3765 69
39 3300048917 Ga0496114_0542117 Ga0496114_0542117_60_323 69
40 3300048918 Ga0496115_0112531 Ga0496115_0112531_1391_1654 69
41 3300049576 Ga0501040_1082835 Ga0501040_1082835_204_464 69
42 3300005547 Ga0070693_101291030 Ga0070693_1012910302 70
43 3300009177 Ga0105248_10289333 Ga0105248_102893332 70
44 3300013296 Ga0157374_10015472 Ga0157374_100154726 70
45 3300013308 Ga0157375_13256893 Ga0157375_132568931 70
46 3300025918 Ga0207662_10772231 Ga0207662_107722311 70
47 3300025941 Ga0207711_10376975 Ga0207711_103769752 70
48 3300026067 Ga0207678_10557510 Ga0207678_105575102 70
49 3300030521 Ga0307511_10118153 Ga0307511_101181532 70
50 3300005937 Ga0081455_10025731 Ga0081455_100257313 71
51 3300009147 Ga0114129_10263661 Ga0114129_102636613 71
52 3300046535 Ga0495586_0045567 Ga0495586_0045567_523_786 71
53 3300047317 Ga0495604_0000346 Ga0495604_0000346_40631_40879 71
54 3300048913 Ga0496110_0202730 Ga0496110_0202730_554_808 71
55 3300048914 Ga0496111_0068038 Ga0496111_0068038_1061_1315 71
56 3300048917 Ga0496114_0121693 Ga0496114_0121693_1645_1899 71
57 3300050492 nmdc:mga0yw44_645445_c1 nmdc:mga0yw44_645445_c1_272_538 71
58 3300050515 nmdc:mga0a205_2672_c1 nmdc:mga0a205_2672_c1_11080_11328 71
59 3300053078 Ga0495612_0004318 Ga0495612_0004318_2488_2742 71
60 3300005329 Ga0070683_100545054 Ga0070683_1005450542 72
61 3300005535 Ga0070684_100753577 Ga0070684_1007535772 72
62 3300005563 Ga0068855_100078649 Ga0068855_1000786494 72
63 3300005564 Ga0070664_100396248 Ga0070664_1003962482 72
64 3300005840 Ga0068870_10361484 Ga0068870_103614842 72
65 3300025908 Ga0207643_10037382 Ga0207643_100373823 72
66 3300025944 Ga0207661_11292140 Ga0207661_112921402 72
67 3300025945 Ga0207679_10740993 Ga0207679_107409932 72
68 3300025949 Ga0207667_10333766 Ga0207667_103337662 72
69 3300045976 Ga0466967_0120572 Ga0466967_0120572_1617_1880 72
70 3300046559 Ga0495667_0027021 Ga0495667_0027021_1226_1483 72
71 3300005344 Ga0070661_100000005 Ga0070661_10000000546 73
72 3300005366 Ga0070659_100011357 Ga0070659_1000113575 73
73 3300005436 Ga0070713_100000022 Ga0070713_10000002249 73
74 3300005466 Ga0070685_10000047 Ga0070685_1000004713 73
75 3300005544 Ga0070686_100236590 Ga0070686_1002365902 73
76 3300005548 Ga0070665_100003628 Ga0070665_10000362810 73
77 3300005578 Ga0068854_100079811 Ga0068854_1000798114 73
78 3300005983 Ga0081540_1000106 Ga0081540_100010688 73
79 3300006881 Ga0068865_101172924 Ga0068865_1011729241 73
80 3300009098 Ga0105245_10774714 Ga0105245_107747142 73
81 3300013307 Ga0157372_10000770 Ga0157372_1000077010 73
82 3300014326 Ga0157380_10000273 Ga0157380_1000027325 73
83 3300025903 Ga0207680_10016173 Ga0207680_100161734 73
84 3300025911 Ga0207654_10518666 Ga0207654_105186662 73
85 3300025919 Ga0207657_10830356 Ga0207657_108303562 73
86 3300025920 Ga0207649_10000005 Ga0207649_10000005190 73
87 3300025928 Ga0207700_10000008 Ga0207700_10000008101 73
88 3300025929 Ga0207664_10428681 Ga0207664_104286812 73
89 3300025932 Ga0207690_10004158 Ga0207690_100041587 73
90 3300025938 Ga0207704_10917776 Ga0207704_109177762 73
91 3300025981 Ga0207640_10008463 Ga0207640_100084633 73
92 3300026121 Ga0207683_10007770 Ga0207683_100077702 73
93 3300028379 Ga0268266_10000303 Ga0268266_1000030342 73
94 3300035725 Ga0373947_0959493 Ga0373947_0959493_192_449 73
95 3300044842 Ga0466957_0078742 Ga0466957_0078742_1476_1730 73
96 3300046459 Ga0495629_0074120 Ga0495629_0074120_1945_2199 73
97 3300046511 Ga0495608_0000094 Ga0495608_0000094_40077_40331 73
98 3300046529 Ga0495652_0920405 Ga0495652_0920405_293_547 73
99 3300046533 Ga0495640_0103784 Ga0495640_0103784_819_1076 73
100 3300046642 Ga0495634_0000063 Ga0495634_0000063_38240_38494 73
101 3300046642 Ga0495634_0303156 Ga0495634_0303156_591_848 73
102 3300046663 Ga0495635_0000096 Ga0495635_0000096_18261_18515 73
103 3300046674 Ga0495588_0000250 Ga0495588_0000250_30941_31195 73
104 3300046675 Ga0495657_0000152 Ga0495657_0000152_23864_24118 73
105 3300046689 Ga0495613_0000068 Ga0495613_0000068_61476_61730 73
106 3300047317 Ga0495604_0002184 Ga0495604_0002184_14168_14422 73
107 3300047317 Ga0495604_0029544 Ga0495604_0029544_3504_3758 73
108 3300047317 Ga0495604_0077035 Ga0495604_0077035_1095_1349 73
109 3300047321 Ga0495676_0235762 Ga0495676_0235762_755_1012 73
110 3300047444 Ga0495675_0000095 Ga0495675_0000095_38783_39037 73
111 3300047471 Ga0495684_0219906 Ga0495684_0219906_948_1202 73
112 3300048088 Ga0495602_0000009 Ga0495602_0000009_35608_35862 73
113 3300048917 Ga0496114_0000003 Ga0496114_0000003_163622_163876 73
114 3300048918 Ga0496115_0000036 Ga0496115_0000036_105892_106146 73
115 3300053078 Ga0495612_0142350 Ga0495612_0142350_183_437 73
116 3300053084 Ga0495595_0000046 Ga0495595_0000046_23864_24118 73
117 3300053084 Ga0495595_0035599 Ga0495595_0035599_1497_1751 73
118 3300053085 Ga0495619_0000258 Ga0495619_0000258_23866_24120 73
119 3300053085 Ga0495619_0002135 Ga0495619_0002135_6721_6978 73
120 3300053085 Ga0495619_0536758 Ga0495619_0536758_156_410 73
121 3300005842 Ga0068858_100000329 Ga0068858_1000003292 74
122 3300006846 Ga0075430_100437756 Ga0075430_1004377562 74
123 3300006852 Ga0075433_10023785 Ga0075433_100237856 74
124 3300009176 Ga0105242_10049662 Ga0105242_100496623 74
125 3300025934 Ga0207686_10067989 Ga0207686_100679891 74
126 3300026035 Ga0207703_10000126 Ga0207703_1000012677 74
127 3300036401 Ga0373937_0083929 Ga0373937_0083929_1082_1339 74
128 3300046462 Ga0495651_0378302 Ga0495651_0378302_520_777 74
129 3300046511 Ga0495608_0004091 Ga0495608_0004091_4825_5082 74
130 3300046511 Ga0495608_0627757 Ga0495608_0627757_126_383 74
131 3300046516 Ga0495628_0104331 Ga0495628_0104331_1838_2095 74
132 3300046533 Ga0495640_0654582 Ga0495640_0654582_160_417 74
133 3300046663 Ga0495635_0069201 Ga0495635_0069201_521_778 74
134 3300046663 Ga0495635_0264380 Ga0495635_0264380_600_857 74
135 3300046689 Ga0495613_0000157 Ga0495613_0000157_49932_50189 74
136 3300046809 Ga0495600_0518756 Ga0495600_0518756_205_462 74
137 3300046809 Ga0495600_0783808 Ga0495600_0783808_121_378 74
138 3300047317 Ga0495604_0285970 Ga0495604_0285970_630_887 74
139 3300047322 Ga0495680_0353112 Ga0495680_0353112_73_330 74
140 3300047322 Ga0495680_0419430 Ga0495680_0419430_583_840 74
141 3300047673 Ga0495593_0070382 Ga0495593_0070382_1026_1283 74
142 3300048088 Ga0495602_0658944 Ga0495602_0658944_364_621 74
143 3300049590 Ga0501074_0494309 Ga0501074_0494309_484_741 74
144 3300049591 Ga0501075_0605436 Ga0501075_0605436_262_519 74
145 3300049824 Ga0501045_1432912 Ga0501045_1432912_180_437 74
146 3300050509 nmdc:mga0qj67_208347_c1 nmdc:mga0qj67_208347_c1_284_541 74
147 3300050509 nmdc:mga0qj67_55614_c1 nmdc:mga0qj67_55614_c1_2704_2961 74
148 3300053085 Ga0495619_0000001 Ga0495619_0000001_52158_52415 74
149 3300053085 Ga0495619_0011063 Ga0495619_0011063_547_804 74
150 3300053085 Ga0495619_0093831 Ga0495619_0093831_771_1028 74
151 3300005340 Ga0070689_100299358 Ga0070689_1002993582 75
152 3300005365 Ga0070688_100115200 Ga0070688_1001152002 75
153 3300013307 Ga0157372_11462184 Ga0157372_114621842 75
154 3300025939 Ga0207665_10166177 Ga0207665_101661772 75
155 3300047673 Ga0495593_0714123 Ga0495593_0714123_164_424 75
156 3300048908 Ga0496105_0074597 Ga0496105_0074597_164_424 75
157 3300049743 Ga0501081_0458192 Ga0501081_0458192_449_712 75
158 3300005440 Ga0070705_101945010 Ga0070705_1019450101 76
159 3300007076 Ga0075435_100604334 Ga0075435_1006043342 76
160 3300013296 Ga0157374_10119827 Ga0157374_101198272 76
161 3300017792 Ga0163161_10000018 Ga0163161_1000001841 76
162 3300046454 Ga0495592_0000324 Ga0495592_0000324_28341_28604 76
163 3300046455 Ga0495603_0006257 Ga0495603_0006257_2362_2625 76
164 3300046462 Ga0495651_0246589 Ga0495651_0246589_257_520 76
165 3300046463 Ga0495653_0152071 Ga0495653_0152071_595_858 76
166 3300046476 Ga0495662_0000250 Ga0495662_0000250_21626_21889 76
167 3300046511 Ga0495608_0000707 Ga0495608_0000707_10002_10265 76
168 3300046516 Ga0495628_0084311 Ga0495628_0084311_289_552 76
169 3300046533 Ga0495640_0094818 Ga0495640_0094818_1019_1282 76
170 3300046536 Ga0495587_0226731 Ga0495587_0226731_99_362 76
171 3300046543 Ga0495645_0290408 Ga0495645_0290408_210_473 76
172 3300046642 Ga0495634_0052837 Ga0495634_0052837_994_1257 76
173 3300046642 Ga0495634_0257403 Ga0495634_0257403_484_747 76
174 3300046675 Ga0495657_0026223 Ga0495657_0026223_3454_3717 76
175 3300046678 Ga0495599_0022572 Ga0495599_0022572_925_1188 76
176 3300046690 Ga0495624_0091972 Ga0495624_0091972_421_684 76
177 3300046694 Ga0495649_0011659 Ga0495649_0011659_3002_3265 76
178 3300046809 Ga0495600_0095777 Ga0495600_0095777_225_488 76
179 3300047322 Ga0495680_0001366 Ga0495680_0001366_12569_12832 76
180 3300047322 Ga0495680_0103494 Ga0495680_0103494_166_429 76
181 3300048916 Ga0496113_0830064 Ga0496113_0830064_114_377 76
182 3300050513 nmdc:mga0rr50_585399_c1 nmdc:mga0rr50_585399_c1_301_564 76
183 3300053084 Ga0495595_0000099 Ga0495595_0000099_18038_18301 76
184 3300005329 Ga0070683_100005054 Ga0070683_1000050542 77
185 3300005535 Ga0070684_100012486 Ga0070684_1000124867 77
186 3300005539 Ga0068853_100026834 Ga0068853_1000268346 77
187 3300005539 Ga0068853_100032420 Ga0068853_1000324202 77
188 3300025944 Ga0207661_10000848 Ga0207661_1000084817 77
189 3300026041 Ga0207639_10001873 Ga0207639_100018732 77
190 3300035172 Ga0373955_0277190 Ga0373955_0277190_39_308 77
191 3300041459 Ga0451800_0236026 Ga0451800_0236026_245_511 77
192 3300041496 Ga0451839_1389348 Ga0451839_1389348_74_340 77
193 3300041512 Ga0451853_0052401 Ga0451853_0052401_623_889 77
194 3300044694 Ga0466963_0000139 Ga0466963_0000139_21385_21651 77
195 3300046473 Ga0495582_0000013 Ga0495582_0000013_90661_90927 77
196 3300046514 Ga0495618_0483430 Ga0495618_0483430_461_727 77
197 3300046536 Ga0495587_0007568 Ga0495587_0007568_1756_2022 77
198 3300046642 Ga0495634_0105682 Ga0495634_0105682_297_563 77
199 3300046683 Ga0495658_0000009 Ga0495658_0000009_19455_19721 77
200 3300047322 Ga0495680_0000464 Ga0495680_0000464_11108_11374 77
201 3300053085 Ga0495619_0065143 Ga0495619_0065143_1479_1745 77

Feature Viewer

pLDDT pTM Quality
76.57 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map