F306618

General Info

Members Datasets Scaffolds Average Seq Length
200 179 401 143

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10045140|Ga0055531_100451402
Length 167
Sequence LSALISTCLVRARKGARSICDALSPRHEHHQHIVKPQPSELLLAWWAEQRDEDLFVASLTIAEIRRGILEKPRGKKRDVLDAWFSGPEGPQELFANRILPFDDKAALIWARLMAEGKATGRPRSALDMIIAAVAGANDCVVVTDNEKDFKGLQIVNPLRLGAGGEEK

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
118 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
119 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
120 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
121 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
128 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
129 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
130 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
131 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
132 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
133 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
134 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
135 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
136 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
137 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
138 2643221618 Ensifer sp. Root231 Isolate Unclassified
139 2643221626 Ensifer sp. Root31 Isolate Unclassified
140 2643221655 Ensifer sp. Root1252 Isolate Unclassified
141 2643221659 Ensifer sp. Root127 Isolate Unclassified
142 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
143 2643221698 Ensifer sp. Root142 Isolate Unclassified
144 2643221712 Ensifer sp. Root258 Isolate Unclassified
145 2643221723 Ensifer sp. Root278 Isolate Unclassified
146 2738541293 Rhizobium sp. GV031 Isolate Unclassified
147 2751185800 Brucella pituitosa AA2 Isolate Unclassified
148 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
149 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
150 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
151 2818991467 Bosea vestrisii 3192 Isolate Unclassified
152 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
153 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
154 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
155 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
156 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
157 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
158 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
159 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
160 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
161 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
162 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
163 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
164 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
165 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
166 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
167 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
168 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
169 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
170 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
171 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
172 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
173 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
174 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
175 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
176 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
177 8018176218 Rhizobium sp. N122 Isolate Nodule
178 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
179 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72
Metatranscriptomes 1.5
Isolates 26.5

Biome Distribution

Category Percentage (%)
Aerial Root 1
Bulb 0
Endosphere 25
Nodule 12.5
Rhizoplane 3
Rhizosphere 41
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10045140 3300003794 Bacteria 1227
2 JGI25159J45721_1018309 3300002987 Bacteria 1417
3 rootH1_10057032 3300003316 Bacteria 3937
4 rootH1_10057032 3300003323 Bacteria 1499
5 JGI25160J50197_1009167 3300003354 Bacteria 3696
6 JGI25160J50197_1013460 3300003354 Bacteria 2787
7 JGI25160J50197_1030185 3300003354 Bacteria 1417
8 JGI25161J50226_1009296 3300003374 Bacteria 1417
9 Ga0055526_1005123 3300003771 Bacteria 7642
10 Ga0055536_1044356 3300003781 Bacteria 1026
11 Ga0055543_1015670 3300004625 Bacteria 1455
12 Ga0065165_1010601 3300005262 Bacteria 3957
13 Ga0065165_1037972 3300005262 Bacteria 1455
14 Ga0070667_100892489 3300005367 Bacteria 827
15 Ga0070708_100027899 3300005445 Bacteria 4851
16 Ga0070706_100003267 3300005467 Bacteria 16030
17 Ga0070706_100003974 3300005467 Bacteria 14398
18 Ga0070707_100013666 3300005468 Bacteria 7603
19 Ga0070698_100008019 3300005471 Bacteria 11420
20 Ga0070698_100188378 3300005471 Bacteria 2001
21 Ga0070699_100004591 3300005518 Bacteria 12217
22 Ga0070699_100252080 3300005518 Bacteria 1577
23 Ga0070697_100001755 3300005536 Bacteria 16543
24 Ga0070697_100001918 3300005536 Bacteria 15921
25 Ga0068864_100000371 3300005618 Bacteria 39127
26 Ga0068858_100000166 3300005842 Bacteria 70016
27 Ga0070717_10051033 3300006028 Bacteria 3403
28 Ga0075368_10162380 3300006042 Bacteria 936
29 Ga0075363_100033956 3300006048 Bacteria 2661
30 Ga0075364_10001403 3300006051 Bacteria 13037
31 Ga0075362_10028413 3300006177 Bacteria 2402
32 Ga0075362_10061630 3300006177 Bacteria 1698
33 Ga0075367_10360085 3300006178 Bacteria 918
34 Ga0075369_10000514 3300006186 Bacteria 12124
35 Ga0097621_101423991 3300006237 Unclassified 656
36 Ga0075370_10403238 3300006353 Bacteria 820
37 Ga0105240_10015349 3300009093 Bacteria 10417
38 Ga0105247_10369194 3300009101 Bacteria 1014
39 Ga0105248_10017159 3300009177 Bacteria 7974
40 Ga0105238_11653758 3300009551 Bacteria 671
41 Ga0105249_10124485 3300009553 Bacteria 2453
42 Ga0105239_10038949 3300010375 Bacteria 5207
43 Ga0163163_10604601 3300014325 Bacteria 1160
44 Ga0163163_10780467 3300014325 Bacteria 1019
45 Ga0157376_10466381 3300014969 Bacteria 1235
46 Ga0213876_10428739 3300021384 Bacteria 703
47 Ga0209436_113045 3300025208 Bacteria 1378
48 Ga0207425_1069558 3300025245 Bacteria 606
49 Ga0209130_1001233 3300025284 Bacteria 17962
50 Ga0209676_1049048 3300025292 Bacteria 1123
51 Ga0209025_1000532 3300025294 Bacteria 72555
52 Ga0209564_1002896 3300025295 Bacteria 12521
53 Ga0209758_1098158 3300025297 Bacteria 840
54 Ga0209050_1020177 3300025298 Bacteria 2491
55 Ga0209256_1002761 3300025299 Bacteria 13550
56 Ga0207426_1001607 3300025302 Bacteria 17962
57 Ga0207710_10183105 3300025900 Bacteria 1028
58 Ga0207684_10007982 3300025910 Bacteria 9454
59 Ga0207684_10017863 3300025910 Bacteria 6081
60 Ga0207695_10000910 3300025913 Bacteria 53286
61 Ga0207693_10431736 3300025915 Bacteria 1030
62 Ga0207646_10000376 3300025922 Bacteria 59768
63 Ga0207711_10008484 3300025941 Bacteria 8598
64 Ga0207712_10238944 3300025961 Bacteria 1462
65 Ga0207658_10810193 3300025986 Bacteria 850
66 Ga0207703_10000711 3300026035 Bacteria 32868
67 Ga0207702_11684689 3300026078 Bacteria 627
68 Ga0207676_10000351 3300026095 Bacteria 39386
69 Ga0268266_10481233 3300028379 Bacteria 1183
70 Ga0265338_10411322 3300028800 Bacteria 963
71 Ga0268256_1004638 3300030500 Bacteria 5626
72 Ga0307511_10174783 3300030521 Bacteria 1171
73 Ga0265762_1003658 3300030760 Bacteria 2750
74 Ga0265763_1010677 3300030763 Unclassified 853
75 Ga0265760_10210737 3300031090 Unclassified 659
76 Ga0265328_10006161 3300031239 Bacteria 5102
77 Ga0265328_10089555 3300031239 Bacteria 1136
78 Ga0265328_10105146 3300031239 Bacteria 1047
79 Ga0265325_10209190 3300031241 Bacteria 897
80 Ga0265331_10000441 3300031250 Bacteria 40882
81 Ga0265327_10094006 3300031251 Bacteria 1458
82 Ga0307509_10462359 3300031507 Unclassified 960
83 Ga0307508_10336722 3300031616 Bacteria 1100
84 Ga0307410_11233578 3300031852 Bacteria 652
85 Ga0307415_101839500 3300032126 Bacteria 587
86 Ga0307507_10279608 3300033179 Bacteria 1045
87 Ga0307510_10226934 3300033180 Bacteria 1374
88 Ga0373935_0318287 3300035692 Bacteria 1103
89 Ga0373927_0257052 3300035695 Bacteria 1148
90 Ga0373927_0565125 3300035695 Bacteria 752
91 Ga0373925_0011133 3300037068 Bacteria 6524
92 Ga0373925_0136453 3300037068 Bacteria 1917
93 Ga0436364_0380715 3300037853 Bacteria 2282
94 Ga0436365_1122073 3300039437 Plasmid 3169
95 Ga0436365_1379597 3300039437 Bacteria 1220
96 Ga0436363_1146794 3300039450 Archaea 1211
97 Ga0439449_0257618 3300042007 Bacteria 656
98 Ga0439434_0058991 3300042435 Unclassified 1198
99 Ga0466972_0047606 3300044658 Bacteria 2073
100 Ga0495603_0423875 3300046455 Bacteria 762
101 Ga0495585_0321238 3300046492 Bacteria 757
102 Ga0495631_0218194 3300046518 Bacteria 814
103 Ga0495643_0068202 3300046522 Bacteria 1872
104 Ga0495622_0108423 3300046557 Bacteria 1272
105 Ga0495633_0047454 3300046558 Bacteria 2029
106 Ga0495633_0316796 3300046558 Bacteria 708
107 Ga0495656_0398607 3300046615 Bacteria 719
108 Ga0495588_0092152 3300046674 Bacteria 1588
109 Ga0495673_0021038 3300047469 Bacteria 3231
110 Ga0495681_0245745 3300047470 Bacteria 708
111 Ga0496101_0640358 3300048904 Bacteria 840
112 Ga0496103_0329406 3300048906 Bacteria 982
113 Ga0496106_0017678 3300048909 Bacteria 5274
114 Ga0496112_0024049 3300048915 Bacteria 5830
115 Ga0496117_0011979 3300048920 Bacteria 7704
116 Ga0496121_0013947 3300048924 Bacteria 8588
117 Ga0496121_0251630 3300048924 Bacteria 1225
118 Ga0496124_0011873 3300048927 Bacteria 8673
119 Ga0496124_0036350 3300048927 Bacteria 4297
120 Ga0496126_0047634 3300048929 Bacteria 3924
121 Ga0501037_0030760 3300049573 Bacteria 3965
122 Ga0501042_1408592 3300049578 Bacteria 508
123 Ga0501046_0072125 3300049580 Bacteria 2682
124 Ga0501047_1026915 3300049581 Bacteria 638
125 Ga0501238_043198 3300049671 Bacteria 666
126 Ga0501079_0805160 3300049741 Bacteria 740
127 nmdc:mga03683_454848_c1 3300050489 Bacteria 616
128 nmdc:mga03683_7374_c1 3300050489 Bacteria 3818
129 nmdc:mga03n38_195_c1 3300050490 Bacteria 13831
130 nmdc:mga00v17_1310_c1 3300050491 Bacteria 13032
131 nmdc:mga00v17_58337_c1 3300050491 Bacteria 2365
132 nmdc:mga0yw44_672_c1 3300050492 Bacteria 12477
133 nmdc:mga06z11_151242_c1 3300050494 Bacteria 1320
134 nmdc:mga04h51_178631_c1 3300050495 Bacteria 825
135 nmdc:mga07m45_1736_c1 3300050496 Bacteria 10028
136 nmdc:mga07m45_93307_c1 3300050496 Bacteria 1726
137 nmdc:mga0sz30_278_c1 3300050516 Bacteria 19605
138 Ga0500644_0030202 3300053088 Bacteria 1712
139 Ga0500566_0432233 3300053094 Bacteria 581
140 Ga0500658_0296691 3300053134 Bacteria 743
141 Ga0500561_0000215 3300053137 Bacteria 10503
142 Ga0500573_0193911 3300053140 Bacteria 1083
143 Ga0500636_0000013 3300053177 Bacteria 130122
144 Ga0500637_0241730 3300053178 Unclassified 1011
145 Ga0500657_080047 3300053728 Bacteria 1406
146 Ga0500645_028430 3300053730 Bacteria 1692
147 Ga0500609_013408 3300053731 Bacteria 1109
148 Ga0501082_0895197 3300060353 Bacteria 776
149 2510132864 2510065019 Bacteria 6903379
150 2511193477 2510917030 Bacteria 7460662
151 2513867680 2513237138 Bacteria 7368160
152 2515111816 2515075009 Bacteria 7288508
153 2515607339 2515154107 Bacteria 6795637
154 2515630787 2515154112 Bacteria 8294334
155 2517887693 2517572143 Bacteria 9484767
156 2559297990 2558860242 Bacteria 5568029
157 2585403792 2582581867 Bacteria 7184437
158 2585843806 2585427594 Bacteria 6180594
159 2599606276 2599185210 Bacteria 5624189
160 2644106613 2643221618 Bacteria 7717186
161 2644148197 2643221626 Bacteria 8069654
162 2644311009 2643221655 Bacteria 7722067
163 2644334994 2643221659 Bacteria 7890716
164 2644482894 2643221686 Bacteria 6310811
165 2644544037 2643221698 Bacteria 7756764
166 2644616842 2643221712 Bacteria 7729434
167 2644673626 2643221723 Bacteria 7095460
168 2738800883 2738541293 Bacteria 7065685
169 2753361027 2751185800 Bacteria 5467370
170 2758642749 2758568016 Bacteria 5645291
171 2765466358 2765235802 Bacteria 5618596
172 2805921641 2802429603 Bacteria 8777136
173 2819718788 2818991467 Bacteria 5893227
174 2841915540 2841911363 Bacteria 6173697
175 2841920742 2841917233 Bacteria 6173500
176 2842334923 2842333319 Bacteria 8899485
177 2842702519 2842698319 Bacteria 5190321
178 2857537400 2857531043 Bacteria 6754041
179 2908758117 2908756301 Bacteria 8864324
180 2926765375 2926760298 Bacteria 5505990
181 2929142746 2929138655 Bacteria 5810547
182 2935638265 2935630451 Bacteria 8169952
183 2935886871 2935883170 Bacteria 7964738
184 2936373177 2936367885 Bacteria 7324495
185 2936381322 2936375103 Bacteria 6652732
186 2936998673 2936996657 Bacteria 6298727
187 2941514905 2941507105 Bacteria 8166816
188 2941522840 2941515067 Bacteria 8166720
189 2941530799 2941523033 Bacteria 8169134
190 2979095373 2979089926 Bacteria 5670289
191 2979097627 2979095461 Bacteria 5669583
192 2984587740 2984587000 Bacteria 5263363
193 2984606598 2984601300 Bacteria 5455244
194 3005589766 3005587118 Bacteria 7794411
195 8005378742 8005376324 Bacteria 6590079
196 8005462474 8005460587 Bacteria 7157962
197 8005701355 8005695170 Bacteria 6912330
198 8016617239 8016613128 Bacteria 8794220
199 8018181973 8018176218 Bacteria 6896178
200 8019560592 8019555841 Bacteria 9642137
201 8019570684 8019565922 Bacteria 9639779
202 Ga0055531_10045140
203 JGI25159J45721_1018309
204 rootH1_10057032
205 JGI25160J50197_1009167
206 JGI25160J50197_1013460
207 JGI25160J50197_1030185
208 JGI25161J50226_1009296
209 Ga0055526_1005123
210 Ga0055536_1044356
211 Ga0055543_1015670
212 Ga0065165_1010601
213 Ga0065165_1037972
214 Ga0070667_100892489
215 Ga0070708_100027899
216 Ga0070706_100003267
217 Ga0070706_100003974
218 Ga0070707_100013666
219 Ga0070698_100008019
220 Ga0070698_100188378
221 Ga0070699_100004591
222 Ga0070699_100252080
223 Ga0070697_100001755
224 Ga0070697_100001918
225 Ga0068864_100000371
226 Ga0068858_100000166
227 Ga0070717_10051033
228 Ga0075368_10162380
229 Ga0075363_100033956
230 Ga0075364_10001403
231 Ga0075362_10028413
232 Ga0075362_10061630
233 Ga0075367_10360085
234 Ga0075369_10000514
235 Ga0097621_101423991
236 Ga0075370_10403238
237 Ga0105240_10015349
238 Ga0105247_10369194
239 Ga0105248_10017159
240 Ga0105238_11653758
241 Ga0105249_10124485
242 Ga0105239_10038949
243 Ga0163163_10604601
244 Ga0163163_10780467
245 Ga0157376_10466381
246 Ga0213876_10428739
247 Ga0209436_113045
248 Ga0207425_1069558
249 Ga0209130_1001233
250 Ga0209676_1049048
251 Ga0209025_1000532
252 Ga0209564_1002896
253 Ga0209758_1098158
254 Ga0209050_1020177
255 Ga0209256_1002761
256 Ga0207426_1001607
257 Ga0207710_10183105
258 Ga0207684_10007982
259 Ga0207684_10017863
260 Ga0207695_10000910
261 Ga0207693_10431736
262 Ga0207646_10000376
263 Ga0207711_10008484
264 Ga0207712_10238944
265 Ga0207658_10810193
266 Ga0207703_10000711
267 Ga0207702_11684689
268 Ga0207676_10000351
269 Ga0268266_10481233
270 Ga0265338_10411322
271 Ga0268256_1004638
272 Ga0307511_10174783
273 Ga0265762_1003658
274 Ga0265763_1010677
275 Ga0265760_10210737
276 Ga0265328_10006161
277 Ga0265328_10089555
278 Ga0265328_10105146
279 Ga0265325_10209190
280 Ga0265331_10000441
281 Ga0265327_10094006
282 Ga0307509_10462359
283 Ga0307508_10336722
284 Ga0307410_11233578
285 Ga0307415_101839500
286 Ga0307507_10279608
287 Ga0307510_10226934
288 Ga0373935_0318287
289 Ga0373927_0257052
290 Ga0373927_0565125
291 Ga0373925_0011133
292 Ga0373925_0136453
293 Ga0436364_0380715
294 Ga0436365_1122073
295 Ga0436365_1379597
296 Ga0436363_1146794
297 Ga0439449_0257618
298 Ga0439434_0058991
299 Ga0466972_0047606
300 Ga0495603_0423875
301 Ga0495585_0321238
302 Ga0495631_0218194
303 Ga0495643_0068202
304 Ga0495622_0108423
305 Ga0495633_0047454
306 Ga0495633_0316796
307 Ga0495656_0398607
308 Ga0495588_0092152
309 Ga0495673_0021038
310 Ga0495681_0245745
311 Ga0496101_0640358
312 Ga0496103_0329406
313 Ga0496106_0017678
314 Ga0496112_0024049
315 Ga0496117_0011979
316 Ga0496121_0013947
317 Ga0496121_0251630
318 Ga0496124_0011873
319 Ga0496124_0036350
320 Ga0496126_0047634
321 Ga0501037_0030760
322 Ga0501042_1408592
323 Ga0501046_0072125
324 Ga0501047_1026915
325 Ga0501238_043198
326 Ga0501079_0805160
327 nmdc:mga03683_454848_c1
328 nmdc:mga03683_7374_c1
329 nmdc:mga03n38_195_c1
330 nmdc:mga00v17_1310_c1
331 nmdc:mga00v17_58337_c1
332 nmdc:mga0yw44_672_c1
333 nmdc:mga06z11_151242_c1
334 nmdc:mga04h51_178631_c1
335 nmdc:mga07m45_1736_c1
336 nmdc:mga07m45_93307_c1
337 nmdc:mga0sz30_278_c1
338 Ga0500644_0030202
339 Ga0500566_0432233
340 Ga0500658_0296691
341 Ga0500561_0000215
342 Ga0500573_0193911
343 Ga0500636_0000013
344 Ga0500637_0241730
345 Ga0500657_080047
346 Ga0500645_028430
347 Ga0500609_013408
348 Ga0501082_0895197
349 2510132864
350 2511193477
351 2513867680
352 2515111816
353 2515607339
354 2515630787
355 2517887693
356 2559297990
357 2585403792
358 2585843806
359 2599606276
360 2644106613
361 2644148197
362 2644311009
363 2644334994
364 2644482894
365 2644544037
366 2644616842
367 2644673626
368 2738800883
369 2753361027
370 2758642749
371 2765466358
372 2805921641
373 2819718788
374 2841915540
375 2841920742
376 2842334923
377 2842702519
378 2857537400
379 2908758117
380 2926765375
381 2929142746
382 2935638265
383 2935886871
384 2936373177
385 2936381322
386 2936998673
387 2941514905
388 2941522840
389 2941530799
390 2979095373
391 2979097627
392 2984587740
393 2984606598
394 3005589766
395 8005378742
396 8005462474
397 8005701355
398 8016617239
399 8018181973
400 8019560592
401 8019570684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

32

154

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9035 4 138
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9002 4 141
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.8882 4 141
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.8504 4 138
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8264 1 133
ID Description Score Start End Superfamily
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9035 4 138 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8449 4 138 3.40.50.1010
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8214 4 76 3.40.50.1010
af_P0CF93_79_330_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.7908 84 113 3.90.350.10
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7833 2 137 3.40.50.1010
ID Description Score Start End GO Terms
AF-K0PNY2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9991 1 140 GO:0000287
GO:0004540
GO:0090729
AF-A0A7W6XNK8-F1-model_v4 deleted 0.9941 29 139
AF-K2JSS0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9939 1 140 GO:0000287
GO:0004540
GO:0090729
AF-N6VEV9-F1-model_v4 PilT domain-containing protein 0.981 1 140 GO:0004518
GO:0046872
AF-A0A527Z4Y1-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9774 1 92 GO:0004518
GO:0046872

Map