F306199

General Info

Members Datasets Scaffolds Average Seq Length
199 120 199 86

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0000060|Ga0495608_0000060_23320_23625
Length 101
Sequence MPRRADPQIGLSQAIKQLRRELQLSQEALGFAADIHPTWISHVESGRVNPTWGNVRRIAVGLRVPLPVLAALAEDLEVKHGVDQLPHGADADADSRRFPRK

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 8.04
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_10023394 3300004801 Bacteria 878
2 Ga0070658_10865861 3300005327 Bacteria 785
3 Ga0070683_100000411 3300005329 Bacteria 29635
4 Ga0070683_100002781 3300005329 Bacteria 13987
5 Ga0070683_100003984 3300005329 Bacteria 12093
6 Ga0070683_100298777 3300005329 Bacteria 1532
7 Ga0070683_100953814 3300005329 Bacteria 823
8 Ga0070666_10016079 3300005335 Bacteria 4782
9 Ga0070682_100000011 3300005337 Bacteria 266253
10 Ga0068868_100003920 3300005338 Bacteria 10394
11 Ga0070660_100770858 3300005339 Bacteria 808
12 Ga0070689_100437859 3300005340 Unclassified 1110
13 Ga0070661_100000004 3300005344 Bacteria 243876
14 Ga0070661_100000226 3300005344 Bacteria 46716
15 Ga0070668_100026404 3300005347 Bacteria 4407
16 Ga0070668_100044660 3300005347 Bacteria 3399
17 Ga0070668_100195565 3300005347 Bacteria 1658
18 Ga0070675_100000027 3300005354 Bacteria 106172
19 Ga0070675_100000028 3300005354 Bacteria 103914
20 Ga0070673_101473701 3300005364 Unclassified 641
21 Ga0070688_100000251 3300005365 Bacteria 28262
22 Ga0070688_100000283 3300005365 Bacteria 26109
23 Ga0070688_100001665 3300005365 Bacteria 11120
24 Ga0070688_100042296 3300005365 Bacteria 2802
25 Ga0070688_100093254 3300005365 Unclassified 1971
26 Ga0070659_100051774 3300005366 Bacteria 3229
27 Ga0070714_100717133 3300005435 Bacteria 966
28 Ga0070714_101030617 3300005435 Bacteria 801
29 Ga0070713_100000058 3300005436 Bacteria 70009
30 Ga0070713_100000085 3300005436 Bacteria 58902
31 Ga0070713_100050223 3300005436 Bacteria 3444
32 Ga0070711_100163522 3300005439 Bacteria 1689
33 Ga0070663_100393604 3300005455 Unclassified 1131
34 Ga0070678_100015301 3300005456 Bacteria 4872
35 Ga0070685_10000053 3300005466 Bacteria 70868
36 Ga0070685_10000141 3300005466 Bacteria 46333
37 Ga0070685_10000431 3300005466 Bacteria 24526
38 Ga0070685_10121971 3300005466 Unclassified 1619
39 Ga0070685_10585976 3300005466 Unclassified 801
40 Ga0070684_100001485 3300005535 Bacteria 16922
41 Ga0070684_100035324 3300005535 Bacteria 4278
42 Ga0070684_100039519 3300005535 Bacteria 4058
43 Ga0070684_100298168 3300005535 Unclassified 1479
44 Ga0070672_100000567 3300005543 Bacteria 21663
45 Ga0070665_100004723 3300005548 Bacteria 14190
46 Ga0070665_100124491 3300005548 Unclassified 2580
47 Ga0068855_100064778 3300005563 Bacteria 4262
48 Ga0070664_100010607 3300005564 Bacteria 7467
49 Ga0070664_100068867 3300005564 Bacteria 3026
50 Ga0068857_100984701 3300005577 Bacteria 811
51 Ga0068854_100000249 3300005578 Bacteria 36592
52 Ga0068854_100294684 3300005578 Bacteria 1310
53 Ga0068856_100016501 3300005614 Bacteria 7149
54 Ga0068852_100457607 3300005616 Unclassified 1264
55 Ga0068861_100321877 3300005719 Bacteria 1347
56 Ga0068851_10000126 3300005834 Bacteria 41437
57 Ga0068851_10000183 3300005834 Bacteria 31166
58 Ga0068851_10012003 3300005834 Bacteria 4075
59 Ga0068862_101650818 3300005844 Bacteria 648
60 Ga0070715_10109707 3300006163 Bacteria 1300
61 Ga0070712_100002000 3300006175 Bacteria 12482
62 Ga0075430_100127711 3300006846 Unclassified 2119
63 Ga0075436_101005222 3300006914 Bacteria 626
64 Ga0105245_10000917 3300009098 Bacteria 26795
65 Ga0105245_10014323 3300009098 Bacteria 6909
66 Ga0105247_10023389 3300009101 Bacteria 3723
67 Ga0105247_10227041 3300009101 Bacteria 1266
68 Ga0105243_10013530 3300009148 Bacteria 6172
69 Ga0105243_10022068 3300009148 Bacteria 4837
70 Ga0105242_11113248 3300009176 Bacteria 804
71 Ga0105239_10103768 3300010375 Bacteria 3147
72 Ga0157371_10715329 3300013102 Unclassified 750
73 Ga0157370_10402633 3300013104 Bacteria 1260
74 Ga0157369_10000020 3300013105 Bacteria 241679
75 Ga0157378_10020160 3300013297 Bacteria 5864
76 Ga0157378_10102671 3300013297 Bacteria 2612
77 Ga0157378_11777498 3300013297 Unclassified 664
78 Ga0157372_10000210 3300013307 Bacteria 65290
79 Ga0157375_10190747 3300013308 Bacteria 2204
80 Ga0157375_12450987 3300013308 Bacteria 623
81 Ga0157380_10000323 3300014326 Bacteria 28968
82 Ga0157380_11493976 3300014326 Unclassified 728
83 Ga0157379_10913363 3300014968 Bacteria 833
84 Ga0157376_10037755 3300014969 Bacteria 3925
85 Ga0206353_10732273 3300020082 Bacteria 1342
86 Ga0154015_1443016 3300020610 Bacteria 802
87 Ga0207656_10000415 3300025321 Bacteria 14390
88 Ga0207656_10000784 3300025321 Bacteria 10384
89 Ga0207656_10078359 3300025321 Bacteria 1481
90 Ga0207680_10009452 3300025903 Bacteria 4837
91 Ga0207685_10086059 3300025905 Bacteria 1312
92 Ga0207643_10431218 3300025908 Bacteria 836
93 Ga0207693_10004030 3300025915 Bacteria 12483
94 Ga0207663_10056930 3300025916 Unclassified 2461
95 Ga0207663_11023652 3300025916 Unclassified 663
96 Ga0207657_10338043 3300025919 Bacteria 1189
97 Ga0207649_10000003 3300025920 Bacteria 388908
98 Ga0207649_10000009 3300025920 Bacteria 295544
99 Ga0207659_10000010 3300025926 Bacteria 286639
100 Ga0207659_10000018 3300025926 Bacteria 156920
101 Ga0207687_10000007 3300025927 Bacteria 604185
102 Ga0207687_10001054 3300025927 Bacteria 18684
103 Ga0207700_10000003 3300025928 Bacteria 500797
104 Ga0207700_10000027 3300025928 Bacteria 137708
105 Ga0207700_10009389 3300025928 Bacteria 6105
106 Ga0207664_10070614 3300025929 Bacteria 2811
107 Ga0207664_10489431 3300025929 Bacteria 1101
108 Ga0207690_10058909 3300025932 Bacteria 2600
109 Ga0207686_10714152 3300025934 Bacteria 798
110 Ga0207709_10003185 3300025935 Bacteria 9859
111 Ga0207709_10031537 3300025935 Bacteria 3096
112 Ga0207670_10365348 3300025936 Bacteria 1146
113 Ga0207691_10000002 3300025940 Bacteria 189785
114 Ga0207711_10697211 3300025941 Unclassified 947
115 Ga0207661_10000693 3300025944 Bacteria 21892
116 Ga0207661_10000774 3300025944 Bacteria 20762
117 Ga0207661_10009788 3300025944 Bacteria 6885
118 Ga0207661_10244231 3300025944 Bacteria 1594
119 Ga0207661_10857114 3300025944 Bacteria 836
120 Ga0207679_10050968 3300025945 Bacteria 3028
121 Ga0207679_10082316 3300025945 Bacteria 2464
122 Ga0207667_10043988 3300025949 Bacteria 4736
123 Ga0207668_10008365 3300025972 Bacteria 6163
124 Ga0207668_10032482 3300025972 Bacteria 3449
125 Ga0207668_10260410 3300025972 Unclassified 1413
126 Ga0207640_10000114 3300025981 Bacteria 60718
127 Ga0207677_10000361 3300026023 Bacteria 31898
128 Ga0207678_10192400 3300026067 Bacteria 1744
129 Ga0207702_10005634 3300026078 Bacteria 10921
130 Ga0207675_101035142 3300026118 Unclassified 840
131 Ga0207683_10005919 3300026121 Bacteria 10477
132 Ga0268266_10001210 3300028379 Bacteria 31835
133 Ga0268266_10091822 3300028379 Unclassified 2663
134 Ga0268265_11623437 3300028380 Bacteria 652
135 Ga0307415_100308830 3300032126 Bacteria 1313
136 Ga0451807_1617170 3300041486 Bacteria 632
137 Ga0466957_0001083 3300044842 Bacteria 14051
138 Ga0466957_0071939 3300044842 Bacteria 2140
139 Ga0466957_0075117 3300044842 Bacteria 2097
140 Ga0466958_0089768 3300045836 Bacteria 1900
141 Ga0495629_0000025 3300046459 Bacteria 135624
142 Ga0495629_0000264 3300046459 Bacteria 45511
143 Ga0495641_0272530 3300046461 Bacteria 761
144 Ga0495594_0000003 3300046499 Bacteria 199267
145 Ga0495606_0000017 3300046507 Bacteria 284549
146 Ga0495606_0000072 3300046507 Bacteria 173678
147 Ga0495608_0000035 3300046511 Bacteria 133011
148 Ga0495608_0000060 3300046511 Bacteria 88189
149 Ga0495630_0000034 3300046517 Bacteria 126055
150 Ga0495622_0000180 3300046557 Bacteria 51095
151 Ga0495588_0000229 3300046674 Bacteria 50351
152 Ga0495657_0000004 3300046675 Bacteria 266465
153 Ga0495657_0000026 3300046675 Bacteria 133011
154 Ga0495647_0000049 3300046681 Bacteria 34446
155 Ga0495669_0359404 3300046684 Unclassified 704
156 Ga0495613_0000094 3300046689 Bacteria 86601
157 Ga0495624_0000831 3300046690 Bacteria 24421
158 Ga0495624_0117910 3300046690 Bacteria 1631
159 Ga0495624_0454639 3300046690 Unclassified 767
160 Ga0495600_0001722 3300046809 Bacteria 12241
161 Ga0495660_0081272 3300046810 Bacteria 1699
162 Ga0495604_0003648 3300047317 Bacteria 12274
163 Ga0495604_0019315 3300047317 Bacteria 5454
164 Ga0495676_0565373 3300047321 Bacteria 742
165 Ga0495675_0000015 3300047444 Bacteria 133004
166 Ga0495675_0000040 3300047444 Bacteria 86266
167 Ga0495602_0000041 3300048088 Bacteria 126954
168 Ga0495602_0166837 3300048088 Bacteria 1713
169 Ga0496108_0018524 3300048911 Bacteria 5702
170 Ga0496109_0000264 3300048912 Bacteria 50480
171 Ga0496110_0000021 3300048913 Bacteria 77064
172 Ga0496110_0004182 3300048913 Bacteria 11148
173 Ga0496110_0097512 3300048913 Bacteria 2634
174 Ga0496110_0323652 3300048913 Unclassified 1404
175 Ga0496110_1789565 3300048913 Unclassified 524
176 Ga0496111_0000009 3300048914 Bacteria 93943
177 Ga0496111_0000117 3300048914 Bacteria 34553
178 Ga0496111_0052165 3300048914 Bacteria 2953
179 Ga0496111_0083483 3300048914 Bacteria 2334
180 Ga0496111_0444812 3300048914 Unclassified 956
181 Ga0496113_1230057 3300048916 Bacteria 584
182 Ga0496114_0232732 3300048917 Bacteria 1619
183 Ga0496114_0320690 3300048917 Bacteria 1369
184 Ga0501068_0106000 3300049584 Bacteria 1745
185 nmdc:mga0qj67_143094_c1 3300050509 Unclassified 1939
186 nmdc:mga08x19_862352_c1 3300050514 Bacteria 643
187 Ga0495601_0000017 3300053077 Bacteria 204209
188 Ga0495601_0477434 3300053077 Bacteria 805
189 Ga0495612_0004401 3300053078 Bacteria 5842
190 Ga0495612_0007505 3300053078 Bacteria 4457
191 Ga0495655_0047881 3300053083 Bacteria 1120
192 Ga0495595_0000003 3300053084 Bacteria 266465
193 Ga0495595_0000017 3300053084 Bacteria 133011
194 Ga0495595_0014208 3300053084 Bacteria 3374
195 Ga0495619_0000116 3300053085 Bacteria 58748
196 Ga0495619_0000131 3300053085 Bacteria 55500
197 Ga0495619_0000144 3300053085 Bacteria 52554
198 Ga0495619_0000311 3300053085 Bacteria 34086
199 Ga0500641_0008613 3300053096 Bacteria 3646

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10865861 Ga0070658_108658612 81
2 3300005338 Ga0068868_100003920 Ga0068868_10000392013 81
3 3300005344 Ga0070661_100000004 Ga0070661_1000000043 81
4 3300005347 Ga0070668_100195565 Ga0070668_1001955652 81
5 3300005364 Ga0070673_101473701 Ga0070673_1014737012 81
6 3300005365 Ga0070688_100000251 Ga0070688_1000002512 81
7 3300005466 Ga0070685_10000053 Ga0070685_1000005346 81
8 3300005548 Ga0070665_100124491 Ga0070665_1001244914 81
9 3300005719 Ga0068861_100321877 Ga0068861_1003218773 81
10 3300005834 Ga0068851_10000126 Ga0068851_100001267 81
11 3300005834 Ga0068851_10000183 Ga0068851_1000018310 81
12 3300009098 Ga0105245_10000917 Ga0105245_1000091710 81
13 3300013307 Ga0157372_10000210 Ga0157372_1000021052 81
14 3300025321 Ga0207656_10000415 Ga0207656_1000041511 81
15 3300025321 Ga0207656_10000784 Ga0207656_100007846 81
16 3300025920 Ga0207649_10000003 Ga0207649_10000003256 81
17 3300025927 Ga0207687_10001054 Ga0207687_100010542 81
18 3300025972 Ga0207668_10260410 Ga0207668_102604102 81
19 3300026023 Ga0207677_10000361 Ga0207677_1000036110 81
20 3300026118 Ga0207675_101035142 Ga0207675_1010351422 81
21 3300028379 Ga0268266_10091822 Ga0268266_100918224 81
22 3300041486 Ga0451807_1617170 Ga0451807_1617170_28_273 81
23 3300048913 Ga0496110_0000021 Ga0496110_0000021_61226_61471 81
24 3300048914 Ga0496111_0000009 Ga0496111_0000009_15630_15875 81
25 3300053096 Ga0500641_0008613 Ga0500641_0008613_741_986 81
26 3300010375 Ga0105239_10103768 Ga0105239_101037686 82
27 3300014326 Ga0157380_10000323 Ga0157380_1000032331 82
28 3300046499 Ga0495594_0000003 Ga0495594_0000003_89585_89833 82
29 3300046557 Ga0495622_0000180 Ga0495622_0000180_3083_3331 82
30 3300049584 Ga0501068_0106000 Ga0501068_0106000_894_1142 82
31 3300005329 Ga0070683_100298777 Ga0070683_1002987773 83
32 3300005335 Ga0070666_10016079 Ga0070666_100160794 83
33 3300005337 Ga0070682_100000011 Ga0070682_100000011218 83
34 3300005339 Ga0070660_100770858 Ga0070660_1007708581 83
35 3300005347 Ga0070668_100044660 Ga0070668_1000446605 83
36 3300005365 Ga0070688_100042296 Ga0070688_1000422963 83
37 3300005366 Ga0070659_100051774 Ga0070659_1000517744 83
38 3300005435 Ga0070714_101030617 Ga0070714_1010306172 83
39 3300005436 Ga0070713_100000058 Ga0070713_10000005839 83
40 3300005436 Ga0070713_100050223 Ga0070713_1000502234 83
41 3300005456 Ga0070678_100015301 Ga0070678_1000153013 83
42 3300005466 Ga0070685_10585976 Ga0070685_105859762 83
43 3300005535 Ga0070684_100298168 Ga0070684_1002981681 83
44 3300005548 Ga0070665_100004723 Ga0070665_10000472315 83
45 3300005563 Ga0068855_100064778 Ga0068855_1000647784 83
46 3300005564 Ga0070664_100010607 Ga0070664_1000106072 83
47 3300005578 Ga0068854_100000249 Ga0068854_10000024913 83
48 3300005616 Ga0068852_100457607 Ga0068852_1004576071 83
49 3300005834 Ga0068851_10012003 Ga0068851_100120034 83
50 3300005844 Ga0068862_101650818 Ga0068862_1016508182 83
51 3300006163 Ga0070715_10109707 Ga0070715_101097073 83
52 3300006914 Ga0075436_101005222 Ga0075436_1010052222 83
53 3300009101 Ga0105247_10227041 Ga0105247_102270411 83
54 3300009148 Ga0105243_10022068 Ga0105243_100220687 83
55 3300009176 Ga0105242_11113248 Ga0105242_111132481 83
56 3300013104 Ga0157370_10402633 Ga0157370_104026333 83
57 3300013308 Ga0157375_10190747 Ga0157375_101907473 83
58 3300013308 Ga0157375_12450987 Ga0157375_124509871 83
59 3300014326 Ga0157380_11493976 Ga0157380_114939761 83
60 3300014969 Ga0157376_10037755 Ga0157376_100377553 83
61 3300020082 Ga0206353_10732273 Ga0206353_107322731 83
62 3300020610 Ga0154015_1443016 Ga0154015_14430162 83
63 3300025321 Ga0207656_10078359 Ga0207656_100783591 83
64 3300025903 Ga0207680_10009452 Ga0207680_100094526 83
65 3300025905 Ga0207685_10086059 Ga0207685_100860593 83
66 3300025916 Ga0207663_11023652 Ga0207663_110236521 83
67 3300025919 Ga0207657_10338043 Ga0207657_103380432 83
68 3300025928 Ga0207700_10000003 Ga0207700_10000003453 83
69 3300025928 Ga0207700_10009389 Ga0207700_100093898 83
70 3300025929 Ga0207664_10489431 Ga0207664_104894311 83
71 3300025932 Ga0207690_10058909 Ga0207690_100589095 83
72 3300025934 Ga0207686_10714152 Ga0207686_107141521 83
73 3300025935 Ga0207709_10031537 Ga0207709_100315372 83
74 3300025944 Ga0207661_10244231 Ga0207661_102442313 83
75 3300025945 Ga0207679_10082316 Ga0207679_100823162 83
76 3300025949 Ga0207667_10043988 Ga0207667_100439886 83
77 3300025972 Ga0207668_10032482 Ga0207668_100324825 83
78 3300025981 Ga0207640_10000114 Ga0207640_1000011433 83
79 3300026121 Ga0207683_10005919 Ga0207683_100059196 83
80 3300028379 Ga0268266_10001210 Ga0268266_1000121023 83
81 3300028380 Ga0268265_11623437 Ga0268265_116234372 83
82 3300032126 Ga0307415_100308830 Ga0307415_1003088302 83
83 3300044842 Ga0466957_0071939 Ga0466957_0071939_1698_1949 83
84 3300044842 Ga0466957_0075117 Ga0466957_0075117_593_847 83
85 3300045836 Ga0466958_0089768 Ga0466958_0089768_68_325 83
86 3300046459 Ga0495629_0000025 Ga0495629_0000025_1124_1375 83
87 3300046461 Ga0495641_0272530 Ga0495641_0272530_173_424 83
88 3300046507 Ga0495606_0000017 Ga0495606_0000017_266226_266477 83
89 3300046511 Ga0495608_0000035 Ga0495608_0000035_29999_30250 83
90 3300046517 Ga0495630_0000034 Ga0495630_0000034_10660_10911 83
91 3300046674 Ga0495588_0000229 Ga0495588_0000229_48449_48700 83
92 3300046675 Ga0495657_0000026 Ga0495657_0000026_102762_103013 83
93 3300046681 Ga0495647_0000049 Ga0495647_0000049_22729_22980 83
94 3300046684 Ga0495669_0359404 Ga0495669_0359404_418_669 83
95 3300046689 Ga0495613_0000094 Ga0495613_0000094_75775_76029 83
96 3300046690 Ga0495624_0000831 Ga0495624_0000831_10516_10767 83
97 3300046690 Ga0495624_0117910 Ga0495624_0117910_319_570 83
98 3300046809 Ga0495600_0001722 Ga0495600_0001722_522_776 83
99 3300046810 Ga0495660_0081272 Ga0495660_0081272_324_575 83
100 3300047317 Ga0495604_0003648 Ga0495604_0003648_649_903 83
101 3300047317 Ga0495604_0019315 Ga0495604_0019315_958_1212 83
102 3300047444 Ga0495675_0000015 Ga0495675_0000015_102755_103006 83
103 3300048088 Ga0495602_0000041 Ga0495602_0000041_10446_10700 83
104 3300048088 Ga0495602_0166837 Ga0495602_0166837_271_522 83
105 3300048913 Ga0496110_0004182 Ga0496110_0004182_10845_11096 83
106 3300048913 Ga0496110_0097512 Ga0496110_0097512_358_609 83
107 3300048913 Ga0496110_1789565 Ga0496110_1789565_250_501 83
108 3300048914 Ga0496111_0000117 Ga0496111_0000117_10451_10702 83
109 3300048914 Ga0496111_0083483 Ga0496111_0083483_1076_1327 83
110 3300048917 Ga0496114_0232732 Ga0496114_0232732_335_586 83
111 3300050514 nmdc:mga08x19_862352_c1 nmdc:mga08x19_862352_c1_61_312 83
112 3300053077 Ga0495601_0000017 Ga0495601_0000017_196586_196840 83
113 3300053078 Ga0495612_0004401 Ga0495612_0004401_530_781 83
114 3300053083 Ga0495655_0047881 Ga0495655_0047881_367_624 83
115 3300053084 Ga0495595_0000017 Ga0495595_0000017_102762_103013 83
116 3300053084 Ga0495595_0014208 Ga0495595_0014208_1229_1483 83
117 3300053085 Ga0495619_0000144 Ga0495619_0000144_23876_24127 83
118 3300053085 Ga0495619_0000311 Ga0495619_0000311_10661_10912 83
119 3300005329 Ga0070683_100000411 Ga0070683_1000004116 87
120 3300005354 Ga0070675_100000027 Ga0070675_10000002782 87
121 3300005535 Ga0070684_100001485 Ga0070684_1000014856 87
122 3300005578 Ga0068854_100294684 Ga0068854_1002946842 87
123 3300006175 Ga0070712_100002000 Ga0070712_10000200017 87
124 3300025915 Ga0207693_10004030 Ga0207693_1000403016 87
125 3300025926 Ga0207659_10000010 Ga0207659_1000001016 87
126 3300025944 Ga0207661_10009788 Ga0207661_100097884 87
127 3300048911 Ga0496108_0018524 Ga0496108_0018524_2072_2335 87
128 3300048912 Ga0496109_0000264 Ga0496109_0000264_34246_34509 87
129 3300048914 Ga0496111_0444812 Ga0496111_0444812_98_361 87
130 3300053078 Ga0495612_0007505 Ga0495612_0007505_4184_4447 87
131 3300005329 Ga0070683_100002781 Ga0070683_1000027819 88
132 3300005329 Ga0070683_100003984 Ga0070683_10000398410 88
133 3300005354 Ga0070675_100000028 Ga0070675_10000002829 88
134 3300005436 Ga0070713_100000085 Ga0070713_10000008554 88
135 3300005535 Ga0070684_100035324 Ga0070684_1000353243 88
136 3300005535 Ga0070684_100039519 Ga0070684_1000395193 88
137 3300005543 Ga0070672_100000567 Ga0070672_10000056711 88
138 3300005577 Ga0068857_100984701 Ga0068857_1009847011 88
139 3300006846 Ga0075430_100127711 Ga0075430_1001277113 88
140 3300013297 Ga0157378_11777498 Ga0157378_117774981 88
141 3300025926 Ga0207659_10000018 Ga0207659_10000018166 88
142 3300025928 Ga0207700_10000027 Ga0207700_1000002712 88
143 3300025940 Ga0207691_10000002 Ga0207691_10000002131 88
144 3300025944 Ga0207661_10000693 Ga0207661_1000069323 88
145 3300025944 Ga0207661_10000774 Ga0207661_1000077415 88
146 3300050509 nmdc:mga0qj67_143094_c1 nmdc:mga0qj67_143094_c1_1657_1923 88
147 3300005329 Ga0070683_100953814 Ga0070683_1009538141 92
148 3300005344 Ga0070661_100000226 Ga0070661_10000022613 92
149 3300005347 Ga0070668_100026404 Ga0070668_1000264044 92
150 3300005365 Ga0070688_100000283 Ga0070688_10000028330 92
151 3300005455 Ga0070663_100393604 Ga0070663_1003936042 92
152 3300005466 Ga0070685_10000431 Ga0070685_100004317 92
153 3300005564 Ga0070664_100068867 Ga0070664_1000688672 92
154 3300009101 Ga0105247_10023389 Ga0105247_100233893 92
155 3300009148 Ga0105243_10013530 Ga0105243_100135304 92
156 3300013102 Ga0157371_10715329 Ga0157371_107153292 92
157 3300013297 Ga0157378_10102671 Ga0157378_101026713 92
158 3300014968 Ga0157379_10913363 Ga0157379_109133632 92
159 3300025908 Ga0207643_10431218 Ga0207643_104312182 92
160 3300025920 Ga0207649_10000009 Ga0207649_10000009165 92
161 3300025935 Ga0207709_10003185 Ga0207709_100031858 92
162 3300025941 Ga0207711_10697211 Ga0207711_106972112 92
163 3300025944 Ga0207661_10857114 Ga0207661_108571141 92
164 3300025945 Ga0207679_10050968 Ga0207679_100509683 92
165 3300025972 Ga0207668_10008365 Ga0207668_100083652 92
166 3300026067 Ga0207678_10192400 Ga0207678_101924002 92
167 3300046459 Ga0495629_0000264 Ga0495629_0000264_24659_24937 92
168 3300046507 Ga0495606_0000072 Ga0495606_0000072_50776_51054 92
169 3300046690 Ga0495624_0454639 Ga0495624_0454639_242_520 92
170 3300047321 Ga0495676_0565373 Ga0495676_0565373_47_325 92
171 3300048913 Ga0496110_0323652 Ga0496110_0323652_1002_1280 92
172 3300048914 Ga0496111_0052165 Ga0496111_0052165_614_892 92
173 3300048917 Ga0496114_0320690 Ga0496114_0320690_759_1037 92
174 3300004801 Ga0058860_10023394 Ga0058860_100233942 93
175 3300005340 Ga0070689_100437859 Ga0070689_1004378591 93
176 3300005365 Ga0070688_100001665 Ga0070688_1000016659 93
177 3300005365 Ga0070688_100093254 Ga0070688_1000932542 93
178 3300005435 Ga0070714_100717133 Ga0070714_1007171332 93
179 3300005439 Ga0070711_100163522 Ga0070711_1001635222 93
180 3300005466 Ga0070685_10000141 Ga0070685_100001417 93
181 3300005466 Ga0070685_10121971 Ga0070685_101219713 93
182 3300005614 Ga0068856_100016501 Ga0068856_1000165013 93
183 3300009098 Ga0105245_10014323 Ga0105245_100143235 93
184 3300013105 Ga0157369_10000020 Ga0157369_10000020140 93
185 3300013297 Ga0157378_10020160 Ga0157378_100201605 93
186 3300025916 Ga0207663_10056930 Ga0207663_100569303 93
187 3300025927 Ga0207687_10000007 Ga0207687_10000007479 93
188 3300025929 Ga0207664_10070614 Ga0207664_100706141 93
189 3300025936 Ga0207670_10365348 Ga0207670_103653482 93
190 3300026078 Ga0207702_10005634 Ga0207702_1000563415 93
191 3300044842 Ga0466957_0001083 Ga0466957_0001083_4412_4693 93
192 3300046511 Ga0495608_0000060 Ga0495608_0000060_23320_23625 93
193 3300046675 Ga0495657_0000004 Ga0495657_0000004_201596_201901 93
194 3300047444 Ga0495675_0000040 Ga0495675_0000040_21416_21721 93
195 3300048916 Ga0496113_1230057 Ga0496113_1230057_25_309 93
196 3300053077 Ga0495601_0477434 Ga0495601_0477434_278_559 93
197 3300053084 Ga0495595_0000003 Ga0495595_0000003_201596_201901 93
198 3300053085 Ga0495619_0000116 Ga0495619_0000116_48363_48668 93
199 3300053085 Ga0495619_0000131 Ga0495619_0000131_39488_39781 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

15

69

0.97

PF13560

HTH_31

Helix-turn-helix domain

11

73

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9687 8 69
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9674 8 69
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9597 12 63
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9523 8 75
6rmq-assembly2.cif.gz_B-3 crystal structure of a selenomethionine-substituted a70m i84m mutant of the essential repressor ddro from radiation resistant-deinococcus bacteria (deinococcus deserti) 0.9517 11 71
ID Description Score Start End Superfamily
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9687 8 69 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9674 8 69 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9598 8 74 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9597 12 63 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9551 8 74 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3S0FVJ3-F1-model_v4 XRE family transcriptional regulator 0.9924 8 80 GO:0003677
GO:0003700
GO:0005829
AF-A0A495WHU3-F1-model_v4 Helix-turn-helix protein 0.9862 8 81 GO:0003677
AF-A0A5B8D6E1-F1-model_v4 deleted 0.9833 8 75
AF-A0A679HWV2-F1-model_v4 Uncharacterized protein 0.9817 8 84 GO:0003677
GO:0003700
GO:0005829
AF-G2JB94-F1-model_v4 Putative transcriptional regulator, XRE family 0.9803 8 83 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
87.2 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map