F306199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 120 | 199 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300046511|Ga0495608_0000060|Ga0495608_0000060_23320_23625 |
| Length | 101 |
| Sequence | MPRRADPQIGLSQAIKQLRRELQLSQEALGFAADIHPTWISHVESGRVNPTWGNVRRIAVGLRVPLPVLAALAEDLEVKHGVDQLPHGADADADSRRFPRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 84 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 85 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 86 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 87 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 109 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 110 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 111 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 112 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 8.04 |
| Rhizosphere | 90.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058860_10023394 | 3300004801 | Bacteria | 878 |
| 2 | Ga0070658_10865861 | 3300005327 | Bacteria | 785 |
| 3 | Ga0070683_100000411 | 3300005329 | Bacteria | 29635 |
| 4 | Ga0070683_100002781 | 3300005329 | Bacteria | 13987 |
| 5 | Ga0070683_100003984 | 3300005329 | Bacteria | 12093 |
| 6 | Ga0070683_100298777 | 3300005329 | Bacteria | 1532 |
| 7 | Ga0070683_100953814 | 3300005329 | Bacteria | 823 |
| 8 | Ga0070666_10016079 | 3300005335 | Bacteria | 4782 |
| 9 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 10 | Ga0068868_100003920 | 3300005338 | Bacteria | 10394 |
| 11 | Ga0070660_100770858 | 3300005339 | Bacteria | 808 |
| 12 | Ga0070689_100437859 | 3300005340 | Unclassified | 1110 |
| 13 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 14 | Ga0070661_100000226 | 3300005344 | Bacteria | 46716 |
| 15 | Ga0070668_100026404 | 3300005347 | Bacteria | 4407 |
| 16 | Ga0070668_100044660 | 3300005347 | Bacteria | 3399 |
| 17 | Ga0070668_100195565 | 3300005347 | Bacteria | 1658 |
| 18 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 19 | Ga0070675_100000028 | 3300005354 | Bacteria | 103914 |
| 20 | Ga0070673_101473701 | 3300005364 | Unclassified | 641 |
| 21 | Ga0070688_100000251 | 3300005365 | Bacteria | 28262 |
| 22 | Ga0070688_100000283 | 3300005365 | Bacteria | 26109 |
| 23 | Ga0070688_100001665 | 3300005365 | Bacteria | 11120 |
| 24 | Ga0070688_100042296 | 3300005365 | Bacteria | 2802 |
| 25 | Ga0070688_100093254 | 3300005365 | Unclassified | 1971 |
| 26 | Ga0070659_100051774 | 3300005366 | Bacteria | 3229 |
| 27 | Ga0070714_100717133 | 3300005435 | Bacteria | 966 |
| 28 | Ga0070714_101030617 | 3300005435 | Bacteria | 801 |
| 29 | Ga0070713_100000058 | 3300005436 | Bacteria | 70009 |
| 30 | Ga0070713_100000085 | 3300005436 | Bacteria | 58902 |
| 31 | Ga0070713_100050223 | 3300005436 | Bacteria | 3444 |
| 32 | Ga0070711_100163522 | 3300005439 | Bacteria | 1689 |
| 33 | Ga0070663_100393604 | 3300005455 | Unclassified | 1131 |
| 34 | Ga0070678_100015301 | 3300005456 | Bacteria | 4872 |
| 35 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 36 | Ga0070685_10000141 | 3300005466 | Bacteria | 46333 |
| 37 | Ga0070685_10000431 | 3300005466 | Bacteria | 24526 |
| 38 | Ga0070685_10121971 | 3300005466 | Unclassified | 1619 |
| 39 | Ga0070685_10585976 | 3300005466 | Unclassified | 801 |
| 40 | Ga0070684_100001485 | 3300005535 | Bacteria | 16922 |
| 41 | Ga0070684_100035324 | 3300005535 | Bacteria | 4278 |
| 42 | Ga0070684_100039519 | 3300005535 | Bacteria | 4058 |
| 43 | Ga0070684_100298168 | 3300005535 | Unclassified | 1479 |
| 44 | Ga0070672_100000567 | 3300005543 | Bacteria | 21663 |
| 45 | Ga0070665_100004723 | 3300005548 | Bacteria | 14190 |
| 46 | Ga0070665_100124491 | 3300005548 | Unclassified | 2580 |
| 47 | Ga0068855_100064778 | 3300005563 | Bacteria | 4262 |
| 48 | Ga0070664_100010607 | 3300005564 | Bacteria | 7467 |
| 49 | Ga0070664_100068867 | 3300005564 | Bacteria | 3026 |
| 50 | Ga0068857_100984701 | 3300005577 | Bacteria | 811 |
| 51 | Ga0068854_100000249 | 3300005578 | Bacteria | 36592 |
| 52 | Ga0068854_100294684 | 3300005578 | Bacteria | 1310 |
| 53 | Ga0068856_100016501 | 3300005614 | Bacteria | 7149 |
| 54 | Ga0068852_100457607 | 3300005616 | Unclassified | 1264 |
| 55 | Ga0068861_100321877 | 3300005719 | Bacteria | 1347 |
| 56 | Ga0068851_10000126 | 3300005834 | Bacteria | 41437 |
| 57 | Ga0068851_10000183 | 3300005834 | Bacteria | 31166 |
| 58 | Ga0068851_10012003 | 3300005834 | Bacteria | 4075 |
| 59 | Ga0068862_101650818 | 3300005844 | Bacteria | 648 |
| 60 | Ga0070715_10109707 | 3300006163 | Bacteria | 1300 |
| 61 | Ga0070712_100002000 | 3300006175 | Bacteria | 12482 |
| 62 | Ga0075430_100127711 | 3300006846 | Unclassified | 2119 |
| 63 | Ga0075436_101005222 | 3300006914 | Bacteria | 626 |
| 64 | Ga0105245_10000917 | 3300009098 | Bacteria | 26795 |
| 65 | Ga0105245_10014323 | 3300009098 | Bacteria | 6909 |
| 66 | Ga0105247_10023389 | 3300009101 | Bacteria | 3723 |
| 67 | Ga0105247_10227041 | 3300009101 | Bacteria | 1266 |
| 68 | Ga0105243_10013530 | 3300009148 | Bacteria | 6172 |
| 69 | Ga0105243_10022068 | 3300009148 | Bacteria | 4837 |
| 70 | Ga0105242_11113248 | 3300009176 | Bacteria | 804 |
| 71 | Ga0105239_10103768 | 3300010375 | Bacteria | 3147 |
| 72 | Ga0157371_10715329 | 3300013102 | Unclassified | 750 |
| 73 | Ga0157370_10402633 | 3300013104 | Bacteria | 1260 |
| 74 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 75 | Ga0157378_10020160 | 3300013297 | Bacteria | 5864 |
| 76 | Ga0157378_10102671 | 3300013297 | Bacteria | 2612 |
| 77 | Ga0157378_11777498 | 3300013297 | Unclassified | 664 |
| 78 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 79 | Ga0157375_10190747 | 3300013308 | Bacteria | 2204 |
| 80 | Ga0157375_12450987 | 3300013308 | Bacteria | 623 |
| 81 | Ga0157380_10000323 | 3300014326 | Bacteria | 28968 |
| 82 | Ga0157380_11493976 | 3300014326 | Unclassified | 728 |
| 83 | Ga0157379_10913363 | 3300014968 | Bacteria | 833 |
| 84 | Ga0157376_10037755 | 3300014969 | Bacteria | 3925 |
| 85 | Ga0206353_10732273 | 3300020082 | Bacteria | 1342 |
| 86 | Ga0154015_1443016 | 3300020610 | Bacteria | 802 |
| 87 | Ga0207656_10000415 | 3300025321 | Bacteria | 14390 |
| 88 | Ga0207656_10000784 | 3300025321 | Bacteria | 10384 |
| 89 | Ga0207656_10078359 | 3300025321 | Bacteria | 1481 |
| 90 | Ga0207680_10009452 | 3300025903 | Bacteria | 4837 |
| 91 | Ga0207685_10086059 | 3300025905 | Bacteria | 1312 |
| 92 | Ga0207643_10431218 | 3300025908 | Bacteria | 836 |
| 93 | Ga0207693_10004030 | 3300025915 | Bacteria | 12483 |
| 94 | Ga0207663_10056930 | 3300025916 | Unclassified | 2461 |
| 95 | Ga0207663_11023652 | 3300025916 | Unclassified | 663 |
| 96 | Ga0207657_10338043 | 3300025919 | Bacteria | 1189 |
| 97 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 98 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 99 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 100 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 101 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 102 | Ga0207687_10001054 | 3300025927 | Bacteria | 18684 |
| 103 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 104 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 105 | Ga0207700_10009389 | 3300025928 | Bacteria | 6105 |
| 106 | Ga0207664_10070614 | 3300025929 | Bacteria | 2811 |
| 107 | Ga0207664_10489431 | 3300025929 | Bacteria | 1101 |
| 108 | Ga0207690_10058909 | 3300025932 | Bacteria | 2600 |
| 109 | Ga0207686_10714152 | 3300025934 | Bacteria | 798 |
| 110 | Ga0207709_10003185 | 3300025935 | Bacteria | 9859 |
| 111 | Ga0207709_10031537 | 3300025935 | Bacteria | 3096 |
| 112 | Ga0207670_10365348 | 3300025936 | Bacteria | 1146 |
| 113 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 114 | Ga0207711_10697211 | 3300025941 | Unclassified | 947 |
| 115 | Ga0207661_10000693 | 3300025944 | Bacteria | 21892 |
| 116 | Ga0207661_10000774 | 3300025944 | Bacteria | 20762 |
| 117 | Ga0207661_10009788 | 3300025944 | Bacteria | 6885 |
| 118 | Ga0207661_10244231 | 3300025944 | Bacteria | 1594 |
| 119 | Ga0207661_10857114 | 3300025944 | Bacteria | 836 |
| 120 | Ga0207679_10050968 | 3300025945 | Bacteria | 3028 |
| 121 | Ga0207679_10082316 | 3300025945 | Bacteria | 2464 |
| 122 | Ga0207667_10043988 | 3300025949 | Bacteria | 4736 |
| 123 | Ga0207668_10008365 | 3300025972 | Bacteria | 6163 |
| 124 | Ga0207668_10032482 | 3300025972 | Bacteria | 3449 |
| 125 | Ga0207668_10260410 | 3300025972 | Unclassified | 1413 |
| 126 | Ga0207640_10000114 | 3300025981 | Bacteria | 60718 |
| 127 | Ga0207677_10000361 | 3300026023 | Bacteria | 31898 |
| 128 | Ga0207678_10192400 | 3300026067 | Bacteria | 1744 |
| 129 | Ga0207702_10005634 | 3300026078 | Bacteria | 10921 |
| 130 | Ga0207675_101035142 | 3300026118 | Unclassified | 840 |
| 131 | Ga0207683_10005919 | 3300026121 | Bacteria | 10477 |
| 132 | Ga0268266_10001210 | 3300028379 | Bacteria | 31835 |
| 133 | Ga0268266_10091822 | 3300028379 | Unclassified | 2663 |
| 134 | Ga0268265_11623437 | 3300028380 | Bacteria | 652 |
| 135 | Ga0307415_100308830 | 3300032126 | Bacteria | 1313 |
| 136 | Ga0451807_1617170 | 3300041486 | Bacteria | 632 |
| 137 | Ga0466957_0001083 | 3300044842 | Bacteria | 14051 |
| 138 | Ga0466957_0071939 | 3300044842 | Bacteria | 2140 |
| 139 | Ga0466957_0075117 | 3300044842 | Bacteria | 2097 |
| 140 | Ga0466958_0089768 | 3300045836 | Bacteria | 1900 |
| 141 | Ga0495629_0000025 | 3300046459 | Bacteria | 135624 |
| 142 | Ga0495629_0000264 | 3300046459 | Bacteria | 45511 |
| 143 | Ga0495641_0272530 | 3300046461 | Bacteria | 761 |
| 144 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 145 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 146 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 147 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 148 | Ga0495608_0000060 | 3300046511 | Bacteria | 88189 |
| 149 | Ga0495630_0000034 | 3300046517 | Bacteria | 126055 |
| 150 | Ga0495622_0000180 | 3300046557 | Bacteria | 51095 |
| 151 | Ga0495588_0000229 | 3300046674 | Bacteria | 50351 |
| 152 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 153 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 154 | Ga0495647_0000049 | 3300046681 | Bacteria | 34446 |
| 155 | Ga0495669_0359404 | 3300046684 | Unclassified | 704 |
| 156 | Ga0495613_0000094 | 3300046689 | Bacteria | 86601 |
| 157 | Ga0495624_0000831 | 3300046690 | Bacteria | 24421 |
| 158 | Ga0495624_0117910 | 3300046690 | Bacteria | 1631 |
| 159 | Ga0495624_0454639 | 3300046690 | Unclassified | 767 |
| 160 | Ga0495600_0001722 | 3300046809 | Bacteria | 12241 |
| 161 | Ga0495660_0081272 | 3300046810 | Bacteria | 1699 |
| 162 | Ga0495604_0003648 | 3300047317 | Bacteria | 12274 |
| 163 | Ga0495604_0019315 | 3300047317 | Bacteria | 5454 |
| 164 | Ga0495676_0565373 | 3300047321 | Bacteria | 742 |
| 165 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 166 | Ga0495675_0000040 | 3300047444 | Bacteria | 86266 |
| 167 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 168 | Ga0495602_0166837 | 3300048088 | Bacteria | 1713 |
| 169 | Ga0496108_0018524 | 3300048911 | Bacteria | 5702 |
| 170 | Ga0496109_0000264 | 3300048912 | Bacteria | 50480 |
| 171 | Ga0496110_0000021 | 3300048913 | Bacteria | 77064 |
| 172 | Ga0496110_0004182 | 3300048913 | Bacteria | 11148 |
| 173 | Ga0496110_0097512 | 3300048913 | Bacteria | 2634 |
| 174 | Ga0496110_0323652 | 3300048913 | Unclassified | 1404 |
| 175 | Ga0496110_1789565 | 3300048913 | Unclassified | 524 |
| 176 | Ga0496111_0000009 | 3300048914 | Bacteria | 93943 |
| 177 | Ga0496111_0000117 | 3300048914 | Bacteria | 34553 |
| 178 | Ga0496111_0052165 | 3300048914 | Bacteria | 2953 |
| 179 | Ga0496111_0083483 | 3300048914 | Bacteria | 2334 |
| 180 | Ga0496111_0444812 | 3300048914 | Unclassified | 956 |
| 181 | Ga0496113_1230057 | 3300048916 | Bacteria | 584 |
| 182 | Ga0496114_0232732 | 3300048917 | Bacteria | 1619 |
| 183 | Ga0496114_0320690 | 3300048917 | Bacteria | 1369 |
| 184 | Ga0501068_0106000 | 3300049584 | Bacteria | 1745 |
| 185 | nmdc:mga0qj67_143094_c1 | 3300050509 | Unclassified | 1939 |
| 186 | nmdc:mga08x19_862352_c1 | 3300050514 | Bacteria | 643 |
| 187 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 188 | Ga0495601_0477434 | 3300053077 | Bacteria | 805 |
| 189 | Ga0495612_0004401 | 3300053078 | Bacteria | 5842 |
| 190 | Ga0495612_0007505 | 3300053078 | Bacteria | 4457 |
| 191 | Ga0495655_0047881 | 3300053083 | Bacteria | 1120 |
| 192 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 193 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 194 | Ga0495595_0014208 | 3300053084 | Bacteria | 3374 |
| 195 | Ga0495619_0000116 | 3300053085 | Bacteria | 58748 |
| 196 | Ga0495619_0000131 | 3300053085 | Bacteria | 55500 |
| 197 | Ga0495619_0000144 | 3300053085 | Bacteria | 52554 |
| 198 | Ga0495619_0000311 | 3300053085 | Bacteria | 34086 |
| 199 | Ga0500641_0008613 | 3300053096 | Bacteria | 3646 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10865861 | Ga0070658_108658612 | 81 |
| 2 | 3300005338 | Ga0068868_100003920 | Ga0068868_10000392013 | 81 |
| 3 | 3300005344 | Ga0070661_100000004 | Ga0070661_1000000043 | 81 |
| 4 | 3300005347 | Ga0070668_100195565 | Ga0070668_1001955652 | 81 |
| 5 | 3300005364 | Ga0070673_101473701 | Ga0070673_1014737012 | 81 |
| 6 | 3300005365 | Ga0070688_100000251 | Ga0070688_1000002512 | 81 |
| 7 | 3300005466 | Ga0070685_10000053 | Ga0070685_1000005346 | 81 |
| 8 | 3300005548 | Ga0070665_100124491 | Ga0070665_1001244914 | 81 |
| 9 | 3300005719 | Ga0068861_100321877 | Ga0068861_1003218773 | 81 |
| 10 | 3300005834 | Ga0068851_10000126 | Ga0068851_100001267 | 81 |
| 11 | 3300005834 | Ga0068851_10000183 | Ga0068851_1000018310 | 81 |
| 12 | 3300009098 | Ga0105245_10000917 | Ga0105245_1000091710 | 81 |
| 13 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021052 | 81 |
| 14 | 3300025321 | Ga0207656_10000415 | Ga0207656_1000041511 | 81 |
| 15 | 3300025321 | Ga0207656_10000784 | Ga0207656_100007846 | 81 |
| 16 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003256 | 81 |
| 17 | 3300025927 | Ga0207687_10001054 | Ga0207687_100010542 | 81 |
| 18 | 3300025972 | Ga0207668_10260410 | Ga0207668_102604102 | 81 |
| 19 | 3300026023 | Ga0207677_10000361 | Ga0207677_1000036110 | 81 |
| 20 | 3300026118 | Ga0207675_101035142 | Ga0207675_1010351422 | 81 |
| 21 | 3300028379 | Ga0268266_10091822 | Ga0268266_100918224 | 81 |
| 22 | 3300041486 | Ga0451807_1617170 | Ga0451807_1617170_28_273 | 81 |
| 23 | 3300048913 | Ga0496110_0000021 | Ga0496110_0000021_61226_61471 | 81 |
| 24 | 3300048914 | Ga0496111_0000009 | Ga0496111_0000009_15630_15875 | 81 |
| 25 | 3300053096 | Ga0500641_0008613 | Ga0500641_0008613_741_986 | 81 |
| 26 | 3300010375 | Ga0105239_10103768 | Ga0105239_101037686 | 82 |
| 27 | 3300014326 | Ga0157380_10000323 | Ga0157380_1000032331 | 82 |
| 28 | 3300046499 | Ga0495594_0000003 | Ga0495594_0000003_89585_89833 | 82 |
| 29 | 3300046557 | Ga0495622_0000180 | Ga0495622_0000180_3083_3331 | 82 |
| 30 | 3300049584 | Ga0501068_0106000 | Ga0501068_0106000_894_1142 | 82 |
| 31 | 3300005329 | Ga0070683_100298777 | Ga0070683_1002987773 | 83 |
| 32 | 3300005335 | Ga0070666_10016079 | Ga0070666_100160794 | 83 |
| 33 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011218 | 83 |
| 34 | 3300005339 | Ga0070660_100770858 | Ga0070660_1007708581 | 83 |
| 35 | 3300005347 | Ga0070668_100044660 | Ga0070668_1000446605 | 83 |
| 36 | 3300005365 | Ga0070688_100042296 | Ga0070688_1000422963 | 83 |
| 37 | 3300005366 | Ga0070659_100051774 | Ga0070659_1000517744 | 83 |
| 38 | 3300005435 | Ga0070714_101030617 | Ga0070714_1010306172 | 83 |
| 39 | 3300005436 | Ga0070713_100000058 | Ga0070713_10000005839 | 83 |
| 40 | 3300005436 | Ga0070713_100050223 | Ga0070713_1000502234 | 83 |
| 41 | 3300005456 | Ga0070678_100015301 | Ga0070678_1000153013 | 83 |
| 42 | 3300005466 | Ga0070685_10585976 | Ga0070685_105859762 | 83 |
| 43 | 3300005535 | Ga0070684_100298168 | Ga0070684_1002981681 | 83 |
| 44 | 3300005548 | Ga0070665_100004723 | Ga0070665_10000472315 | 83 |
| 45 | 3300005563 | Ga0068855_100064778 | Ga0068855_1000647784 | 83 |
| 46 | 3300005564 | Ga0070664_100010607 | Ga0070664_1000106072 | 83 |
| 47 | 3300005578 | Ga0068854_100000249 | Ga0068854_10000024913 | 83 |
| 48 | 3300005616 | Ga0068852_100457607 | Ga0068852_1004576071 | 83 |
| 49 | 3300005834 | Ga0068851_10012003 | Ga0068851_100120034 | 83 |
| 50 | 3300005844 | Ga0068862_101650818 | Ga0068862_1016508182 | 83 |
| 51 | 3300006163 | Ga0070715_10109707 | Ga0070715_101097073 | 83 |
| 52 | 3300006914 | Ga0075436_101005222 | Ga0075436_1010052222 | 83 |
| 53 | 3300009101 | Ga0105247_10227041 | Ga0105247_102270411 | 83 |
| 54 | 3300009148 | Ga0105243_10022068 | Ga0105243_100220687 | 83 |
| 55 | 3300009176 | Ga0105242_11113248 | Ga0105242_111132481 | 83 |
| 56 | 3300013104 | Ga0157370_10402633 | Ga0157370_104026333 | 83 |
| 57 | 3300013308 | Ga0157375_10190747 | Ga0157375_101907473 | 83 |
| 58 | 3300013308 | Ga0157375_12450987 | Ga0157375_124509871 | 83 |
| 59 | 3300014326 | Ga0157380_11493976 | Ga0157380_114939761 | 83 |
| 60 | 3300014969 | Ga0157376_10037755 | Ga0157376_100377553 | 83 |
| 61 | 3300020082 | Ga0206353_10732273 | Ga0206353_107322731 | 83 |
| 62 | 3300020610 | Ga0154015_1443016 | Ga0154015_14430162 | 83 |
| 63 | 3300025321 | Ga0207656_10078359 | Ga0207656_100783591 | 83 |
| 64 | 3300025903 | Ga0207680_10009452 | Ga0207680_100094526 | 83 |
| 65 | 3300025905 | Ga0207685_10086059 | Ga0207685_100860593 | 83 |
| 66 | 3300025916 | Ga0207663_11023652 | Ga0207663_110236521 | 83 |
| 67 | 3300025919 | Ga0207657_10338043 | Ga0207657_103380432 | 83 |
| 68 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003453 | 83 |
| 69 | 3300025928 | Ga0207700_10009389 | Ga0207700_100093898 | 83 |
| 70 | 3300025929 | Ga0207664_10489431 | Ga0207664_104894311 | 83 |
| 71 | 3300025932 | Ga0207690_10058909 | Ga0207690_100589095 | 83 |
| 72 | 3300025934 | Ga0207686_10714152 | Ga0207686_107141521 | 83 |
| 73 | 3300025935 | Ga0207709_10031537 | Ga0207709_100315372 | 83 |
| 74 | 3300025944 | Ga0207661_10244231 | Ga0207661_102442313 | 83 |
| 75 | 3300025945 | Ga0207679_10082316 | Ga0207679_100823162 | 83 |
| 76 | 3300025949 | Ga0207667_10043988 | Ga0207667_100439886 | 83 |
| 77 | 3300025972 | Ga0207668_10032482 | Ga0207668_100324825 | 83 |
| 78 | 3300025981 | Ga0207640_10000114 | Ga0207640_1000011433 | 83 |
| 79 | 3300026121 | Ga0207683_10005919 | Ga0207683_100059196 | 83 |
| 80 | 3300028379 | Ga0268266_10001210 | Ga0268266_1000121023 | 83 |
| 81 | 3300028380 | Ga0268265_11623437 | Ga0268265_116234372 | 83 |
| 82 | 3300032126 | Ga0307415_100308830 | Ga0307415_1003088302 | 83 |
| 83 | 3300044842 | Ga0466957_0071939 | Ga0466957_0071939_1698_1949 | 83 |
| 84 | 3300044842 | Ga0466957_0075117 | Ga0466957_0075117_593_847 | 83 |
| 85 | 3300045836 | Ga0466958_0089768 | Ga0466958_0089768_68_325 | 83 |
| 86 | 3300046459 | Ga0495629_0000025 | Ga0495629_0000025_1124_1375 | 83 |
| 87 | 3300046461 | Ga0495641_0272530 | Ga0495641_0272530_173_424 | 83 |
| 88 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_266226_266477 | 83 |
| 89 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_29999_30250 | 83 |
| 90 | 3300046517 | Ga0495630_0000034 | Ga0495630_0000034_10660_10911 | 83 |
| 91 | 3300046674 | Ga0495588_0000229 | Ga0495588_0000229_48449_48700 | 83 |
| 92 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_102762_103013 | 83 |
| 93 | 3300046681 | Ga0495647_0000049 | Ga0495647_0000049_22729_22980 | 83 |
| 94 | 3300046684 | Ga0495669_0359404 | Ga0495669_0359404_418_669 | 83 |
| 95 | 3300046689 | Ga0495613_0000094 | Ga0495613_0000094_75775_76029 | 83 |
| 96 | 3300046690 | Ga0495624_0000831 | Ga0495624_0000831_10516_10767 | 83 |
| 97 | 3300046690 | Ga0495624_0117910 | Ga0495624_0117910_319_570 | 83 |
| 98 | 3300046809 | Ga0495600_0001722 | Ga0495600_0001722_522_776 | 83 |
| 99 | 3300046810 | Ga0495660_0081272 | Ga0495660_0081272_324_575 | 83 |
| 100 | 3300047317 | Ga0495604_0003648 | Ga0495604_0003648_649_903 | 83 |
| 101 | 3300047317 | Ga0495604_0019315 | Ga0495604_0019315_958_1212 | 83 |
| 102 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_102755_103006 | 83 |
| 103 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_10446_10700 | 83 |
| 104 | 3300048088 | Ga0495602_0166837 | Ga0495602_0166837_271_522 | 83 |
| 105 | 3300048913 | Ga0496110_0004182 | Ga0496110_0004182_10845_11096 | 83 |
| 106 | 3300048913 | Ga0496110_0097512 | Ga0496110_0097512_358_609 | 83 |
| 107 | 3300048913 | Ga0496110_1789565 | Ga0496110_1789565_250_501 | 83 |
| 108 | 3300048914 | Ga0496111_0000117 | Ga0496111_0000117_10451_10702 | 83 |
| 109 | 3300048914 | Ga0496111_0083483 | Ga0496111_0083483_1076_1327 | 83 |
| 110 | 3300048917 | Ga0496114_0232732 | Ga0496114_0232732_335_586 | 83 |
| 111 | 3300050514 | nmdc:mga08x19_862352_c1 | nmdc:mga08x19_862352_c1_61_312 | 83 |
| 112 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_196586_196840 | 83 |
| 113 | 3300053078 | Ga0495612_0004401 | Ga0495612_0004401_530_781 | 83 |
| 114 | 3300053083 | Ga0495655_0047881 | Ga0495655_0047881_367_624 | 83 |
| 115 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_102762_103013 | 83 |
| 116 | 3300053084 | Ga0495595_0014208 | Ga0495595_0014208_1229_1483 | 83 |
| 117 | 3300053085 | Ga0495619_0000144 | Ga0495619_0000144_23876_24127 | 83 |
| 118 | 3300053085 | Ga0495619_0000311 | Ga0495619_0000311_10661_10912 | 83 |
| 119 | 3300005329 | Ga0070683_100000411 | Ga0070683_1000004116 | 87 |
| 120 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002782 | 87 |
| 121 | 3300005535 | Ga0070684_100001485 | Ga0070684_1000014856 | 87 |
| 122 | 3300005578 | Ga0068854_100294684 | Ga0068854_1002946842 | 87 |
| 123 | 3300006175 | Ga0070712_100002000 | Ga0070712_10000200017 | 87 |
| 124 | 3300025915 | Ga0207693_10004030 | Ga0207693_1000403016 | 87 |
| 125 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001016 | 87 |
| 126 | 3300025944 | Ga0207661_10009788 | Ga0207661_100097884 | 87 |
| 127 | 3300048911 | Ga0496108_0018524 | Ga0496108_0018524_2072_2335 | 87 |
| 128 | 3300048912 | Ga0496109_0000264 | Ga0496109_0000264_34246_34509 | 87 |
| 129 | 3300048914 | Ga0496111_0444812 | Ga0496111_0444812_98_361 | 87 |
| 130 | 3300053078 | Ga0495612_0007505 | Ga0495612_0007505_4184_4447 | 87 |
| 131 | 3300005329 | Ga0070683_100002781 | Ga0070683_1000027819 | 88 |
| 132 | 3300005329 | Ga0070683_100003984 | Ga0070683_10000398410 | 88 |
| 133 | 3300005354 | Ga0070675_100000028 | Ga0070675_10000002829 | 88 |
| 134 | 3300005436 | Ga0070713_100000085 | Ga0070713_10000008554 | 88 |
| 135 | 3300005535 | Ga0070684_100035324 | Ga0070684_1000353243 | 88 |
| 136 | 3300005535 | Ga0070684_100039519 | Ga0070684_1000395193 | 88 |
| 137 | 3300005543 | Ga0070672_100000567 | Ga0070672_10000056711 | 88 |
| 138 | 3300005577 | Ga0068857_100984701 | Ga0068857_1009847011 | 88 |
| 139 | 3300006846 | Ga0075430_100127711 | Ga0075430_1001277113 | 88 |
| 140 | 3300013297 | Ga0157378_11777498 | Ga0157378_117774981 | 88 |
| 141 | 3300025926 | Ga0207659_10000018 | Ga0207659_10000018166 | 88 |
| 142 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002712 | 88 |
| 143 | 3300025940 | Ga0207691_10000002 | Ga0207691_10000002131 | 88 |
| 144 | 3300025944 | Ga0207661_10000693 | Ga0207661_1000069323 | 88 |
| 145 | 3300025944 | Ga0207661_10000774 | Ga0207661_1000077415 | 88 |
| 146 | 3300050509 | nmdc:mga0qj67_143094_c1 | nmdc:mga0qj67_143094_c1_1657_1923 | 88 |
| 147 | 3300005329 | Ga0070683_100953814 | Ga0070683_1009538141 | 92 |
| 148 | 3300005344 | Ga0070661_100000226 | Ga0070661_10000022613 | 92 |
| 149 | 3300005347 | Ga0070668_100026404 | Ga0070668_1000264044 | 92 |
| 150 | 3300005365 | Ga0070688_100000283 | Ga0070688_10000028330 | 92 |
| 151 | 3300005455 | Ga0070663_100393604 | Ga0070663_1003936042 | 92 |
| 152 | 3300005466 | Ga0070685_10000431 | Ga0070685_100004317 | 92 |
| 153 | 3300005564 | Ga0070664_100068867 | Ga0070664_1000688672 | 92 |
| 154 | 3300009101 | Ga0105247_10023389 | Ga0105247_100233893 | 92 |
| 155 | 3300009148 | Ga0105243_10013530 | Ga0105243_100135304 | 92 |
| 156 | 3300013102 | Ga0157371_10715329 | Ga0157371_107153292 | 92 |
| 157 | 3300013297 | Ga0157378_10102671 | Ga0157378_101026713 | 92 |
| 158 | 3300014968 | Ga0157379_10913363 | Ga0157379_109133632 | 92 |
| 159 | 3300025908 | Ga0207643_10431218 | Ga0207643_104312182 | 92 |
| 160 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009165 | 92 |
| 161 | 3300025935 | Ga0207709_10003185 | Ga0207709_100031858 | 92 |
| 162 | 3300025941 | Ga0207711_10697211 | Ga0207711_106972112 | 92 |
| 163 | 3300025944 | Ga0207661_10857114 | Ga0207661_108571141 | 92 |
| 164 | 3300025945 | Ga0207679_10050968 | Ga0207679_100509683 | 92 |
| 165 | 3300025972 | Ga0207668_10008365 | Ga0207668_100083652 | 92 |
| 166 | 3300026067 | Ga0207678_10192400 | Ga0207678_101924002 | 92 |
| 167 | 3300046459 | Ga0495629_0000264 | Ga0495629_0000264_24659_24937 | 92 |
| 168 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_50776_51054 | 92 |
| 169 | 3300046690 | Ga0495624_0454639 | Ga0495624_0454639_242_520 | 92 |
| 170 | 3300047321 | Ga0495676_0565373 | Ga0495676_0565373_47_325 | 92 |
| 171 | 3300048913 | Ga0496110_0323652 | Ga0496110_0323652_1002_1280 | 92 |
| 172 | 3300048914 | Ga0496111_0052165 | Ga0496111_0052165_614_892 | 92 |
| 173 | 3300048917 | Ga0496114_0320690 | Ga0496114_0320690_759_1037 | 92 |
| 174 | 3300004801 | Ga0058860_10023394 | Ga0058860_100233942 | 93 |
| 175 | 3300005340 | Ga0070689_100437859 | Ga0070689_1004378591 | 93 |
| 176 | 3300005365 | Ga0070688_100001665 | Ga0070688_1000016659 | 93 |
| 177 | 3300005365 | Ga0070688_100093254 | Ga0070688_1000932542 | 93 |
| 178 | 3300005435 | Ga0070714_100717133 | Ga0070714_1007171332 | 93 |
| 179 | 3300005439 | Ga0070711_100163522 | Ga0070711_1001635222 | 93 |
| 180 | 3300005466 | Ga0070685_10000141 | Ga0070685_100001417 | 93 |
| 181 | 3300005466 | Ga0070685_10121971 | Ga0070685_101219713 | 93 |
| 182 | 3300005614 | Ga0068856_100016501 | Ga0068856_1000165013 | 93 |
| 183 | 3300009098 | Ga0105245_10014323 | Ga0105245_100143235 | 93 |
| 184 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020140 | 93 |
| 185 | 3300013297 | Ga0157378_10020160 | Ga0157378_100201605 | 93 |
| 186 | 3300025916 | Ga0207663_10056930 | Ga0207663_100569303 | 93 |
| 187 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007479 | 93 |
| 188 | 3300025929 | Ga0207664_10070614 | Ga0207664_100706141 | 93 |
| 189 | 3300025936 | Ga0207670_10365348 | Ga0207670_103653482 | 93 |
| 190 | 3300026078 | Ga0207702_10005634 | Ga0207702_1000563415 | 93 |
| 191 | 3300044842 | Ga0466957_0001083 | Ga0466957_0001083_4412_4693 | 93 |
| 192 | 3300046511 | Ga0495608_0000060 | Ga0495608_0000060_23320_23625 | 93 |
| 193 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_201596_201901 | 93 |
| 194 | 3300047444 | Ga0495675_0000040 | Ga0495675_0000040_21416_21721 | 93 |
| 195 | 3300048916 | Ga0496113_1230057 | Ga0496113_1230057_25_309 | 93 |
| 196 | 3300053077 | Ga0495601_0477434 | Ga0495601_0477434_278_559 | 93 |
| 197 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_201596_201901 | 93 |
| 198 | 3300053085 | Ga0495619_0000116 | Ga0495619_0000116_48363_48668 | 93 |
| 199 | 3300053085 | Ga0495619_0000131 | Ga0495619_0000131_39488_39781 | 93 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9687 | 8 | 69 |
| 1y7y-assembly1.cif.gz_A | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9674 | 8 | 69 |
| 4yba-assembly1.cif.gz_A | the structure of the c.kpn2i controller protein | 0.9597 | 12 | 63 |
| 2b5a-assembly1.cif.gz_A | c.bcli, control element of the bcli restriction-modification system | 0.9523 | 8 | 75 |
| 6rmq-assembly2.cif.gz_B-3 | crystal structure of a selenomethionine-substituted a70m i84m mutant of the essential repressor ddro from radiation resistant-deinococcus bacteria (deinococcus deserti) | 0.9517 | 11 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9687 | 8 | 69 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9674 | 8 | 69 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9598 | 8 | 74 | 1.10.260.40 |
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9597 | 12 | 63 | 1.10.260.40 |
| 2b5aC00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9551 | 8 | 74 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0FVJ3-F1-model_v4 | XRE family transcriptional regulator | 0.9924 | 8 | 80 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A495WHU3-F1-model_v4 | Helix-turn-helix protein | 0.9862 | 8 | 81 |
GO:0003677
|
| AF-A0A5B8D6E1-F1-model_v4 | deleted | 0.9833 | 8 | 75 |
|
| AF-A0A679HWV2-F1-model_v4 | Uncharacterized protein | 0.9817 | 8 | 84 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-G2JB94-F1-model_v4 | Putative transcriptional regulator, XRE family | 0.9803 | 8 | 83 |
GO:0003677
GO:0003700 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar