F304563

General Info

Members Datasets Scaffolds Average Seq Length
198 151 396 135

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10187485|Ga0207678_101874853
Length 164
Sequence MPKKRSGGGLSPTQQAAKFLGVSVLALVAKGSVESFDELPANLKTPPLSSDYTMYLDERDGRQVIVCQVGKTTLLYDARAIDDLHAMLRQRGDWVDLGSADEQKPAKDGTVEAWGRSEDNPVGGWYGLKKGLRGRFANYVPPVLEQLGGVEVEHKARGNRMRAA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 10.1
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10187485 3300026067 Bacteria 1767
2 Ga0070658_10005789 3300005327 Bacteria 10024
3 Ga0070676_10020485 3300005328 Bacteria 3693
4 Ga0070683_100084395 3300005329 Bacteria 2976
5 Ga0070682_100436878 3300005337 Bacteria 999
6 Ga0068868_100009170 3300005338 Bacteria 7107
7 Ga0068868_100158392 3300005338 Bacteria 1868
8 Ga0070660_100356906 3300005339 Bacteria 1204
9 Ga0070668_100719240 3300005347 Bacteria 882
10 Ga0070673_100015099 3300005364 Bacteria 5409
11 Ga0070688_100023352 3300005365 Bacteria 3636
12 Ga0070667_100703758 3300005367 Bacteria 935
13 Ga0070705_100404527 3300005440 Bacteria 1012
14 Ga0070700_100158886 3300005441 Bacteria 1554
15 Ga0070694_100246279 3300005444 Bacteria 1350
16 Ga0070708_100873085 3300005445 Bacteria 845
17 Ga0070678_100000080 3300005456 Bacteria 35906
18 Ga0070678_101244113 3300005456 Bacteria 691
19 Ga0070662_101034457 3300005457 Bacteria 704
20 Ga0070681_10313884 3300005458 Bacteria 1477
21 Ga0068867_100046605 3300005459 Unclassified 3184
22 Ga0068867_100173217 3300005459 Bacteria 1711
23 Ga0070685_10000910 3300005466 Bacteria 15899
24 Ga0070706_100016332 3300005467 Bacteria 6858
25 Ga0070707_101304879 3300005468 Bacteria 692
26 Ga0070679_101060109 3300005530 Unclassified 755
27 Ga0070697_100048508 3300005536 Bacteria 3443
28 Ga0070686_100298466 3300005544 Bacteria 1194
29 Ga0070695_100073410 3300005545 Bacteria 2245
30 Ga0070696_100005245 3300005546 Bacteria 8660
31 Ga0070665_100070875 3300005548 Bacteria 3492
32 Ga0070665_100574673 3300005548 Bacteria 1140
33 Ga0070665_101061675 3300005548 Bacteria 822
34 Ga0070704_100201021 3300005549 Bacteria 1608
35 Ga0068856_100000351 3300005614 Bacteria 50364
36 Ga0068864_100650962 3300005618 Bacteria 1026
37 Ga0068861_100749979 3300005719 Bacteria 912
38 Ga0068863_100071772 3300005841 Bacteria 3275
39 Ga0068858_100796477 3300005842 Bacteria 922
40 Ga0075364_10801591 3300006051 Bacteria 642
41 Ga0070712_100510217 3300006175 Bacteria 1009
42 Ga0075367_10022621 3300006178 Bacteria 3528
43 Ga0068871_100014136 3300006358 Bacteria 5939
44 Ga0068865_100485791 3300006881 Bacteria 1027
45 Ga0068865_100583576 3300006881 Bacteria 943
46 Ga0075436_100001671 3300006914 Bacteria 15159
47 Ga0105240_10245228 3300009093 Bacteria 2075
48 Ga0105245_10053458 3300009098 Bacteria 3625
49 Ga0114129_10308630 3300009147 Unclassified 2107
50 Ga0105243_10173489 3300009148 Bacteria 1869
51 Ga0105243_11890517 3300009148 Bacteria 629
52 Ga0105241_10073085 3300009174 Bacteria 2667
53 Ga0105242_10221934 3300009176 Bacteria 1689
54 Ga0105242_10253084 3300009176 Unclassified 1588
55 Ga0105242_10420148 3300009176 Bacteria 1253
56 Ga0105242_11173310 3300009176 Bacteria 786
57 Ga0105248_10730021 3300009177 Bacteria 1118
58 Ga0105237_10004653 3300009545 Bacteria 15804
59 Ga0105238_12454223 3300009551 Bacteria 557
60 Ga0105249_10278579 3300009553 Bacteria 1669
61 Ga0105249_10850435 3300009553 Bacteria 978
62 Ga0105249_11105024 3300009553 Bacteria 863
63 Ga0105249_13324153 3300009553 Unclassified 517
64 Ga0105239_10006042 3300010375 Bacteria 14093
65 Ga0105239_10014026 3300010375 Bacteria 8896
66 Ga0105239_11640822 3300010375 Bacteria 744
67 Ga0157371_10983142 3300013102 Bacteria 643
68 Ga0157374_10104571 3300013296 Bacteria 2718
69 Ga0157374_11135051 3300013296 Bacteria 802
70 Ga0157378_10024761 3300013297 Bacteria 5285
71 Ga0163162_10941430 3300013306 Unclassified 975
72 Ga0163162_11445720 3300013306 Unclassified 783
73 Ga0157372_11287259 3300013307 Bacteria 844
74 Ga0157372_13292312 3300013307 Bacteria 515
75 Ga0157375_10874747 3300013308 Bacteria 1044
76 Ga0157380_10169543 3300014326 Bacteria 1906
77 Ga0157379_10374009 3300014968 Bacteria 1307
78 Ga0157376_10166760 3300014969 Bacteria 2002
79 Ga0163161_10208631 3300017792 Bacteria 1508
80 Ga0213875_10001347 3300021388 Bacteria 16186
81 Ga0207680_10591219 3300025903 Bacteria 794
82 Ga0207645_10046762 3300025907 Bacteria 2764
83 Ga0207705_10021595 3300025909 Bacteria 4595
84 Ga0207654_10191562 3300025911 Bacteria 1340
85 Ga0207707_10185907 3300025912 Bacteria 1813
86 Ga0207671_10000883 3300025914 Bacteria 37968
87 Ga0207657_10235139 3300025919 Bacteria 1465
88 Ga0207652_10570636 3300025921 Unclassified 1016
89 Ga0207694_10653408 3300025924 Unclassified 886
90 Ga0207659_11385432 3300025926 Unclassified 603
91 Ga0207687_10236416 3300025927 Bacteria 1446
92 Ga0207690_10002564 3300025932 Bacteria 10981
93 Ga0207706_10702872 3300025933 Bacteria 864
94 Ga0207686_10505011 3300025934 Unclassified 939
95 Ga0207686_10562254 3300025934 Bacteria 893
96 Ga0207709_10173698 3300025935 Bacteria 1515
97 Ga0207709_10247622 3300025935 Bacteria 1300
98 Ga0207704_10408526 3300025938 Bacteria 1073
99 Ga0207711_11491950 3300025941 Bacteria 619
100 Ga0207661_10111948 3300025944 Bacteria 2310
101 Ga0207651_10003117 3300025960 Bacteria 8064
102 Ga0207712_10107603 3300025961 Bacteria 2085
103 Ga0207668_10353866 3300025972 Unclassified 1229
104 Ga0207640_10780330 3300025981 Bacteria 826
105 Ga0207658_10340305 3300025986 Bacteria 1304
106 Ga0207677_10006422 3300026023 Bacteria 6449
107 Ga0207677_10768317 3300026023 Bacteria 860
108 Ga0207708_10249287 3300026075 Bacteria 1430
109 Ga0207702_10000446 3300026078 Bacteria 46754
110 Ga0207702_10677871 3300026078 Bacteria 1015
111 Ga0207641_10070757 3300026088 Bacteria 2998
112 Ga0207648_10028493 3300026089 Bacteria 4950
113 Ga0207648_10050662 3300026089 Bacteria 3630
114 Ga0207648_10433067 3300026089 Bacteria 1195
115 Ga0207675_100118850 3300026118 Bacteria 2500
116 Ga0207683_10031927 3300026121 Bacteria 4573
117 Ga0207428_10178991 3300027907 Bacteria 1603
118 Ga0268266_10002264 3300028379 Bacteria 20937
119 Ga0268266_10875553 3300028379 Bacteria 868
120 Ga0268266_10955708 3300028379 Bacteria 829
121 Ga0268264_10735001 3300028381 Bacteria 982
122 Ga0265338_10010024 3300028800 Bacteria 11197
123 Ga0265338_10222081 3300028800 Bacteria 1411
124 Ga0265338_10928622 3300028800 Bacteria 591
125 Ga0265340_10039177 3300031247 Bacteria 2340
126 Ga0265327_10001049 3300031251 Bacteria 38684
127 Ga0307405_10740691 3300031731 Unclassified 818
128 Ga0307409_100147513 3300031995 Bacteria 2037
129 Ga0307416_101745362 3300032002 Bacteria 727
130 Ga0373955_0125178 3300035172 Bacteria 1497
131 Ga0373924_0124610 3300035410 Bacteria 1119
132 Ga0395900_0847122 3300037418 Bacteria 840
133 Ga0436364_0276642 3300037853 Bacteria 9520
134 Ga0436365_0932354 3300039437 Bacteria 558
135 Ga0436363_1402970 3300039450 Bacteria 1385
136 Ga0451787_679775 3300041441 Bacteria 723
137 Ga0451793_0282956 3300041452 Bacteria 672
138 Ga0451793_1260877 3300041452 Bacteria 584
139 Ga0451853_2189534 3300041512 Bacteria 1049
140 Ga0495603_0011923 3300046455 Bacteria 5260
141 Ga0495603_0252764 3300046455 Bacteria 1015
142 Ga0495641_0109316 3300046461 Bacteria 1234
143 Ga0495651_0027302 3300046462 Bacteria 4447
144 Ga0495651_0353224 3300046462 Bacteria 971
145 Ga0495653_0566590 3300046463 Bacteria 701
146 Ga0495653_0840676 3300046463 Bacteria 550
147 Ga0495662_0136312 3300046476 Bacteria 1207
148 Ga0495664_0325596 3300046477 Bacteria 927
149 Ga0495594_0020088 3300046499 Bacteria 3557
150 Ga0495608_0073534 3300046511 Bacteria 2229
151 Ga0495608_0281083 3300046511 Bacteria 1033
152 Ga0495608_0607040 3300046511 Bacteria 656
153 Ga0495618_0668580 3300046514 Bacteria 613
154 Ga0495620_0149990 3300046515 Bacteria 909
155 Ga0495628_0217153 3300046516 Bacteria 1437
156 Ga0495628_1124482 3300046516 Bacteria 536
157 Ga0495666_0219203 3300046526 Bacteria 872
158 Ga0495652_0975628 3300046529 Bacteria 555
159 Ga0495634_0036719 3300046642 Bacteria 3350
160 Ga0495588_0007892 3300046674 Bacteria 4863
161 Ga0495657_0236116 3300046675 Bacteria 1104
162 Ga0495657_0345078 3300046675 Bacteria 882
163 Ga0495657_0554189 3300046675 Bacteria 667
164 Ga0495599_0016461 3300046678 Bacteria 4589
165 Ga0495623_0461665 3300046679 Bacteria 675
166 Ga0495646_0094806 3300046680 Bacteria 1718
167 Ga0495658_0533312 3300046683 Bacteria 751
168 Ga0495604_0377924 3300047317 Bacteria 936
169 Ga0495674_0370833 3300047319 Bacteria 1159
170 Ga0495684_0812926 3300047471 Bacteria 610
171 Ga0495593_0462534 3300047673 Bacteria 635
172 Ga0496100_0022257 3300048903 Bacteria 3834
173 Ga0496100_0812760 3300048903 Unclassified 733
174 Ga0496101_0098096 3300048904 Bacteria 2189
175 Ga0496101_0379554 3300048904 Unclassified 1112
176 Ga0496102_0015234 3300048905 Bacteria 6694
177 Ga0496102_0350495 3300048905 Bacteria 1390
178 Ga0496105_0310803 3300048908 Bacteria 1265
179 Ga0496105_0376269 3300048908 Unclassified 1131
180 Ga0496106_0253771 3300048909 Bacteria 1406
181 Ga0496107_0034312 3300048910 Bacteria 3634
182 Ga0496109_0037864 3300048912 Bacteria 4359
183 Ga0496114_0047985 3300048917 Bacteria 3551
184 Ga0496114_0216469 3300048917 Bacteria 1681
185 Ga0496114_0314574 3300048917 Bacteria 1383
186 Ga0496115_0176620 3300048918 Unclassified 1766
187 Ga0496115_0374990 3300048918 Bacteria 1158
188 Ga0496115_0722912 3300048918 Unclassified 781
189 Ga0501073_0630734 3300049589 Bacteria 740
190 nmdc:mga06z11_12142_c1 3300050494 Bacteria 3737
191 nmdc:mga05p37_493222_c1 3300050507 Bacteria 1408
192 nmdc:mga08x19_3694_c1 3300050514 Bacteria 9111
193 Ga0495601_0207606 3300053077 Bacteria 1280
194 Ga0495619_0027069 3300053085 Bacteria 3693
195 Ga0495619_0450832 3300053085 Bacteria 887
196 Ga0500568_0257083 3300053139 Bacteria 636
197 Ga0500616_0000273 3300053153 Bacteria 77024
198 Ga0500616_0001009 3300053153 Bacteria 30168
199 Ga0207678_10187485
200 Ga0070658_10005789
201 Ga0070676_10020485
202 Ga0070683_100084395
203 Ga0070682_100436878
204 Ga0068868_100009170
205 Ga0068868_100158392
206 Ga0070660_100356906
207 Ga0070668_100719240
208 Ga0070673_100015099
209 Ga0070688_100023352
210 Ga0070667_100703758
211 Ga0070705_100404527
212 Ga0070700_100158886
213 Ga0070694_100246279
214 Ga0070708_100873085
215 Ga0070678_100000080
216 Ga0070678_101244113
217 Ga0070662_101034457
218 Ga0070681_10313884
219 Ga0068867_100046605
220 Ga0068867_100173217
221 Ga0070685_10000910
222 Ga0070706_100016332
223 Ga0070707_101304879
224 Ga0070679_101060109
225 Ga0070697_100048508
226 Ga0070686_100298466
227 Ga0070695_100073410
228 Ga0070696_100005245
229 Ga0070665_100070875
230 Ga0070665_100574673
231 Ga0070665_101061675
232 Ga0070704_100201021
233 Ga0068856_100000351
234 Ga0068864_100650962
235 Ga0068861_100749979
236 Ga0068863_100071772
237 Ga0068858_100796477
238 Ga0075364_10801591
239 Ga0070712_100510217
240 Ga0075367_10022621
241 Ga0068871_100014136
242 Ga0068865_100485791
243 Ga0068865_100583576
244 Ga0075436_100001671
245 Ga0105240_10245228
246 Ga0105245_10053458
247 Ga0114129_10308630
248 Ga0105243_10173489
249 Ga0105243_11890517
250 Ga0105241_10073085
251 Ga0105242_10221934
252 Ga0105242_10253084
253 Ga0105242_10420148
254 Ga0105242_11173310
255 Ga0105248_10730021
256 Ga0105237_10004653
257 Ga0105238_12454223
258 Ga0105249_10278579
259 Ga0105249_10850435
260 Ga0105249_11105024
261 Ga0105249_13324153
262 Ga0105239_10006042
263 Ga0105239_10014026
264 Ga0105239_11640822
265 Ga0157371_10983142
266 Ga0157374_10104571
267 Ga0157374_11135051
268 Ga0157378_10024761
269 Ga0163162_10941430
270 Ga0163162_11445720
271 Ga0157372_11287259
272 Ga0157372_13292312
273 Ga0157375_10874747
274 Ga0157380_10169543
275 Ga0157379_10374009
276 Ga0157376_10166760
277 Ga0163161_10208631
278 Ga0213875_10001347
279 Ga0207680_10591219
280 Ga0207645_10046762
281 Ga0207705_10021595
282 Ga0207654_10191562
283 Ga0207707_10185907
284 Ga0207671_10000883
285 Ga0207657_10235139
286 Ga0207652_10570636
287 Ga0207694_10653408
288 Ga0207659_11385432
289 Ga0207687_10236416
290 Ga0207690_10002564
291 Ga0207706_10702872
292 Ga0207686_10505011
293 Ga0207686_10562254
294 Ga0207709_10173698
295 Ga0207709_10247622
296 Ga0207704_10408526
297 Ga0207711_11491950
298 Ga0207661_10111948
299 Ga0207651_10003117
300 Ga0207712_10107603
301 Ga0207668_10353866
302 Ga0207640_10780330
303 Ga0207658_10340305
304 Ga0207677_10006422
305 Ga0207677_10768317
306 Ga0207708_10249287
307 Ga0207702_10000446
308 Ga0207702_10677871
309 Ga0207641_10070757
310 Ga0207648_10028493
311 Ga0207648_10050662
312 Ga0207648_10433067
313 Ga0207675_100118850
314 Ga0207683_10031927
315 Ga0207428_10178991
316 Ga0268266_10002264
317 Ga0268266_10875553
318 Ga0268266_10955708
319 Ga0268264_10735001
320 Ga0265338_10010024
321 Ga0265338_10222081
322 Ga0265338_10928622
323 Ga0265340_10039177
324 Ga0265327_10001049
325 Ga0307405_10740691
326 Ga0307409_100147513
327 Ga0307416_101745362
328 Ga0373955_0125178
329 Ga0373924_0124610
330 Ga0395900_0847122
331 Ga0436364_0276642
332 Ga0436365_0932354
333 Ga0436363_1402970
334 Ga0451787_679775
335 Ga0451793_0282956
336 Ga0451793_1260877
337 Ga0451853_2189534
338 Ga0495603_0011923
339 Ga0495603_0252764
340 Ga0495641_0109316
341 Ga0495651_0027302
342 Ga0495651_0353224
343 Ga0495653_0566590
344 Ga0495653_0840676
345 Ga0495662_0136312
346 Ga0495664_0325596
347 Ga0495594_0020088
348 Ga0495608_0073534
349 Ga0495608_0281083
350 Ga0495608_0607040
351 Ga0495618_0668580
352 Ga0495620_0149990
353 Ga0495628_0217153
354 Ga0495628_1124482
355 Ga0495666_0219203
356 Ga0495652_0975628
357 Ga0495634_0036719
358 Ga0495588_0007892
359 Ga0495657_0236116
360 Ga0495657_0345078
361 Ga0495657_0554189
362 Ga0495599_0016461
363 Ga0495623_0461665
364 Ga0495646_0094806
365 Ga0495658_0533312
366 Ga0495604_0377924
367 Ga0495674_0370833
368 Ga0495684_0812926
369 Ga0495593_0462534
370 Ga0496100_0022257
371 Ga0496100_0812760
372 Ga0496101_0098096
373 Ga0496101_0379554
374 Ga0496102_0015234
375 Ga0496102_0350495
376 Ga0496105_0310803
377 Ga0496105_0376269
378 Ga0496106_0253771
379 Ga0496107_0034312
380 Ga0496109_0037864
381 Ga0496114_0047985
382 Ga0496114_0216469
383 Ga0496114_0314574
384 Ga0496115_0176620
385 Ga0496115_0374990
386 Ga0496115_0722912
387 Ga0501073_0630734
388 nmdc:mga06z11_12142_c1
389 nmdc:mga05p37_493222_c1
390 nmdc:mga08x19_3694_c1
391 Ga0495601_0207606
392 Ga0495619_0027069
393 Ga0495619_0450832
394 Ga0500568_0257083
395 Ga0500616_0000273
396 Ga0500616_0001009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21619

DUF6855

Family of unknown function (DUF6855)

33

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pbp-assembly3.cif.gz_G structure of the yeast heterotrimeric nup82-nup159-nup116 nucleoporin complex 0.7414 21 46
3pbp-assembly2.cif.gz_D structure of the yeast heterotrimeric nup82-nup159-nup116 nucleoporin complex 0.7411 21 46
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.6909 23 46
8u11-assembly1.cif.gz_6 in situ cryo-em structure of bacteriophage p22 gp1:gp5:gp4: gp10: gp9 n-term complex in conformation 2 at 3.1a resolution 0.659 23 47
7sg7-assembly1.cif.gz_X in situ cryo-em structure of bacteriophage sf6 gp8:gp14n complex at 2.8 a resolution 0.6533 23 47
ID Description Score Start End Superfamily
af_Q9SUP3_137_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7528 50 133 1.10.10.10
af_Q9V4E7_58_597_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7516 21 44 1.20.1740.10
af_A0A0R4IP82_24_183_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7372 31 49 2.30.29.30
af_Q54IU7_6_294_3.30.2140.20 Alpha Beta;2-Layer Sandwich;Arylamine N-acetyltransferase fold; 0.7254 20 46 3.30.2140.20
af_Q9SUP3_137_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7189 50 133 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X9KHG0-F1-model_v4 DUF6855 domain-containing protein 0.996 33 133
AF-A0A1V5JG82-F1-model_v4 deleted 0.9957 13 133
AF-A0A536HPS8-F1-model_v4 DUF6855 domain-containing protein 0.9815 4 133
AF-A0A085WIA7-F1-model_v4 DUF6855 domain-containing protein 0.9809 4 133
AF-A0A1V5JG82-F1-model_v4 deleted 0.9796 13 133

Map