F303654

General Info

Members Datasets Scaffolds Average Seq Length
197 145 394 401

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000789|Ga0500555_000789_6332_7681
Length 449
Sequence VRLQRFRAEWVLPITSPPLRDGWIDVQDGEVIALGGEPATGPGGGAPPALGAVTGVSARGRMEPRSSMHAGAATPASAPAVAAGFSTLVEEIDLGRVAVMPGLVNAHTHIELSWMWGRVPPNPSFVDWVSQLMALRAAAGGDDRSKMIEAIAGAEEAGTAAIGDISNTLTSVDAIARSRLHAVVFRELLGFRSPDPAGIVHRALAEMDAVVVPPDARIRLTLAPHAPYSVSPALFQEIAKASTGQGALSSVHLGESPEEVRFLKEGAGPFRAFLERVGAWTPAWAVPGCGPAEYLRRLDVLSPRLLVVHGVQLMDEELADLAGRGATLVTCPRSNVWVGAGDPPIERFYASGLRIAIGTDSLASATDLNLFSEVAAMHALAPALAPARLLASATRVGAEALGFGRLGFIGPGARARLIAIDLPEHVRDVETYLCEGVDPGQIDWLPVED

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
92 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
93 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
94 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
108 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 0
Rhizoplane 1.52
Rhizosphere 89.85
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_000789 3300053103 Bacteria 11496
2 Ga0070676_10025743 3300005328 Bacteria 3328
3 Ga0070676_10127602 3300005328 Bacteria 1605
4 Ga0070683_100080911 3300005329 Bacteria 3040
5 Ga0070670_100121015 3300005331 Unclassified 2258
6 Ga0068869_100023698 3300005334 Bacteria 4245
7 Ga0070689_100277308 3300005340 Unclassified 1390
8 Ga0070691_10000205 3300005341 Bacteria 19816
9 Ga0070668_100165871 3300005347 Bacteria 1795
10 Ga0070669_100037570 3300005353 Bacteria 3513
11 Ga0070675_100000079 3300005354 Bacteria 56265
12 Ga0070675_100084457 3300005354 Bacteria 2652
13 Ga0070671_100037811 3300005355 Bacteria 4005
14 Ga0070671_100208229 3300005355 Bacteria 1658
15 Ga0070674_100054962 3300005356 Bacteria 2755
16 Ga0070673_100109885 3300005364 Bacteria 2285
17 Ga0070673_100159258 3300005364 Bacteria 1918
18 Ga0070673_100183248 3300005364 Bacteria 1793
19 Ga0070688_100143664 3300005365 Bacteria 1624
20 Ga0070709_10004714 3300005434 Bacteria 7368
21 Ga0070713_100053691 3300005436 Bacteria 3340
22 Ga0070705_100016983 3300005440 Bacteria 3792
23 Ga0070700_100002568 3300005441 Bacteria 9280
24 Ga0070700_100017254 3300005441 Bacteria 4124
25 Ga0070694_100010273 3300005444 Bacteria 5768
26 Ga0070678_100166351 3300005456 Bacteria 1792
27 Ga0070662_100071728 3300005457 Bacteria 2555
28 Ga0070662_100105977 3300005457 Bacteria 2135
29 Ga0070681_10359116 3300005458 Bacteria 1367
30 Ga0068867_100021865 3300005459 Bacteria 4567
31 Ga0070707_100093211 3300005468 Bacteria 2916
32 Ga0070699_100139628 3300005518 Bacteria 2139
33 Ga0070679_100284979 3300005530 Bacteria 1604
34 Ga0070695_100061712 3300005545 Bacteria 2432
35 Ga0070696_100024142 3300005546 Bacteria 4132
36 Ga0070704_100030556 3300005549 Bacteria 3611
37 Ga0068854_100035734 3300005578 Bacteria 3480
38 Ga0068854_100258615 3300005578 Unclassified 1393
39 Ga0070702_100006773 3300005615 Bacteria 5447
40 Ga0068866_10099705 3300005718 Bacteria 1600
41 Ga0068861_100004810 3300005719 Bacteria 9079
42 Ga0068863_100009990 3300005841 Bacteria 9240
43 Ga0068860_100014536 3300005843 Bacteria 7702
44 Ga0068862_100133199 3300005844 Bacteria 2200
45 Ga0068862_100288172 3300005844 Bacteria 1507
46 Ga0081455_10072702 3300005937 Bacteria 2846
47 Ga0075368_10002646 3300006042 Bacteria 5889
48 Ga0075364_10029766 3300006051 Bacteria 3502
49 Ga0075432_10012783 3300006058 Bacteria 2852
50 Ga0097621_100041097 3300006237 Bacteria 3720
51 Ga0097621_100093417 3300006237 Bacteria 2521
52 Ga0075370_10016777 3300006353 Bacteria 3945
53 Ga0068871_100015641 3300006358 Bacteria 5686
54 Ga0068871_100098793 3300006358 Bacteria 2442
55 Ga0075428_100012598 3300006844 Bacteria 9402
56 Ga0075433_10050721 3300006852 Bacteria 3613
57 Ga0075434_100001049 3300006871 Bacteria 22542
58 Ga0075434_100006547 3300006871 Bacteria 10682
59 Ga0075434_100315176 3300006871 Unclassified 1585
60 Ga0075436_100007129 3300006914 Bacteria 7650
61 Ga0075436_100008464 3300006914 Bacteria 7033
62 Ga0075435_100000213 3300007076 Bacteria 35518
63 Ga0105240_10511068 3300009093 Bacteria 1334
64 Ga0111539_10006888 3300009094 Bacteria 14599
65 Ga0111539_10036302 3300009094 Bacteria 5961
66 Ga0111539_10044979 3300009094 Bacteria 5286
67 Ga0111539_10098985 3300009094 Bacteria 3425
68 Ga0105245_10411995 3300009098 Bacteria 1353
69 Ga0105247_10022240 3300009101 Bacteria 3818
70 Ga0114129_10002137 3300009147 Bacteria 27257
71 Ga0114129_10038255 3300009147 Bacteria 6769
72 Ga0105242_10084038 3300009176 Bacteria 2667
73 Ga0105248_10042926 3300009177 Bacteria 5070
74 Ga0105248_10080302 3300009177 Bacteria 3665
75 Ga0105248_10140114 3300009177 Bacteria 2728
76 Ga0105248_10142313 3300009177 Bacteria 2705
77 Ga0105248_10239148 3300009177 Bacteria 2044
78 Ga0105237_10447570 3300009545 Bacteria 1297
79 Ga0163162_10039132 3300013306 Bacteria 4737
80 Ga0157375_10148752 3300013308 Bacteria 2475
81 Ga0163163_10047257 3300014325 Bacteria 4230
82 Ga0157380_10016184 3300014326 Bacteria 5494
83 Ga0157380_10042974 3300014326 Bacteria 3535
84 Ga0157379_10005030 3300014968 Bacteria 11340
85 Ga0163161_10005036 3300017792 Bacteria 9191
86 Ga0213876_10058555 3300021384 Bacteria 2034
87 Ga0207710_10030904 3300025900 Unclassified 2338
88 Ga0207645_10039788 3300025907 Bacteria 3012
89 Ga0207645_10043475 3300025907 Bacteria 2876
90 Ga0207707_10285522 3300025912 Bacteria 1428
91 Ga0207652_10315828 3300025921 Bacteria 1410
92 Ga0207646_10074704 3300025922 Bacteria 3028
93 Ga0207681_10062151 3300025923 Bacteria 2570
94 Ga0207681_10064446 3300025923 Bacteria 2530
95 Ga0207659_10004827 3300025926 Bacteria 8171
96 Ga0207700_10006706 3300025928 Bacteria 6987
97 Ga0207706_10133361 3300025933 Unclassified 2185
98 Ga0207665_10074908 3300025939 Bacteria 2317
99 Ga0207691_10065847 3300025940 Bacteria 3278
100 Ga0207711_10054049 3300025941 Bacteria 3444
101 Ga0207711_10071816 3300025941 Bacteria 3005
102 Ga0207711_10099909 3300025941 Bacteria 2566
103 Ga0207689_10039600 3300025942 Bacteria 3901
104 Ga0207679_10085715 3300025945 Bacteria 2421
105 Ga0207651_10054222 3300025960 Bacteria 2746
106 Ga0207668_10044066 3300025972 Bacteria 3033
107 Ga0207668_10063669 3300025972 Bacteria 2603
108 Ga0207668_10079360 3300025972 Bacteria 2374
109 Ga0207658_10040609 3300025986 Bacteria 3365
110 Ga0207708_10002632 3300026075 Bacteria 13204
111 Ga0207708_10023061 3300026075 Bacteria 4702
112 Ga0207708_10040677 3300026075 Bacteria 3544
113 Ga0207641_10014455 3300026088 Bacteria 6466
114 Ga0207648_10003352 3300026089 Bacteria 16838
115 Ga0207648_10041336 3300026089 Bacteria 4049
116 Ga0207675_100002221 3300026118 Bacteria 19290
117 Ga0207675_100035787 3300026118 Bacteria 4631
118 Ga0207683_10253757 3300026121 Bacteria 1605
119 Ga0209813_10001496 3300027866 Bacteria 5255
120 Ga0207428_10001147 3300027907 Bacteria 28680
121 Ga0207428_10014166 3300027907 Bacteria 6941
122 Ga0207428_10172856 3300027907 Bacteria 1635
123 Ga0268265_10004027 3300028380 Bacteria 10350
124 Ga0265314_10145508 3300031711 Bacteria 1460
125 Ga0307409_100007833 3300031995 Bacteria 6429
126 Ga0373930_0013834 3300034816 Bacteria 1493
127 Ga0373958_0000875 3300034819 Bacteria 3876
128 Ga0373938_0008020 3300034957 Bacteria 1876
129 Ga0373928_0005082 3300035084 Bacteria 2508
130 Ga0373940_0001778 3300035088 Bacteria 4011
131 Ga0373951_0000250 3300035091 Bacteria 17855
132 Ga0373939_0000330 3300035114 Bacteria 12172
133 Ga0373960_0000553 3300035121 Bacteria 7559
134 Ga0373946_0007807 3300035171 Bacteria 3928
135 Ga0373955_0024945 3300035172 Bacteria 3064
136 Ga0373942_0000461 3300035207 Bacteria 11493
137 Ga0373961_0001789 3300035241 Bacteria 5922
138 Ga0373962_0002576 3300035242 Bacteria 4306
139 Ga0373935_0170789 3300035692 Bacteria 1487
140 Ga0373947_0148710 3300035725 Bacteria 1507
141 Ga0436365_1516765 3300039437 Bacteria 2870
142 Ga0450895_004061 3300042132 Bacteria 1146
143 Ga0450916_002810 3300042530 Bacteria 1876
144 Ga0451576_0003199 3300045051 Bacteria 22846
145 Ga0495592_0053608 3300046454 Bacteria 2991
146 Ga0495592_0223146 3300046454 Unclassified 1259
147 Ga0495653_0048042 3300046463 Bacteria 3297
148 Ga0495628_0067150 3300046516 Bacteria 2801
149 Ga0495630_0004210 3300046517 Bacteria 10077
150 Ga0495667_0118351 3300046559 Bacteria 1711
151 Ga0495613_0005107 3300046689 Bacteria 9843
152 Ga0495613_0048660 3300046689 Bacteria 3131
153 Ga0495604_0096974 3300047317 Bacteria 2175
154 Ga0495604_0127629 3300047317 Bacteria 1832
155 Ga0495674_0022038 3300047319 Bacteria 5879
156 Ga0495684_0001265 3300047471 Bacteria 20345
157 Ga0495684_0112446 3300047471 Bacteria 2054
158 Ga0496109_0265203 3300048912 Unclassified 1618
159 Ga0496114_0002165 3300048917 Bacteria 14953
160 Ga0496115_0049192 3300048918 Bacteria 3374
161 Ga0501071_0092034 3300049587 Bacteria 2228
162 Ga0501072_0105567 3300049588 Bacteria 2240
163 Ga0501073_0008361 3300049589 Bacteria 7675
164 Ga0501080_0111480 3300049742 Bacteria 2536
165 Ga0501045_0048673 3300049824 Bacteria 3090
166 nmdc:mga00v17_169364_c1 3300050491 Unclassified 1408
167 nmdc:mga00v17_80271_c1 3300050491 Bacteria 2036
168 nmdc:mga0k408_36239_c1 3300050493 Bacteria 2831
169 nmdc:mga06z11_95247_c1 3300050494 Unclassified 1624
170 nmdc:mga04h51_4035_c1 3300050495 Bacteria 3619
171 nmdc:mga05p37_12306_c1 3300050507 Bacteria 10218
172 nmdc:mga05p37_28047_c1 3300050507 Bacteria 6861
173 nmdc:mga08y16_168848_c1 3300050511 Bacteria 2273
174 nmdc:mga08y16_4298_c1 3300050511 Bacteria 14875
175 nmdc:mga08y16_633870_c1 3300050511 Bacteria 1075
176 nmdc:mga08y16_73474_c1 3300050511 Bacteria 3564
177 nmdc:mga08y16_9169_c1 3300050511 Bacteria 10387
178 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
179 nmdc:mga0n895_293257_c1 3300050512 Unclassified 1649
180 nmdc:mga0n895_5460_c1 3300050512 Bacteria 10633
181 nmdc:mga0rr50_1088_c1 3300050513 Bacteria 14763
182 nmdc:mga0rr50_15225_c1 3300050513 Bacteria 5072
183 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
184 nmdc:mga08x19_24019_c1 3300050514 Bacteria 3785
185 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
186 nmdc:mga08x19_61801_c1 3300050514 Bacteria 2428
187 nmdc:mga0a205_67600_c1 3300050515 Bacteria 3452
188 Ga0495601_0003629 3300053077 Bacteria 8872
189 Ga0495601_0005785 3300053077 Bacteria 7211
190 Ga0495612_0055675 3300053078 Unclassified 1631
191 Ga0495595_0064369 3300053084 Bacteria 1723
192 Ga0495619_0001690 3300053085 Bacteria 14594
193 Ga0500641_0003189 3300053096 Bacteria 5797
194 Ga0500568_0009745 3300053139 Bacteria 4544
195 Ga0500616_0000358 3300053153 Bacteria 64893
196 Ga0500645_001085 3300053730 Bacteria 14965
197 Ga0500599_004683 3300053736 Unclassified 1698
198 Ga0500555_000789
199 Ga0070676_10025743
200 Ga0070676_10127602
201 Ga0070683_100080911
202 Ga0070670_100121015
203 Ga0068869_100023698
204 Ga0070689_100277308
205 Ga0070691_10000205
206 Ga0070668_100165871
207 Ga0070669_100037570
208 Ga0070675_100000079
209 Ga0070675_100084457
210 Ga0070671_100037811
211 Ga0070671_100208229
212 Ga0070674_100054962
213 Ga0070673_100109885
214 Ga0070673_100159258
215 Ga0070673_100183248
216 Ga0070688_100143664
217 Ga0070709_10004714
218 Ga0070713_100053691
219 Ga0070705_100016983
220 Ga0070700_100002568
221 Ga0070700_100017254
222 Ga0070694_100010273
223 Ga0070678_100166351
224 Ga0070662_100071728
225 Ga0070662_100105977
226 Ga0070681_10359116
227 Ga0068867_100021865
228 Ga0070707_100093211
229 Ga0070699_100139628
230 Ga0070679_100284979
231 Ga0070695_100061712
232 Ga0070696_100024142
233 Ga0070704_100030556
234 Ga0068854_100035734
235 Ga0068854_100258615
236 Ga0070702_100006773
237 Ga0068866_10099705
238 Ga0068861_100004810
239 Ga0068863_100009990
240 Ga0068860_100014536
241 Ga0068862_100133199
242 Ga0068862_100288172
243 Ga0081455_10072702
244 Ga0075368_10002646
245 Ga0075364_10029766
246 Ga0075432_10012783
247 Ga0097621_100041097
248 Ga0097621_100093417
249 Ga0075370_10016777
250 Ga0068871_100015641
251 Ga0068871_100098793
252 Ga0075428_100012598
253 Ga0075433_10050721
254 Ga0075434_100001049
255 Ga0075434_100006547
256 Ga0075434_100315176
257 Ga0075436_100007129
258 Ga0075436_100008464
259 Ga0075435_100000213
260 Ga0105240_10511068
261 Ga0111539_10006888
262 Ga0111539_10036302
263 Ga0111539_10044979
264 Ga0111539_10098985
265 Ga0105245_10411995
266 Ga0105247_10022240
267 Ga0114129_10002137
268 Ga0114129_10038255
269 Ga0105242_10084038
270 Ga0105248_10042926
271 Ga0105248_10080302
272 Ga0105248_10140114
273 Ga0105248_10142313
274 Ga0105248_10239148
275 Ga0105237_10447570
276 Ga0163162_10039132
277 Ga0157375_10148752
278 Ga0163163_10047257
279 Ga0157380_10016184
280 Ga0157380_10042974
281 Ga0157379_10005030
282 Ga0163161_10005036
283 Ga0213876_10058555
284 Ga0207710_10030904
285 Ga0207645_10039788
286 Ga0207645_10043475
287 Ga0207707_10285522
288 Ga0207652_10315828
289 Ga0207646_10074704
290 Ga0207681_10062151
291 Ga0207681_10064446
292 Ga0207659_10004827
293 Ga0207700_10006706
294 Ga0207706_10133361
295 Ga0207665_10074908
296 Ga0207691_10065847
297 Ga0207711_10054049
298 Ga0207711_10071816
299 Ga0207711_10099909
300 Ga0207689_10039600
301 Ga0207679_10085715
302 Ga0207651_10054222
303 Ga0207668_10044066
304 Ga0207668_10063669
305 Ga0207668_10079360
306 Ga0207658_10040609
307 Ga0207708_10002632
308 Ga0207708_10023061
309 Ga0207708_10040677
310 Ga0207641_10014455
311 Ga0207648_10003352
312 Ga0207648_10041336
313 Ga0207675_100002221
314 Ga0207675_100035787
315 Ga0207683_10253757
316 Ga0209813_10001496
317 Ga0207428_10001147
318 Ga0207428_10014166
319 Ga0207428_10172856
320 Ga0268265_10004027
321 Ga0265314_10145508
322 Ga0307409_100007833
323 Ga0373930_0013834
324 Ga0373958_0000875
325 Ga0373938_0008020
326 Ga0373928_0005082
327 Ga0373940_0001778
328 Ga0373951_0000250
329 Ga0373939_0000330
330 Ga0373960_0000553
331 Ga0373946_0007807
332 Ga0373955_0024945
333 Ga0373942_0000461
334 Ga0373961_0001789
335 Ga0373962_0002576
336 Ga0373935_0170789
337 Ga0373947_0148710
338 Ga0436365_1516765
339 Ga0450895_004061
340 Ga0450916_002810
341 Ga0451576_0003199
342 Ga0495592_0053608
343 Ga0495592_0223146
344 Ga0495653_0048042
345 Ga0495628_0067150
346 Ga0495630_0004210
347 Ga0495667_0118351
348 Ga0495613_0005107
349 Ga0495613_0048660
350 Ga0495604_0096974
351 Ga0495604_0127629
352 Ga0495674_0022038
353 Ga0495684_0001265
354 Ga0495684_0112446
355 Ga0496109_0265203
356 Ga0496114_0002165
357 Ga0496115_0049192
358 Ga0501071_0092034
359 Ga0501072_0105567
360 Ga0501073_0008361
361 Ga0501080_0111480
362 Ga0501045_0048673
363 nmdc:mga00v17_169364_c1
364 nmdc:mga00v17_80271_c1
365 nmdc:mga0k408_36239_c1
366 nmdc:mga06z11_95247_c1
367 nmdc:mga04h51_4035_c1
368 nmdc:mga05p37_12306_c1
369 nmdc:mga05p37_28047_c1
370 nmdc:mga08y16_168848_c1
371 nmdc:mga08y16_4298_c1
372 nmdc:mga08y16_633870_c1
373 nmdc:mga08y16_73474_c1
374 nmdc:mga08y16_9169_c1
375 nmdc:mga0n895_173_c1
376 nmdc:mga0n895_293257_c1
377 nmdc:mga0n895_5460_c1
378 nmdc:mga0rr50_1088_c1
379 nmdc:mga0rr50_15225_c1
380 nmdc:mga0rr50_2_c1
381 nmdc:mga08x19_24019_c1
382 nmdc:mga08x19_452_c1
383 nmdc:mga08x19_61801_c1
384 nmdc:mga0a205_67600_c1
385 Ga0495601_0003629
386 Ga0495601_0005785
387 Ga0495612_0055675
388 Ga0495595_0064369
389 Ga0495619_0001690
390 Ga0500641_0003189
391 Ga0500568_0009745
392 Ga0500616_0000358
393 Ga0500645_001085
394 Ga0500599_004683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

98

442

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkj-assembly1.cif.gz_B crystal structure of helicobacter pylori aminofutalosine deaminase (aflda) 0.8943 7 348
7lkj-assembly2.cif.gz_D crystal structure of helicobacter pylori aminofutalosine deaminase (aflda) 0.8874 7 348
7lkk-assembly2.cif.gz_C crystal structure of helicobacter pylori aminofutalosine deaminase (aflda) in complex with methylthio-coformycin 0.8853 7 348
3v7p-assembly1.cif.gz_A-2 crystal structure of amidohydrolase nis_0429 (target efi-500396) from nitratiruptor sp. sb155-2 0.8608 7 348
4f0r-assembly1.cif.gz_A crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'-methylthioadenosine (unproductive complex) 0.8607 7 356
ID Description Score Start End Superfamily
af_Q58936_50_340_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8738 12 314 3.20.20.140
af_Q58936_50_340_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.871 12 314 3.20.20.140
4gbdA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.858 12 314 3.20.20.140
af_Q58110_154_346_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8565 133 343 3.20.20.140
4gbdA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8552 12 314 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V8BLA2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9884 47 359 GO:0016787
AF-A0A6B0WD35-F1-model_v4 Amidohydrolase family protein 0.9868 206 360 GO:0016787
AF-A0A2E8E900-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9835 2 359 GO:0016810
AF-A0A2V8BLA2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.976 47 359 GO:0016787
AF-A0A7X4HWJ2-F1-model_v4 Amidohydrolase family protein 0.9612 2 360 GO:0016810

Map