F303478

General Info

Members Datasets Scaffolds Average Seq Length
197 143 394 153

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0001185|Ga0495625_0001185_1529_2059
Length 176
Sequence MQNQRSTPPKTLNIKYNYNTLTNTMQIRPATLNDIPTLLQFEQGVITAERPFDPTLVPGAIKYYDLEMFITSPDVELLVAELDGQLVGSGYARIKQSEKVYFDFERYAYLGFMFVSPQHRGKGINKLIIDRLKEWAKGQGLTELRLQVYADNEGAVRAYEKVGFGKHMVEMRMGLE

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
128 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
129 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
130 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
131 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
134 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
135 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
136 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
137 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
138 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
139 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
140 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
141 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
142 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
143 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0
Isolates 5.58

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 9.64
Nodule 0
Rhizoplane 0.51
Rhizosphere 80.2
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0001185 3300046660 Bacteria 33419
2 JGI24737J22298_10004411 3300001990 Bacteria 4907
3 JGI24735J21928_10000001 3300002067 Bacteria 650042
4 JGI25162J39368_1000435 3300002737 Bacteria 33619
5 JGI25164J39214_1002757 3300002772 Unclassified 2499
6 JGI25165J46597_1002884 3300003214 Bacteria 4886
7 rootH1_10143942 3300003316 Bacteria 3200
8 rootH2_10130682 3300003320 Bacteria 1658
9 rootL2_10045610 3300003322 Bacteria 6216
10 rootL2_10136755 3300003322 Bacteria 1761
11 JGI25160J50197_1000999 3300003354 Bacteria 14665
12 Ga0065714_10075054 3300005288 Bacteria 2953
13 Ga0065712_10369628 3300005290 Bacteria 765
14 Ga0070676_10050983 3300005328 Bacteria 2428
15 Ga0070683_100010718 3300005329 Bacteria 7883
16 Ga0070670_100134844 3300005331 Unclassified 2133
17 Ga0068869_100126995 3300005334 Bacteria 1957
18 Ga0070661_100249261 3300005344 Bacteria 1370
19 Ga0070661_100556555 3300005344 Bacteria 923
20 Ga0070661_100681903 3300005344 Bacteria 836
21 Ga0070668_100619381 3300005347 Bacteria 948
22 Ga0070669_100220087 3300005353 Bacteria 1501
23 Ga0070675_100225119 3300005354 Bacteria 1634
24 Ga0070671_100312893 3300005355 Bacteria 1338
25 Ga0070671_100484192 3300005355 Bacteria 1063
26 Ga0070674_100659151 3300005356 Bacteria 890
27 Ga0070673_100080087 3300005364 Bacteria 2646
28 Ga0070673_100133195 3300005364 Bacteria 2089
29 Ga0070678_100406852 3300005456 Bacteria 1183
30 Ga0070662_100000853 3300005457 Bacteria 18740
31 Ga0070681_10306753 3300005458 Archaea 1497
32 Ga0068867_100034600 3300005459 Bacteria 3662
33 Ga0068867_100157321 3300005459 Bacteria 1790
34 Ga0070685_10041674 3300005466 Bacteria 2617
35 Ga0070684_100004059 3300005535 Bacteria 11084
36 Ga0070684_100125294 3300005535 Bacteria 2313
37 Ga0068853_100029154 3300005539 Bacteria 4650
38 Ga0068853_100066627 3300005539 Bacteria 3127
39 Ga0070672_100361864 3300005543 Bacteria 1238
40 Ga0070665_100000367 3300005548 Bacteria 67579
41 Ga0068855_100021310 3300005563 Bacteria 7772
42 Ga0068855_100109054 3300005563 Bacteria 3180
43 Ga0068855_100179698 3300005563 Bacteria 2393
44 Ga0070664_100634032 3300005564 Bacteria 993
45 Ga0068854_100075650 3300005578 Bacteria 2473
46 Ga0068856_100000690 3300005614 Bacteria 36629
47 Ga0068859_101086736 3300005617 Bacteria 880
48 Ga0068864_100242248 3300005618 Bacteria 1671
49 Ga0068864_101648442 3300005618 Bacteria 646
50 Ga0068861_100016638 3300005719 Bacteria 5208
51 Ga0068851_10030039 3300005834 Bacteria 2693
52 Ga0068870_10363087 3300005840 Bacteria 932
53 Ga0068858_100686400 3300005842 Bacteria 996
54 Ga0068858_101589322 3300005842 Bacteria 645
55 Ga0068860_100109650 3300005843 Bacteria 2638
56 Ga0068860_100811540 3300005843 Bacteria 949
57 Ga0075366_10013771 3300006195 Bacteria 4609
58 Ga0075366_10026872 3300006195 Bacteria 3374
59 Ga0097621_101390851 3300006237 Bacteria 664
60 Ga0097620_101086638 3300006931 Bacteria 880
61 Ga0105240_10007763 3300009093 Bacteria 15518
62 Ga0105240_10030838 3300009093 Bacteria 6965
63 Ga0105240_10171756 3300009093 Bacteria 2567
64 Ga0105243_10008729 3300009148 Bacteria 7768
65 Ga0105243_10281441 3300009148 Bacteria 1498
66 Ga0105241_10000784 3300009174 Bacteria 24141
67 Ga0105241_11088550 3300009174 Bacteria 752
68 Ga0105237_10012167 3300009545 Bacteria 9076
69 Ga0105237_10327670 3300009545 Bacteria 1535
70 Ga0105237_10995198 3300009545 Unclassified 845
71 Ga0105239_10067598 3300010375 Bacteria 3926
72 Ga0105246_10019956 3300011119 Bacteria 4294
73 Ga0157373_10366311 3300013100 Bacteria 1029
74 Ga0157371_10014703 3300013102 Bacteria 5892
75 Ga0157371_11104380 3300013102 Unclassified 608
76 Ga0157369_10495868 3300013105 Bacteria 1263
77 Ga0157374_10000393 3300013296 Bacteria 39683
78 Ga0157374_10259649 3300013296 Bacteria 1711
79 Ga0157374_10412853 3300013296 Bacteria 1348
80 Ga0157378_11226502 3300013297 Bacteria 790
81 Ga0163162_10000457 3300013306 Bacteria 37808
82 Ga0163162_10017145 3300013306 Bacteria 7086
83 Ga0163162_10103148 3300013306 Bacteria 2946
84 Ga0157372_10007965 3300013307 Bacteria 11267
85 Ga0157375_10081814 3300013308 Bacteria 3270
86 Ga0157375_10494880 3300013308 Bacteria 1387
87 Ga0163163_12097466 3300014325 Unclassified 625
88 Ga0157380_12005948 3300014326 Unclassified 640
89 Ga0157377_10004495 3300014745 Bacteria 6432
90 Ga0157377_10400122 3300014745 Bacteria 935
91 Ga0182006_1000003 3300015261 Bacteria 826681
92 Ga0163161_10405896 3300017792 Bacteria 1093
93 Ga0209563_106923 3300025230 Unclassified 1905
94 Ga0207427_100644 3300025231 Bacteria 16924
95 Ga0209437_100112 3300025233 Bacteria 214292
96 Ga0209233_1000126 3300025261 Bacteria 214298
97 Ga0207426_1000002 3300025302 Bacteria 1249660
98 Ga0207656_10061900 3300025321 Bacteria 1644
99 Ga0207647_10000495 3300025904 Bacteria 31517
100 Ga0207647_10449413 3300025904 Bacteria 722
101 Ga0207643_10332221 3300025908 Bacteria 951
102 Ga0207654_10087329 3300025911 Bacteria 1892
103 Ga0207654_10232880 3300025911 Bacteria 1227
104 Ga0207695_10012165 3300025913 Bacteria 10344
105 Ga0207695_10090487 3300025913 Bacteria 3075
106 Ga0207671_10048102 3300025914 Bacteria 3156
107 Ga0207657_10153268 3300025919 Bacteria 1876
108 Ga0207657_11174324 3300025919 Unclassified 584
109 Ga0207649_10292894 3300025920 Bacteria 1187
110 Ga0207650_10156519 3300025925 Bacteria 1802
111 Ga0207644_10760984 3300025931 Bacteria 809
112 Ga0207644_10817601 3300025931 Bacteria 780
113 Ga0207690_11002944 3300025932 Bacteria 695
114 Ga0207706_10000553 3300025933 Bacteria 39805
115 Ga0207706_10211561 3300025933 Bacteria 1700
116 Ga0207709_10046437 3300025935 Bacteria 2635
117 Ga0207691_10443265 3300025940 Bacteria 1105
118 Ga0207689_10005843 3300025942 Bacteria 10906
119 Ga0207661_10012393 3300025944 Bacteria 6194
120 Ga0207661_10685211 3300025944 Unclassified 942
121 Ga0207679_11531056 3300025945 Bacteria 611
122 Ga0207667_10017093 3300025949 Bacteria 8178
123 Ga0207667_10063459 3300025949 Bacteria 3860
124 Ga0207651_10233843 3300025960 Bacteria 1494
125 Ga0207640_10169268 3300025981 Bacteria 1626
126 Ga0207677_10057184 3300026023 Archaea 2677
127 Ga0207677_10616828 3300026023 Bacteria 953
128 Ga0207703_10880572 3300026035 Bacteria 857
129 Ga0207639_10124268 3300026041 Bacteria 2125
130 Ga0207702_10024065 3300026078 Bacteria 5053
131 Ga0207648_10045866 3300026089 Bacteria 3833
132 Ga0207648_10132683 3300026089 Bacteria 2192
133 Ga0207676_10510145 3300026095 Bacteria 1143
134 Ga0207676_10840760 3300026095 Unclassified 897
135 Ga0207674_11804973 3300026116 Bacteria 579
136 Ga0207675_100354931 3300026118 Unclassified 1437
137 Ga0268266_10000053 3300028379 Bacteria 295181
138 Ga0268264_10027788 3300028381 Bacteria 4625
139 Ga0268264_10761170 3300028381 Bacteria 965
140 Ga0307517_10004728 3300028786 Bacteria 20806
141 Ga0307515_10000001 3300028794 Bacteria 4259510
142 Ga0307515_10001599 3300028794 Bacteria 50542
143 Ga0307515_10281880 3300028794 Bacteria 1368
144 Ga0307516_10003984 3300031730 Bacteria 18549
145 Ga0307507_10000362 3300033179 Bacteria 93053
146 Ga0436364_0762015 3300037853 Unclassified 634
147 Ga0495650_0000132 3300046471 Bacteria 174226
148 Ga0495650_0120954 3300046471 Unclassified 964
149 Ga0495605_0128221 3300046474 Bacteria 1146
150 Ga0495585_0000399 3300046492 Bacteria 42055
151 Ga0495585_0024169 3300046492 Bacteria 3486
152 Ga0495610_0000739 3300046512 Bacteria 31000
153 Ga0495616_0001978 3300046513 Bacteria 13788
154 Ga0495631_0052240 3300046518 Bacteria 1785
155 Ga0495632_0187442 3300046519 Bacteria 946
156 Ga0495637_0038934 3300046520 Bacteria 2056
157 Ga0495648_0019278 3300046524 Bacteria 4802
158 Ga0495648_0034613 3300046524 Bacteria 3285
159 Ga0495654_0028088 3300046530 Bacteria 2879
160 Ga0495609_0004618 3300046538 Bacteria 7482
161 Ga0495609_0045598 3300046538 Bacteria 1964
162 Ga0495622_0025119 3300046557 Bacteria 2783
163 Ga0495633_0000156 3300046558 Bacteria 89387
164 Ga0495668_0000021 3300046616 Bacteria 381308
165 Ga0495668_0007001 3300046616 Bacteria 7282
166 Ga0495625_0000036 3300046660 Bacteria 221680
167 Ga0495625_0000222 3300046660 Bacteria 89536
168 Ga0495625_0018600 3300046660 Bacteria 5417
169 Ga0495661_0003353 3300046665 Bacteria 11869
170 Ga0495661_0006562 3300046665 Bacteria 8172
171 Ga0495661_0021356 3300046665 Bacteria 4222
172 Ga0495661_0027916 3300046665 Bacteria 3619
173 Ga0495649_0000017 3300046694 Bacteria 221685
174 Ga0495660_0020268 3300046810 Bacteria 3811
175 Ga0495687_037668 3300047443 Bacteria 2152
176 Ga0495686_0000066 3300047472 Bacteria 225023
177 Ga0495686_0078031 3300047472 Bacteria 2028
178 Ga0496126_0148519 3300048929 Bacteria 2011
179 nmdc:mga0k408_14271_c1 3300050493 Bacteria 4373
180 nmdc:mga0k408_57029_c1 3300050493 Bacteria 2267
181 Ga0500647_0074942 3300053091 Bacteria 1624
182 Ga0500618_000023 3300053125 Bacteria 152444
183 Ga0500655_001356 3300053133 Bacteria 4632
184 Ga0500619_216511 3300053154 Bacteria 639
185 Ga0500634_0204453 3300053161 Bacteria 864
186 Ga0500637_0327455 3300053178 Unclassified 825
187 2599477105 2599185184 Bacteria 6430550
188 2729200392 2728369107 Bacteria 5082720
189 2738701335 2738541273 Bacteria 4048577
190 2739255633 2738543014 Bacteria 4048139
191 2852624734 2852623160 Bacteria 4376875
192 2884936378 2884933994 Bacteria 4535041
193 2928079018 2928078545 Bacteria 6534839
194 2928148611 2928147474 Bacteria 6512076
195 2932085667 2932082852 Bacteria 6563563
196 2984573455 2984572630 Bacteria 4186940
197 2984606893 2984606641 Bacteria 4186971
198 Ga0495625_0001185
199 JGI24737J22298_10004411
200 JGI24735J21928_10000001
201 JGI25162J39368_1000435
202 JGI25164J39214_1002757
203 JGI25165J46597_1002884
204 rootH1_10143942
205 rootH2_10130682
206 rootL2_10045610
207 rootL2_10136755
208 JGI25160J50197_1000999
209 Ga0065714_10075054
210 Ga0065712_10369628
211 Ga0070676_10050983
212 Ga0070683_100010718
213 Ga0070670_100134844
214 Ga0068869_100126995
215 Ga0070661_100249261
216 Ga0070661_100556555
217 Ga0070661_100681903
218 Ga0070668_100619381
219 Ga0070669_100220087
220 Ga0070675_100225119
221 Ga0070671_100312893
222 Ga0070671_100484192
223 Ga0070674_100659151
224 Ga0070673_100080087
225 Ga0070673_100133195
226 Ga0070678_100406852
227 Ga0070662_100000853
228 Ga0070681_10306753
229 Ga0068867_100034600
230 Ga0068867_100157321
231 Ga0070685_10041674
232 Ga0070684_100004059
233 Ga0070684_100125294
234 Ga0068853_100029154
235 Ga0068853_100066627
236 Ga0070672_100361864
237 Ga0070665_100000367
238 Ga0068855_100021310
239 Ga0068855_100109054
240 Ga0068855_100179698
241 Ga0070664_100634032
242 Ga0068854_100075650
243 Ga0068856_100000690
244 Ga0068859_101086736
245 Ga0068864_100242248
246 Ga0068864_101648442
247 Ga0068861_100016638
248 Ga0068851_10030039
249 Ga0068870_10363087
250 Ga0068858_100686400
251 Ga0068858_101589322
252 Ga0068860_100109650
253 Ga0068860_100811540
254 Ga0075366_10013771
255 Ga0075366_10026872
256 Ga0097621_101390851
257 Ga0097620_101086638
258 Ga0105240_10007763
259 Ga0105240_10030838
260 Ga0105240_10171756
261 Ga0105243_10008729
262 Ga0105243_10281441
263 Ga0105241_10000784
264 Ga0105241_11088550
265 Ga0105237_10012167
266 Ga0105237_10327670
267 Ga0105237_10995198
268 Ga0105239_10067598
269 Ga0105246_10019956
270 Ga0157373_10366311
271 Ga0157371_10014703
272 Ga0157371_11104380
273 Ga0157369_10495868
274 Ga0157374_10000393
275 Ga0157374_10259649
276 Ga0157374_10412853
277 Ga0157378_11226502
278 Ga0163162_10000457
279 Ga0163162_10017145
280 Ga0163162_10103148
281 Ga0157372_10007965
282 Ga0157375_10081814
283 Ga0157375_10494880
284 Ga0163163_12097466
285 Ga0157380_12005948
286 Ga0157377_10004495
287 Ga0157377_10400122
288 Ga0182006_1000003
289 Ga0163161_10405896
290 Ga0209563_106923
291 Ga0207427_100644
292 Ga0209437_100112
293 Ga0209233_1000126
294 Ga0207426_1000002
295 Ga0207656_10061900
296 Ga0207647_10000495
297 Ga0207647_10449413
298 Ga0207643_10332221
299 Ga0207654_10087329
300 Ga0207654_10232880
301 Ga0207695_10012165
302 Ga0207695_10090487
303 Ga0207671_10048102
304 Ga0207657_10153268
305 Ga0207657_11174324
306 Ga0207649_10292894
307 Ga0207650_10156519
308 Ga0207644_10760984
309 Ga0207644_10817601
310 Ga0207690_11002944
311 Ga0207706_10000553
312 Ga0207706_10211561
313 Ga0207709_10046437
314 Ga0207691_10443265
315 Ga0207689_10005843
316 Ga0207661_10012393
317 Ga0207661_10685211
318 Ga0207679_11531056
319 Ga0207667_10017093
320 Ga0207667_10063459
321 Ga0207651_10233843
322 Ga0207640_10169268
323 Ga0207677_10057184
324 Ga0207677_10616828
325 Ga0207703_10880572
326 Ga0207639_10124268
327 Ga0207702_10024065
328 Ga0207648_10045866
329 Ga0207648_10132683
330 Ga0207676_10510145
331 Ga0207676_10840760
332 Ga0207674_11804973
333 Ga0207675_100354931
334 Ga0268266_10000053
335 Ga0268264_10027788
336 Ga0268264_10761170
337 Ga0307517_10004728
338 Ga0307515_10000001
339 Ga0307515_10001599
340 Ga0307515_10281880
341 Ga0307516_10003984
342 Ga0307507_10000362
343 Ga0436364_0762015
344 Ga0495650_0000132
345 Ga0495650_0120954
346 Ga0495605_0128221
347 Ga0495585_0000399
348 Ga0495585_0024169
349 Ga0495610_0000739
350 Ga0495616_0001978
351 Ga0495631_0052240
352 Ga0495632_0187442
353 Ga0495637_0038934
354 Ga0495648_0019278
355 Ga0495648_0034613
356 Ga0495654_0028088
357 Ga0495609_0004618
358 Ga0495609_0045598
359 Ga0495622_0025119
360 Ga0495633_0000156
361 Ga0495668_0000021
362 Ga0495668_0007001
363 Ga0495625_0000036
364 Ga0495625_0000222
365 Ga0495625_0018600
366 Ga0495661_0003353
367 Ga0495661_0006562
368 Ga0495661_0021356
369 Ga0495661_0027916
370 Ga0495649_0000017
371 Ga0495660_0020268
372 Ga0495687_037668
373 Ga0495686_0000066
374 Ga0495686_0078031
375 Ga0496126_0148519
376 nmdc:mga0k408_14271_c1
377 nmdc:mga0k408_57029_c1
378 Ga0500647_0074942
379 Ga0500618_000023
380 Ga0500655_001356
381 Ga0500619_216511
382 Ga0500634_0204453
383 Ga0500637_0327455
384 2599477105
385 2729200392
386 2738701335
387 2739255633
388 2852624734
389 2884936378
390 2928079018
391 2928148611
392 2932085667
393 2984573455
394 2984606893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

174

0.9

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

44

164

0.88

PF08445

FR47

FR47-like protein

104

173

0.88

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

73

166

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

24

165

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e0a-assembly1.cif.gz_B crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182 0.8965 1 151
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8913 49 138
4e0a-assembly1.cif.gz_B crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182 0.8909 1 151
4f6a-assembly1.cif.gz_B high-resolution x-ray structure of the tetramutant of bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182 0.8854 1 151
4f6a-assembly1.cif.gz_B high-resolution x-ray structure of the tetramutant of bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182 0.88 1 151
ID Description Score Start End Superfamily
4f6aA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8695 2 149 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8659 2 148 3.40.630.30
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8539 1 144 3.40.630.30
af_Q7EYF5_51_166_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8537 38 146 3.40.630.30
4evyB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8513 1 151 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2S7TMU9-F1-model_v4 GNAT family N-acetyltransferase 0.9871 2 151 GO:0016747
AF-A0A7W8KY67-F1-model_v4 deleted 0.987 2 151
AF-A0A2P8G098-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9864 2 150 GO:0005840
GO:0016747
AF-A0A2E4S6F6-F1-model_v4 GNAT family N-acetyltransferase 0.9859 1 151 GO:0016747
AF-A0A2D8W6Q9-F1-model_v4 deleted 0.9848 2 151

Map