F300204

General Info

Members Datasets Scaffolds Average Seq Length
195 126 390 212

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10411850|Ga0207700_104118501
Length 241
Sequence MRASAHARHSGIERASGVPRKRRTRHVSEPAAEVVRWVCVVNDDEGIRASLATLIRRASSLKLIGDYADAETALKDIPRRPPDVVLMDINLPGMNGVECVRQLKSAAPGVQFLMLTVYEDSDSLFNSLKAGASGYLLKRTASARLLEAIRDVYEGGSPMTPQLARRVVQFFSKASRGESPVSHLTPGEREFLDQLANGYAYKEIADRMKISIDTVRSYVRTVYEKLHVHSRTEAVVKYLRG

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
66 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 1.03
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 17.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10411850 3300025928 Unclassified 1186
2 rootH2_10198322 3300003320 Unclassified 3567
3 rootH2_10304899 3300003320 Bacteria 2199
4 Ga0070689_100143537 3300005340 Bacteria 1921
5 Ga0070714_100009477 3300005435 Bacteria 7657
6 Ga0070714_100245767 3300005435 Bacteria 1653
7 Ga0070713_100584293 3300005436 Unclassified 1060
8 Ga0070705_100646856 3300005440 Bacteria 824
9 Ga0070707_100394353 3300005468 Bacteria 1344
10 Ga0070699_100331096 3300005518 Bacteria 1370
11 Ga0070679_100412251 3300005530 Bacteria 1297
12 Ga0070693_100597437 3300005547 Bacteria 796
13 Ga0068855_100033279 3300005563 Bacteria 6153
14 Ga0068855_100391842 3300005563 Bacteria 1523
15 Ga0068856_100002290 3300005614 Bacteria 19736
16 Ga0068856_100004330 3300005614 Bacteria 14158
17 Ga0068856_100379493 3300005614 Unclassified 1433
18 Ga0070702_100037273 3300005615 Bacteria 2700
19 Ga0068852_100836867 3300005616 Unclassified 935
20 Ga0068863_100170903 3300005841 Bacteria 2085
21 Ga0075367_10087005 3300006178 Unclassified 1897
22 Ga0075366_10069615 3300006195 Unclassified 2094
23 Ga0068871_100016929 3300006358 Bacteria 5504
24 Ga0068871_100334628 3300006358 Bacteria 1336
25 Ga0075434_100111727 3300006871 Bacteria 2744
26 Ga0075434_100956894 3300006871 Unclassified 871
27 Ga0105240_10145858 3300009093 Bacteria 2824
28 Ga0111539_11033602 3300009094 Bacteria 955
29 Ga0111539_11197297 3300009094 Unclassified 882
30 Ga0105245_10118915 3300009098 Bacteria 2466
31 Ga0105245_10348057 3300009098 Bacteria 1467
32 Ga0114129_10394131 3300009147 Bacteria 1826
33 Ga0105242_10038199 3300009176 Unclassified 3860
34 Ga0105242_10088949 3300009176 Bacteria 2595
35 Ga0105242_10398796 3300009176 Bacteria 1283
36 Ga0105249_10233601 3300009553 Bacteria 1814
37 Ga0163163_10132099 3300014325 Bacteria 2537
38 Ga0157376_10507857 3300014969 Bacteria 1186
39 Ga0207695_10360551 3300025913 Bacteria 1340
40 Ga0207652_10494819 3300025921 Bacteria 1101
41 Ga0207694_10121513 3300025924 Bacteria 2086
42 Ga0207664_10269224 3300025929 Bacteria 1492
43 Ga0207686_10089245 3300025934 Bacteria 2032
44 Ga0207670_10127643 3300025936 Bacteria 1858
45 Ga0207670_10632941 3300025936 Unclassified 881
46 Ga0207711_10324349 3300025941 Bacteria 1423
47 Ga0207667_10107053 3300025949 Bacteria 2884
48 Ga0207667_10143131 3300025949 Bacteria 2461
49 Ga0207702_10003660 3300026078 Bacteria 13925
50 Ga0207702_10018079 3300026078 Bacteria 5833
51 Ga0207702_10286605 3300026078 Unclassified 1559
52 Ga0207641_10216497 3300026088 Bacteria 1774
53 Ga0265337_1004127 3300028556 Bacteria 6098
54 Ga0265337_1004920 3300028556 Bacteria 5437
55 Ga0265319_1026877 3300028563 Bacteria 2046
56 Ga0265318_10009222 3300028577 Bacteria 4353
57 Ga0265318_10091151 3300028577 Unclassified 1123
58 Ga0265323_10000213 3300028653 Bacteria 34497
59 Ga0265323_10017400 3300028653 Bacteria 2792
60 Ga0265322_10051568 3300028654 Bacteria 1168
61 Ga0265338_10003712 3300028800 Bacteria 21241
62 Ga0265338_10009659 3300028800 Bacteria 11446
63 Ga0265338_10016536 3300028800 Bacteria 8015
64 Ga0265338_10054033 3300028800 Bacteria 3586
65 Ga0265338_10359636 3300028800 Bacteria 1045
66 Ga0265338_10673092 3300028800 Bacteria 716
67 Ga0265324_10003850 3300029957 Bacteria 7005
68 Ga0265324_10012457 3300029957 Bacteria 3205
69 Ga0265324_10049644 3300029957 Bacteria 1443
70 Ga0265330_10082437 3300031235 Bacteria 1385
71 Ga0265320_10036097 3300031240 Bacteria 2500
72 Ga0265320_10042028 3300031240 Bacteria 2270
73 Ga0265339_10011993 3300031249 Bacteria 5311
74 Ga0265339_10015462 3300031249 Bacteria 4573
75 Ga0265331_10060041 3300031250 Bacteria 1797
76 Ga0265327_10006325 3300031251 Bacteria 9511
77 Ga0265327_10007580 3300031251 Bacteria 8334
78 Ga0265316_10039703 3300031344 Bacteria 3779
79 Ga0265313_10002732 3300031595 Bacteria 14913
80 Ga0265314_10007632 3300031711 Bacteria 9363
81 Ga0265342_10267364 3300031712 Bacteria 908
82 Ga0373950_0000075 3300034818 Bacteria 43166
83 Ga0373953_0084528 3300035117 Bacteria 1323
84 Ga0373954_0001132 3300035118 Bacteria 10695
85 Ga0373954_0012580 3300035118 Bacteria 3764
86 Ga0373956_0003319 3300035119 Bacteria 6481
87 Ga0373946_0082269 3300035171 Bacteria 1412
88 Ga0373962_0041152 3300035242 Bacteria 1302
89 Ga0373927_0048089 3300035695 Bacteria 2758
90 Ga0373933_0004467 3300035724 Bacteria 7670
91 Ga0373937_0024919 3300036401 Bacteria 5399
92 Ga0373925_0042160 3300037068 Unclassified 3386
93 Ga0373925_0196685 3300037068 Bacteria 1602
94 Ga0373925_0228011 3300037068 Bacteria 1489
95 Ga0373925_0810125 3300037068 Bacteria 772
96 Ga0451807_1371480 3300041486 Unclassified 1194
97 Ga0439435_0017906 3300042436 Bacteria 1797
98 Ga0439444_0026726 3300042437 Bacteria 1058
99 Ga0451577_0055749 3300042876 Bacteria 3525
100 Ga0451576_0031219 3300045051 Bacteria 5683
101 Ga0451576_0078081 3300045051 Bacteria 3446
102 Ga0451576_0281039 3300045051 Unclassified 1740
103 Ga0451576_1183692 3300045051 Bacteria 798
104 Ga0451576_1319465 3300045051 Bacteria 752
105 Ga0495592_0059068 3300046454 Bacteria 2826
106 Ga0495629_0029474 3300046459 Bacteria 3891
107 Ga0495641_0005585 3300046461 Bacteria 8427
108 Ga0495653_0443233 3300046463 Bacteria 818
109 Ga0495618_0002648 3300046514 Bacteria 11455
110 Ga0495628_0129185 3300046516 Bacteria 1934
111 Ga0495628_0213995 3300046516 Unclassified 1449
112 Ga0495630_0000022 3300046517 Bacteria 172932
113 Ga0495630_0188998 3300046517 Unclassified 1571
114 Ga0495666_0035381 3300046526 Bacteria 2435
115 Ga0495666_0178439 3300046526 Bacteria 981
116 Ga0495652_0521152 3300046529 Bacteria 821
117 Ga0495640_0211972 3300046533 Bacteria 1224
118 Ga0495586_0000010 3300046535 Bacteria 143135
119 Ga0495586_0000748 3300046535 Bacteria 18672
120 Ga0495586_0001479 3300046535 Bacteria 12957
121 Ga0495645_0270692 3300046543 Unclassified 1121
122 Ga0495645_0344148 3300046543 Bacteria 962
123 Ga0495667_0094740 3300046559 Unclassified 1933
124 Ga0495634_0001579 3300046642 Bacteria 20011
125 Ga0495634_0014219 3300046642 Bacteria 5743
126 Ga0495634_0031011 3300046642 Unclassified 3685
127 Ga0495657_0323174 3300046675 Bacteria 917
128 Ga0495599_0077953 3300046678 Bacteria 2069
129 Ga0495599_0108312 3300046678 Unclassified 1731
130 Ga0495658_0085793 3300046683 Unclassified 1856
131 Ga0495658_0200904 3300046683 Bacteria 1242
132 Ga0495669_0036951 3300046684 Bacteria 2160
133 Ga0495613_0001550 3300046689 Bacteria 17465
134 Ga0495613_0006521 3300046689 Bacteria 8723
135 Ga0495624_0040377 3300046690 Bacteria 2989
136 Ga0495600_0378043 3300046809 Bacteria 884
137 Ga0495600_0512496 3300046809 Bacteria 736
138 Ga0495581_0020485 3300047315 Unclassified 3837
139 Ga0495674_0012010 3300047319 Bacteria 8165
140 Ga0495674_0334408 3300047319 Bacteria 1232
141 Ga0495672_0035658 3300047320 Unclassified 3062
142 Ga0495676_0011146 3300047321 Bacteria 8123
143 Ga0495676_0052283 3300047321 Bacteria 3262
144 Ga0495680_0005354 3300047322 Bacteria 12102
145 Ga0495675_0445214 3300047444 Unclassified 750
146 Ga0496114_0109440 3300048917 Bacteria 2366
147 Ga0501031_0000122 3300049568 Bacteria 42868
148 Ga0501031_0065407 3300049568 Unclassified 2369
149 Ga0501032_0001907 3300049569 Bacteria 16467
150 Ga0501032_0073012 3300049569 Unclassified 2286
151 Ga0501032_0152637 3300049569 Bacteria 1518
152 Ga0501033_0006349 3300049570 Bacteria 9265
153 Ga0501033_0016326 3300049570 Bacteria 5624
154 Ga0501033_0041721 3300049570 Unclassified 3423
155 Ga0501034_0000377 3300049571 Bacteria 75861
156 Ga0501034_0000378 3300049571 Bacteria 75855
157 Ga0501036_0031771 3300049572 Bacteria 4461
158 Ga0501036_0032776 3300049572 Bacteria 4392
159 Ga0501036_0746170 3300049572 Bacteria 808
160 Ga0501037_0210789 3300049573 Bacteria 1370
161 Ga0501038_0135815 3300049574 Bacteria 2015
162 Ga0501043_0105481 3300049579 Bacteria 2214
163 Ga0501046_0000404 3300049580 Bacteria 43145
164 Ga0501046_0259999 3300049580 Bacteria 1275
165 Ga0501047_0000184 3300049581 Bacteria 75843
166 Ga0501047_0304399 3300049581 Bacteria 1436
167 Ga0501048_0009271 3300049582 Bacteria 7393
168 Ga0501070_0000437 3300049586 Bacteria 37839
169 Ga0501070_0116203 3300049586 Unclassified 2210
170 Ga0501072_0000080 3300049588 Bacteria 70836
171 Ga0501073_0004800 3300049589 Bacteria 10143
172 Ga0501073_0012719 3300049589 Bacteria 6138
173 Ga0501073_0070248 3300049589 Bacteria 2439
174 Ga0501074_0003675 3300049590 Bacteria 10879
175 Ga0501079_0001384 3300049741 Bacteria 17084
176 Ga0501080_0078529 3300049742 Bacteria 3069
177 Ga0501080_0642824 3300049742 Bacteria 939
178 Ga0501083_0000753 3300049744 Bacteria 21143
179 Ga0501035_0002625 3300049822 Bacteria 17513
180 Ga0501035_0043419 3300049822 Bacteria 4051
181 Ga0501044_0000430 3300049823 Bacteria 51693
182 Ga0501044_0017783 3300049823 Bacteria 7625
183 Ga0501044_0475681 3300049823 Bacteria 1153
184 nmdc:mga03683_132391_c1 3300050489 Bacteria 1116
185 nmdc:mga0k408_55823_c1 3300050493 Unclassified 2290
186 nmdc:mga05p37_880794_c1 3300050507 Unclassified 968
187 nmdc:mga05p37_94856_c1 3300050507 Bacteria 3676
188 nmdc:mga08y16_856884_c1 3300050511 Bacteria 897
189 nmdc:mga0n895_589810_c1 3300050512 Bacteria 1114
190 nmdc:mga0n895_670761_c1 3300050512 Unclassified 1034
191 nmdc:mga0a205_878810_c1 3300050515 Bacteria 743
192 Ga0495601_0035678 3300053077 Unclassified 3105
193 Ga0500568_0006151 3300053139 Bacteria 6071
194 Ga0501084_0000015 3300054114 Bacteria 159007
195 2910250214 2910245624 Bacteria 6935613
196 Ga0207700_10411850
197 rootH2_10198322
198 rootH2_10304899
199 Ga0070689_100143537
200 Ga0070714_100009477
201 Ga0070714_100245767
202 Ga0070713_100584293
203 Ga0070705_100646856
204 Ga0070707_100394353
205 Ga0070699_100331096
206 Ga0070679_100412251
207 Ga0070693_100597437
208 Ga0068855_100033279
209 Ga0068855_100391842
210 Ga0068856_100002290
211 Ga0068856_100004330
212 Ga0068856_100379493
213 Ga0070702_100037273
214 Ga0068852_100836867
215 Ga0068863_100170903
216 Ga0075367_10087005
217 Ga0075366_10069615
218 Ga0068871_100016929
219 Ga0068871_100334628
220 Ga0075434_100111727
221 Ga0075434_100956894
222 Ga0105240_10145858
223 Ga0111539_11033602
224 Ga0111539_11197297
225 Ga0105245_10118915
226 Ga0105245_10348057
227 Ga0114129_10394131
228 Ga0105242_10038199
229 Ga0105242_10088949
230 Ga0105242_10398796
231 Ga0105249_10233601
232 Ga0163163_10132099
233 Ga0157376_10507857
234 Ga0207695_10360551
235 Ga0207652_10494819
236 Ga0207694_10121513
237 Ga0207664_10269224
238 Ga0207686_10089245
239 Ga0207670_10127643
240 Ga0207670_10632941
241 Ga0207711_10324349
242 Ga0207667_10107053
243 Ga0207667_10143131
244 Ga0207702_10003660
245 Ga0207702_10018079
246 Ga0207702_10286605
247 Ga0207641_10216497
248 Ga0265337_1004127
249 Ga0265337_1004920
250 Ga0265319_1026877
251 Ga0265318_10009222
252 Ga0265318_10091151
253 Ga0265323_10000213
254 Ga0265323_10017400
255 Ga0265322_10051568
256 Ga0265338_10003712
257 Ga0265338_10009659
258 Ga0265338_10016536
259 Ga0265338_10054033
260 Ga0265338_10359636
261 Ga0265338_10673092
262 Ga0265324_10003850
263 Ga0265324_10012457
264 Ga0265324_10049644
265 Ga0265330_10082437
266 Ga0265320_10036097
267 Ga0265320_10042028
268 Ga0265339_10011993
269 Ga0265339_10015462
270 Ga0265331_10060041
271 Ga0265327_10006325
272 Ga0265327_10007580
273 Ga0265316_10039703
274 Ga0265313_10002732
275 Ga0265314_10007632
276 Ga0265342_10267364
277 Ga0373950_0000075
278 Ga0373953_0084528
279 Ga0373954_0001132
280 Ga0373954_0012580
281 Ga0373956_0003319
282 Ga0373946_0082269
283 Ga0373962_0041152
284 Ga0373927_0048089
285 Ga0373933_0004467
286 Ga0373937_0024919
287 Ga0373925_0042160
288 Ga0373925_0196685
289 Ga0373925_0228011
290 Ga0373925_0810125
291 Ga0451807_1371480
292 Ga0439435_0017906
293 Ga0439444_0026726
294 Ga0451577_0055749
295 Ga0451576_0031219
296 Ga0451576_0078081
297 Ga0451576_0281039
298 Ga0451576_1183692
299 Ga0451576_1319465
300 Ga0495592_0059068
301 Ga0495629_0029474
302 Ga0495641_0005585
303 Ga0495653_0443233
304 Ga0495618_0002648
305 Ga0495628_0129185
306 Ga0495628_0213995
307 Ga0495630_0000022
308 Ga0495630_0188998
309 Ga0495666_0035381
310 Ga0495666_0178439
311 Ga0495652_0521152
312 Ga0495640_0211972
313 Ga0495586_0000010
314 Ga0495586_0000748
315 Ga0495586_0001479
316 Ga0495645_0270692
317 Ga0495645_0344148
318 Ga0495667_0094740
319 Ga0495634_0001579
320 Ga0495634_0014219
321 Ga0495634_0031011
322 Ga0495657_0323174
323 Ga0495599_0077953
324 Ga0495599_0108312
325 Ga0495658_0085793
326 Ga0495658_0200904
327 Ga0495669_0036951
328 Ga0495613_0001550
329 Ga0495613_0006521
330 Ga0495624_0040377
331 Ga0495600_0378043
332 Ga0495600_0512496
333 Ga0495581_0020485
334 Ga0495674_0012010
335 Ga0495674_0334408
336 Ga0495672_0035658
337 Ga0495676_0011146
338 Ga0495676_0052283
339 Ga0495680_0005354
340 Ga0495675_0445214
341 Ga0496114_0109440
342 Ga0501031_0000122
343 Ga0501031_0065407
344 Ga0501032_0001907
345 Ga0501032_0073012
346 Ga0501032_0152637
347 Ga0501033_0006349
348 Ga0501033_0016326
349 Ga0501033_0041721
350 Ga0501034_0000377
351 Ga0501034_0000378
352 Ga0501036_0031771
353 Ga0501036_0032776
354 Ga0501036_0746170
355 Ga0501037_0210789
356 Ga0501038_0135815
357 Ga0501043_0105481
358 Ga0501046_0000404
359 Ga0501046_0259999
360 Ga0501047_0000184
361 Ga0501047_0304399
362 Ga0501048_0009271
363 Ga0501070_0000437
364 Ga0501070_0116203
365 Ga0501072_0000080
366 Ga0501073_0004800
367 Ga0501073_0012719
368 Ga0501073_0070248
369 Ga0501074_0003675
370 Ga0501079_0001384
371 Ga0501080_0078529
372 Ga0501080_0642824
373 Ga0501083_0000753
374 Ga0501035_0002625
375 Ga0501035_0043419
376 Ga0501044_0000430
377 Ga0501044_0017783
378 Ga0501044_0475681
379 nmdc:mga03683_132391_c1
380 nmdc:mga0k408_55823_c1
381 nmdc:mga05p37_880794_c1
382 nmdc:mga05p37_94856_c1
383 nmdc:mga08y16_856884_c1
384 nmdc:mga0n895_589810_c1
385 nmdc:mga0n895_670761_c1
386 nmdc:mga0a205_878810_c1
387 Ga0495601_0035678
388 Ga0500568_0006151
389 Ga0501084_0000015
390 2910250214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

150

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

182

238

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9756 151 206
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.972 148 207
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9698 149 207
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9694 147 207
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9663 151 207
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9829 150 203 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.976 151 204 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9756 151 206 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 151 204 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.971 150 203 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5J4KNV9-F1-model_v4 Response regulatory domain-containing protein 0.9709 1 128 GO:0000160
GO:0003677
AF-A0A257VTH8-F1-model_v4 Response regulatory domain-containing protein 0.9698 2 141 GO:0000160
AF-A0A7Z0LHK6-F1-model_v4 Response regulator transcription factor 0.9525 1 140 GO:0000160
GO:0003677
GO:0010468
AF-A0A7C7XW49-F1-model_v4 Response regulator transcription factor 0.9494 2 146 GO:0000160
GO:0003677
AF-A0A066YUJ2-F1-model_v4 LuxR family transcriptional regulator 0.9473 1 142 GO:0000160
GO:0003677

Map