F298009

General Info

Members Datasets Scaffolds Average Seq Length
194 112 388 314

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10043345|JGI25151J46595_100433452
Length 336
Sequence MKKAPIFLAPLFQERIWGGSELKKQYRYNIPSAQTGECWAISAHPNGPSVVRDGDYTGKTLGELWDEHPEIFGHFDSGKFPLLTKILDANQDLSIQVHPNDEYANEFENGEFGKTECWYILDCDEDATMIFGHRAQSKEEFMNMVDEGHWNDLLQRVKIKPGDFFYVPSGTIHALCKGTLVLETQQSSDTTYRVYDYDRRDNNGNLRELHLEKAIEVTTVPHITSKVEPALIKMSGGSIVTFVEEDHFTVYKWDVQTEMKLMQDAHFLLASVIEGAGTLCTKEGEFALQKGDHFILPNHVDSFTIKGTLQLIVSHPNHKGGQHRELENTARQMASI

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
6 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
7 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
8 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
12 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
13 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
14 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
15 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
16 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
17 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
18 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
19 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
20 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
21 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
22 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
23 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
24 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
27 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
28 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
29 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
30 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
31 2554235283 Bacillus safensis VK Isolate Rhizosphere
32 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
33 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
34 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
35 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
36 2643221729 Bacillus sp. Root11 Isolate Unclassified
37 2643221730 Bacillus sp. Root131 Isolate Unclassified
38 2643221731 Bacillus sp. Root147 Isolate Unclassified
39 2643221732 Bacillus sp. Root239 Isolate Unclassified
40 2643221735 Bacillus sp. Root920 Isolate Unclassified
41 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
42 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
43 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
44 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
45 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
46 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
47 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
48 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
49 2738543010 Bacillus sp. YR335 Isolate Unclassified
50 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
51 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
52 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
53 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
54 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
55 2811994870 Bacillus sp. JB4 Isolate Unclassified
56 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
57 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
58 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
59 2818991441 Niallia circulans 3243 Isolate Rhizosphere
60 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
61 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
62 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
63 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
64 2842882022 Bacillus sp. R-71893 Isolate Unclassified
65 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
66 2860837431 Bacillus sp. WR11 Isolate Unclassified
67 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
68 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
69 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
70 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
71 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
72 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
73 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
74 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
75 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
76 2919720352 Priestia megaterium 4340 Isolate Unclassified
77 2919726948 Bacillus pumilus 4489 Isolate Unclassified
78 2929004312 Priestia megaterium 1104 Isolate Unclassified
79 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
80 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
81 2938917290 Bacillus sp. CR71 Isolate Unclassified
82 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
83 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
84 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
85 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
86 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
87 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
88 2965761152 Bacillus sp. COPE52 Isolate Unclassified
89 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
90 2969141011 Bacillus velezensis MH25 Isolate Unclassified
91 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
92 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
93 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
94 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
95 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
96 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
97 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
98 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
99 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
100 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
101 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
102 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
103 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
104 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
105 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
106 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
107 8022653035 Bacillus sp. Rc4 Isolate Unclassified
108 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
109 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
110 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
111 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
112 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 21.13
Metatranscriptomes 2.58
Isolates 76.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 0
Rhizoplane 3.09
Rhizosphere 55.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10043345 3300003187 Bacteria 1611
2 JGI25151J46595_10000092 3300003187 Bacteria 122327
3 JGI25151J46595_10022703 3300003187 Bacteria 2599
4 JGI25151J46595_10030246 3300003187 Bacteria 2132
5 Ga0006562J51391_1000756 3300003578 Bacteria 25600
6 Ga0006562J51391_1003692 3300003578 Bacteria 15820
7 Ga0006562J51391_1075695 3300003578 Bacteria 1648
8 Ga0105251_10006833 3300009011 Bacteria 7178
9 Ga0105251_10008122 3300009011 Bacteria 6354
10 Ga0105251_10058265 3300009011 Bacteria 1824
11 Ga0105244_10035661 3300009036 Bacteria 2612
12 Ga0105244_10091352 3300009036 Bacteria 1497
13 Ga0105244_10140837 3300009036 Bacteria 1160
14 Ga0105250_10003578 3300009092 Bacteria 7319
15 Ga0209147_100014 3300025229 Bacteria 597841
16 Ga0209147_103889 3300025229 Bacteria 2684
17 Ga0209147_105605 3300025229 Bacteria 1854
18 Ga0209025_1000011 3300025294 Bacteria 976387
19 Ga0209025_1001453 3300025294 Bacteria 31072
20 Ga0209025_1003793 3300025294 Bacteria 13823
21 Ga0209025_1012042 3300025294 Bacteria 5604
22 Ga0209025_1013059 3300025294 Bacteria 5253
23 Ga0209025_1015971 3300025294 Bacteria 4473
24 Ga0209025_1023643 3300025294 Bacteria 3203
25 Ga0209025_1033640 3300025294 Bacteria 2363
26 Ga0209025_1040363 3300025294 Bacteria 2020
27 Ga0207696_1007322 3300025711 Bacteria 4334
28 Ga0207655_1031297 3300025728 Bacteria 2454
29 Ga0207713_1005544 3300025735 Bacteria 7865
30 Ga0307408_100174771 3300031548 Bacteria 1718
31 Ga0307416_100564150 3300032002 Bacteria 1214
32 Ga0466957_0103881 3300044842 Bacteria 1795
33 Ga0495605_0030109 3300046474 Bacteria 2786
34 Ga0495609_0023233 3300046538 Bacteria 2851
35 Ga0495622_0054459 3300046557 Bacteria 1856
36 Ga0495649_0111769 3300046694 Bacteria 1449
37 Ga0495660_0023025 3300046810 Bacteria 3554
38 Ga0496102_0004932 3300048905 Bacteria 11308
39 Ga0496103_0002845 3300048906 Bacteria 10760
40 Ga0496110_0381485 3300048913 Bacteria 1284
41 Ga0496113_0025640 3300048916 Bacteria 4206
42 Ga0496117_0000040 3300048920 Bacteria 318616
43 Ga0501305_006395 3300049161 Bacteria 1462
44 Ga0501312_004701 3300049528 Bacteria 1624
45 Ga0501217_044258 3300049661 Bacteria 1143
46 Ga0501233_035602 3300049668 Bacteria 1148
47 2511700379 2511231119 Bacteria 4019861
48 2511701297 2511231119 Bacteria 4019861
49 2511701590 2511231119 Bacteria 4019861
50 2540605685 2540341094 Bacteria 4061186
51 2540606339 2540341094 Bacteria 4061186
52 2540608499 2540341094 Bacteria 4061186
53 2545557078 2545555800 Bacteria 4222588
54 2545557686 2545555800 Bacteria 4222588
55 2545557989 2545555800 Bacteria 4222588
56 2555468472 2554235283 Bacteria 3683090
57 2556065069 2554235469 Bacteria 3590176
58 2578931337 2576861599 Bacteria 4217202
59 2578932075 2576861599 Bacteria 4217202
60 2578932388 2576861599 Bacteria 4217202
61 2595089549 2593339131 Bacteria 5116855
62 2595090125 2593339131 Bacteria 5116855
63 2631984631 2630968484 Bacteria 3876276
64 2631986154 2630968484 Bacteria 3876276
65 2631986385 2630968484 Bacteria 3876276
66 2644703168 2643221729 Bacteria 6621700
67 2644711890 2643221730 Bacteria 6523787
68 2644719637 2643221731 Bacteria 5623886
69 2644721909 2643221732 Bacteria 5756404
70 2644738721 2643221735 Bacteria 3676263
71 2651530914 2648501850 Bacteria 3975476
72 2651531188 2648501850 Bacteria 3975476
73 2651531744 2648501850 Bacteria 3975476
74 2674418800 2671180844 Bacteria 4164150
75 2674421472 2671180844 Bacteria 4164150
76 2674421779 2671180844 Bacteria 4164150
77 2686998616 2684623153 Bacteria 3878815
78 2687499896 2687453109 Bacteria 3860091
79 2695628371 2695420354 Bacteria 3922431
80 2695629251 2695420354 Bacteria 3922431
81 2695629544 2695420354 Bacteria 3922431
82 2698325794 2695420987 Bacteria 6152737
83 2712199421 2711768088 Bacteria 3195027
84 2717914758 2716884898 Bacteria 3928789
85 2717915046 2716884898 Bacteria 3928789
86 2717915926 2716884898 Bacteria 3928789
87 2739232453 2738543010 Bacteria 5583595
88 2739232461 2738543010 Bacteria 5583595
89 2739233453 2738543010 Bacteria 5583595
90 2745168573 2744054657 Bacteria 5016802
91 2757567541 2757320391 Bacteria 4746095
92 2757567875 2757320391 Bacteria 4746095
93 2777761109 2775507177 Bacteria 4384303
94 2808870519 2808606364 Bacteria 4465927
95 2809053639 2808606399 Bacteria 4021018
96 2809054551 2808606399 Bacteria 4021018
97 2809055130 2808606399 Bacteria 4021018
98 2812313806 2811994870 Bacteria 3776934
99 2816864455 2816332186 Bacteria 5331395
100 2817480180 2816332295 Bacteria 4352468
101 2817481896 2816332295 Bacteria 4352468
102 2817620954 2816332336 Bacteria 5207640
103 2819567988 2818991441 Bacteria 5062707
104 2819583559 2818991443 Bacteria 6598732
105 2819708378 2818991465 Bacteria 5388835
106 2819722814 2818991468 Bacteria 3723169
107 2823529835 2823526263 Bacteria 3765752
108 2842885610 2842882022 Bacteria 6158489
109 2857607469 2857604169 Bacteria 5111450
110 2860838079 2860837431 Bacteria 4202080
111 2860838728 2860837431 Bacteria 4202080
112 2860841308 2860837431 Bacteria 4202080
113 2865004890 2865002811 Bacteria 6333767
114 2877771265 2877768649 Bacteria 3957164
115 2877772186 2877768649 Bacteria 3957164
116 2877772473 2877768649 Bacteria 3957164
117 2880172132 2880169592 Bacteria 3900066
118 2880173024 2880169592 Bacteria 3900066
119 2880173324 2880169592 Bacteria 3900066
120 2897112346 2897109615 Bacteria 4009619
121 2897113302 2897109615 Bacteria 4009619
122 2897113597 2897109615 Bacteria 4009619
123 2904528040 2904524088 Bacteria 5887454
124 2904561625 2904560550 Bacteria 4029838
125 2904562220 2904560550 Bacteria 4029838
126 2904563187 2904560550 Bacteria 4029838
127 2908667092 2908665501 Bacteria 3678115
128 2919094892 2919093281 Bacteria 3660974
129 2919521154 2919517244 Bacteria 5858162
130 2919724138 2919720352 Bacteria 5986006
131 2919727468 2919726948 Bacteria 3696050
132 2929004997 2929004312 Bacteria 5678476
133 2936341158 2936340661 Bacteria 5139038
134 2936362853 2936361878 Bacteria 5632809
135 2938920892 2938917290 Bacteria 5914775
136 2939617714 2939615513 Bacteria 2384962
137 2954776736 2954773129 Bacteria 3741715
138 2956901188 2956897341 Bacteria 5447711
139 2960322299 2960319331 Bacteria 5502575
140 2960377963 2960375949 Bacteria 5361395
141 2962291415 2962290636 Bacteria 4072939
142 2962292147 2962290636 Bacteria 4072939
143 2962294539 2962290636 Bacteria 4072939
144 2965766535 2965761152 Bacteria 5806513
145 2965766545 2965761152 Bacteria 5806513
146 2969137499 2969136845 Bacteria 3923176
147 2969138125 2969136845 Bacteria 3923176
148 2969140477 2969136845 Bacteria 3923176
149 2969143717 2969141011 Bacteria 4118468
150 2969144742 2969141011 Bacteria 4118468
151 2969145056 2969141011 Bacteria 4118468
152 2969768090 2969765954 Bacteria 4216713
153 2969768711 2969765954 Bacteria 4216713
154 2969770014 2969765954 Bacteria 4216713
155 2969771049 2969770375 Bacteria 4271280
156 2969771919 2969770375 Bacteria 4271280
157 2969774868 2969770375 Bacteria 4271280
158 2971895929 2971893375 Bacteria 3929648
159 2971896866 2971893375 Bacteria 3929648
160 2971897170 2971893375 Bacteria 3929648
161 2977255690 2977254563 Bacteria 4828420
162 2980493254 2980492589 Bacteria 4072961
163 2980493920 2980492589 Bacteria 4072961
164 2980496305 2980492589 Bacteria 4072961
165 2990276488 2990275345 Bacteria 4887158
166 3001269324 3001267043 Bacteria 4823521
167 3001270935 3001267043 Bacteria 4823521
168 3001274708 3001272096 Bacteria 4729684
169 3006828291 3006826541 Bacteria 4678913
170 3006860520 3006858327 Bacteria 4317835
171 3006862326 3006858327 Bacteria 4317835
172 3006879554 3006879489 Bacteria 4064221
173 3006883010 3006879489 Bacteria 4064221
174 3006969324 3006969106 Bacteria 4739423
175 3006971511 3006969106 Bacteria 4739423
176 3006977013 3006973921 Bacteria 4423788
177 3006978482 3006973921 Bacteria 4423788
178 3006986762 3006984091 Bacteria 4207523
179 3006991294 3006988479 Bacteria 4767936
180 8022631330 8022630665 Bacteria 3886130
181 8022632006 8022630665 Bacteria 3886130
182 8022632693 8022630665 Bacteria 3886130
183 8022653732 8022653035 Bacteria 4035078
184 8022655959 8022653035 Bacteria 4035078
185 8022656735 8022653035 Bacteria 4035078
186 8022893984 8022893055 Bacteria 5300455
187 8022950465 8022948649 Bacteria 5366783
188 8051953910 8051952484 Bacteria 3926774
189 8051954202 8051952484 Bacteria 3926774
190 8051955163 8051952484 Bacteria 3926774
191 8052175715 8052174270 Bacteria 3881265
192 8052176026 8052174270 Bacteria 3881265
193 8052176192 8052174270 Bacteria 3881265
194 8054283593 8054280661 Bacteria 4232245
195 JGI25151J46595_10043345
196 JGI25151J46595_10000092
197 JGI25151J46595_10022703
198 JGI25151J46595_10030246
199 Ga0006562J51391_1000756
200 Ga0006562J51391_1003692
201 Ga0006562J51391_1075695
202 Ga0105251_10006833
203 Ga0105251_10008122
204 Ga0105251_10058265
205 Ga0105244_10035661
206 Ga0105244_10091352
207 Ga0105244_10140837
208 Ga0105250_10003578
209 Ga0209147_100014
210 Ga0209147_103889
211 Ga0209147_105605
212 Ga0209025_1000011
213 Ga0209025_1001453
214 Ga0209025_1003793
215 Ga0209025_1012042
216 Ga0209025_1013059
217 Ga0209025_1015971
218 Ga0209025_1023643
219 Ga0209025_1033640
220 Ga0209025_1040363
221 Ga0207696_1007322
222 Ga0207655_1031297
223 Ga0207713_1005544
224 Ga0307408_100174771
225 Ga0307416_100564150
226 Ga0466957_0103881
227 Ga0495605_0030109
228 Ga0495609_0023233
229 Ga0495622_0054459
230 Ga0495649_0111769
231 Ga0495660_0023025
232 Ga0496102_0004932
233 Ga0496103_0002845
234 Ga0496110_0381485
235 Ga0496113_0025640
236 Ga0496117_0000040
237 Ga0501305_006395
238 Ga0501312_004701
239 Ga0501217_044258
240 Ga0501233_035602
241 2511700379
242 2511701297
243 2511701590
244 2540605685
245 2540606339
246 2540608499
247 2545557078
248 2545557686
249 2545557989
250 2555468472
251 2556065069
252 2578931337
253 2578932075
254 2578932388
255 2595089549
256 2595090125
257 2631984631
258 2631986154
259 2631986385
260 2644703168
261 2644711890
262 2644719637
263 2644721909
264 2644738721
265 2651530914
266 2651531188
267 2651531744
268 2674418800
269 2674421472
270 2674421779
271 2686998616
272 2687499896
273 2695628371
274 2695629251
275 2695629544
276 2698325794
277 2712199421
278 2717914758
279 2717915046
280 2717915926
281 2739232453
282 2739232461
283 2739233453
284 2745168573
285 2757567541
286 2757567875
287 2777761109
288 2808870519
289 2809053639
290 2809054551
291 2809055130
292 2812313806
293 2816864455
294 2817480180
295 2817481896
296 2817620954
297 2819567988
298 2819583559
299 2819708378
300 2819722814
301 2823529835
302 2842885610
303 2857607469
304 2860838079
305 2860838728
306 2860841308
307 2865004890
308 2877771265
309 2877772186
310 2877772473
311 2880172132
312 2880173024
313 2880173324
314 2897112346
315 2897113302
316 2897113597
317 2904528040
318 2904561625
319 2904562220
320 2904563187
321 2908667092
322 2919094892
323 2919521154
324 2919724138
325 2919727468
326 2929004997
327 2936341158
328 2936362853
329 2938920892
330 2939617714
331 2954776736
332 2956901188
333 2960322299
334 2960377963
335 2962291415
336 2962292147
337 2962294539
338 2965766535
339 2965766545
340 2969137499
341 2969138125
342 2969140477
343 2969143717
344 2969144742
345 2969145056
346 2969768090
347 2969768711
348 2969770014
349 2969771049
350 2969771919
351 2969774868
352 2971895929
353 2971896866
354 2971897170
355 2977255690
356 2980493254
357 2980493920
358 2980496305
359 2990276488
360 3001269324
361 3001270935
362 3001274708
363 3006828291
364 3006860520
365 3006862326
366 3006879554
367 3006883010
368 3006969324
369 3006971511
370 3006977013
371 3006978482
372 3006986762
373 3006991294
374 8022631330
375 8022632006
376 8022632693
377 8022653732
378 8022655959
379 8022656735
380 8022893984
381 8022950465
382 8051953910
383 8051954202
384 8051955163
385 8052175715
386 8052176026
387 8052176192
388 8054283593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21621

MPI_cupin_dom

Mannose-6-phosphate isomerase, cupin domain

238

316

0.98

PF01238

PMI_typeI_C

Phosphomannose isomerase type I C-terminal

282

316

0.94

PF20511

PMI_typeI_cat

Phosphomannose isomerase type I, catalytic domain

6

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qwr-assembly2.cif.gz_B crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis 0.9854 3 316
1qwr-assembly2.cif.gz_B crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis 0.9823 3 316
4h7l-assembly1.cif.gz_A crystal structure of plim_4148 protein from planctomyces limnophilus 0.8901 80 190
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8374 252 313
1zx5-assembly1.cif.gz_A the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus 0.8327 2 315
ID Description Score Start End Superfamily
af_Q2G223_1_221_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9835 6 220 2.60.120.10
af_Q2FWB3_3_192_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9597 36 223 2.60.120.10
af_Q2G223_226_310_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 232 315 2.60.120.10
af_Q2FWB3_199_285_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9468 230 316 2.60.120.10
af_Q2FWB3_3_192_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.945 36 223 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7U7H1T9-F1-model_v4 deleted 0.9963 84 194
AF-A0A5S9MJ78-F1-model_v4 mannose-6-phosphate isomerase (EC 5.3.1.8) (Phosphohexomutase) (Phosphomannose isomerase) 0.9958 93 316 GO:0004476
GO:0005975
GO:0008270
AF-A0A6L7E7C1-F1-model_v4 deleted 0.9943 119 316
AF-A0A5S9MJ78-F1-model_v4 mannose-6-phosphate isomerase (EC 5.3.1.8) (Phosphohexomutase) (Phosphomannose isomerase) 0.9914 93 316 GO:0004476
GO:0005975
GO:0008270
AF-A0A6L7E7C1-F1-model_v4 deleted 0.9893 119 316

Map