F297783

General Info

Members Datasets Scaffolds Average Seq Length
193 94 386 177

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0592748|Ga0501072_0592748_42_656
Length 204
Sequence MTAQPSQAQSEATAVTQSRVGKKPIPLPKGVDFKLNGRTAAVKGSKGELTYDLPEGITVAIEDNEIVVSTAAGAGKRGRQFQGLTRALLAGMVKGVSEGYATSLDLVGVGYRAEIKGQDLTLALGLSHQVKYTMHKSVAARVEIIDEGGVKRPRLHLTSHDKAALGQTAARIRSFRPPEPYKGKGVRYTGEKLRVKAGKAGGKK

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
59 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0592748 3300049588 Bacteria 874
2 Ga0070680_100060809 3300005336 Bacteria 3091
3 Ga0070692_10006684 3300005345 Bacteria 5025
4 Ga0070714_100697807 3300005435 Bacteria 979
5 Ga0070713_100211307 3300005436 Bacteria 1757
6 Ga0070710_10229327 3300005437 Bacteria 1185
7 Ga0070701_10000503 3300005438 Bacteria 13404
8 Ga0070711_100004125 3300005439 Bacteria 8541
9 Ga0070705_100011997 3300005440 Bacteria 4390
10 Ga0070705_100021844 3300005440 Bacteria 3410
11 Ga0070705_100112472 3300005440 Bacteria 1742
12 Ga0070705_100602981 3300005440 Bacteria 850
13 Ga0070705_100621453 3300005440 Bacteria 839
14 Ga0070694_100006856 3300005444 Bacteria 6922
15 Ga0070694_100051254 3300005444 Bacteria 2785
16 Ga0070694_100223145 3300005444 Bacteria 1414
17 Ga0070708_100015288 3300005445 Bacteria 6334
18 Ga0070708_100140252 3300005445 Bacteria 2241
19 Ga0070708_100176515 3300005445 Bacteria 1996
20 Ga0070708_100384476 3300005445 Bacteria 1323
21 Ga0070708_100656817 3300005445 Bacteria 988
22 Ga0070681_11009798 3300005458 Unclassified 752
23 Ga0068867_100229841 3300005459 Bacteria 1499
24 Ga0070706_100031508 3300005467 Bacteria 4889
25 Ga0070706_100063594 3300005467 Bacteria 3410
26 Ga0070706_100300536 3300005467 Bacteria 1498
27 Ga0070706_100306105 3300005467 Bacteria 1482
28 Ga0070707_100073287 3300005468 Bacteria 3301
29 Ga0070707_100091075 3300005468 Bacteria 2952
30 Ga0070707_100401625 3300005468 Bacteria 1330
31 Ga0070707_100839852 3300005468 Bacteria 882
32 Ga0070698_100014184 3300005471 Bacteria 8423
33 Ga0070698_100500707 3300005471 Bacteria 1153
34 Ga0070698_100807053 3300005471 Bacteria 882
35 Ga0070698_101353755 3300005471 Bacteria 662
36 Ga0070699_100066286 3300005518 Bacteria 3134
37 Ga0070699_100074822 3300005518 Bacteria 2947
38 Ga0070699_100108281 3300005518 Bacteria 2439
39 Ga0070699_100168423 3300005518 Bacteria 1941
40 Ga0070699_100217638 3300005518 Bacteria 1702
41 Ga0070699_100499037 3300005518 Bacteria 1105
42 Ga0070699_100628833 3300005518 Bacteria 979
43 Ga0070699_100957426 3300005518 Bacteria 784
44 Ga0070697_100008562 3300005536 Bacteria 7989
45 Ga0070697_100026151 3300005536 Bacteria 4659
46 Ga0070697_100119841 3300005536 Bacteria 2200
47 Ga0070697_100295266 3300005536 Bacteria 1392
48 Ga0070697_100297367 3300005536 Bacteria 1387
49 Ga0070697_100537963 3300005536 Bacteria 1024
50 Ga0070697_100812647 3300005536 Bacteria 827
51 Ga0070695_100002446 3300005545 Bacteria 10679
52 Ga0070695_100121337 3300005545 Bacteria 1788
53 Ga0070695_100308402 3300005545 Bacteria 1172
54 Ga0070696_100007549 3300005546 Bacteria 7275
55 Ga0070696_100058258 3300005546 Bacteria 2697
56 Ga0070696_100217782 3300005546 Bacteria 1431
57 Ga0070704_100006456 3300005549 Bacteria 6911
58 Ga0070704_100013015 3300005549 Bacteria 5150
59 Ga0070704_100021619 3300005549 Bacteria 4175
60 Ga0070704_100092987 3300005549 Bacteria 2252
61 Ga0070704_100190695 3300005549 Bacteria 1647
62 Ga0068863_100830919 3300005841 Bacteria 922
63 Ga0081455_10003850 3300005937 Bacteria 17117
64 Ga0081455_10015866 3300005937 Bacteria 7294
65 Ga0081539_10033236 3300005985 Bacteria 3145
66 Ga0070716_100048840 3300006173 Bacteria 2394
67 Ga0075428_100052413 3300006844 Bacteria 4472
68 Ga0075431_100004690 3300006847 Bacteria 13429
69 Ga0075431_100387158 3300006847 Bacteria 1401
70 Ga0075433_10011016 3300006852 Bacteria 7272
71 Ga0075433_10247619 3300006852 Bacteria 1581
72 Ga0075433_10653494 3300006852 Bacteria 922
73 Ga0075433_10963313 3300006852 Bacteria 744
74 Ga0075434_100001309 3300006871 Bacteria 20777
75 Ga0075434_100013195 3300006871 Bacteria 7851
76 Ga0075434_101306826 3300006871 Bacteria 736
77 Ga0075436_100033319 3300006914 Bacteria 3551
78 Ga0075436_100305038 3300006914 Bacteria 1142
79 Ga0075436_100386534 3300006914 Bacteria 1012
80 Ga0075436_100671305 3300006914 Bacteria 766
81 Ga0075436_100945738 3300006914 Bacteria 645
82 Ga0075435_100160028 3300007076 Bacteria 1896
83 Ga0075435_100376705 3300007076 Unclassified 1219
84 Ga0075435_100390846 3300007076 Bacteria 1195
85 Ga0099794_10064551 3300007265 Bacteria 1784
86 Ga0111539_10067675 3300009094 Bacteria 4217
87 Ga0105245_10856018 3300009098 Bacteria 949
88 Ga0114129_10219902 3300009147 Bacteria 2563
89 Ga0114129_10228776 3300009147 Bacteria 2505
90 Ga0114129_10327087 3300009147 Bacteria 2036
91 Ga0114129_10622585 3300009147 Bacteria 1396
92 Ga0157370_10516276 3300013104 Unclassified 1097
93 Ga0157370_11060885 3300013104 Bacteria 733
94 Ga0163163_10078157 3300014325 Bacteria 3305
95 Ga0157379_10015737 3300014968 Bacteria 6647
96 Ga0213874_10166574 3300021377 Bacteria 777
97 Ga0213875_10002808 3300021388 Bacteria 10247
98 Ga0213875_10004565 3300021388 Bacteria 7562
99 Ga0213875_10011495 3300021388 Bacteria 4403
100 Ga0213875_10025282 3300021388 Bacteria 2829
101 Ga0213875_10045751 3300021388 Bacteria 2054
102 Ga0207653_10021089 3300025885 Bacteria 2066
103 Ga0207692_10303887 3300025898 Bacteria 972
104 Ga0207684_10008303 3300025910 Bacteria 9242
105 Ga0207684_10020184 3300025910 Bacteria 5690
106 Ga0207684_10659305 3300025910 Bacteria 891
107 Ga0207707_10349727 3300025912 Unclassified 1274
108 Ga0207663_10002687 3300025916 Bacteria 8578
109 Ga0207646_10001572 3300025922 Bacteria 27945
110 Ga0207646_10019177 3300025922 Bacteria 6359
111 Ga0207646_10254414 3300025922 Bacteria 1587
112 Ga0207700_10413846 3300025928 Bacteria 1183
113 Ga0207665_10008082 3300025939 Bacteria 6943
114 Ga0207665_10094429 3300025939 Bacteria 2077
115 Ga0209588_1086109 3300027671 Bacteria 1014
116 Ga0207428_10149226 3300027907 Bacteria 1780
117 Ga0265337_1088600 3300028556 Bacteria 844
118 Ga0265761_103884 3300030889 Bacteria 748
119 Ga0265330_10079148 3300031235 Bacteria 1417
120 Ga0265313_10071279 3300031595 Bacteria 1599
121 Ga0316592_1054042 3300033524 Bacteria 898
122 Ga0316588_1078659 3300033528 Bacteria 814
123 Ga0373926_0024344 3300035083 Bacteria 2108
124 Ga0373940_0006108 3300035088 Bacteria 2650
125 Ga0373942_0078623 3300035207 Bacteria 975
126 Ga0373927_0001798 3300035695 Bacteria 16005
127 Ga0373933_0069184 3300035724 Bacteria 2145
128 Ga0373947_0078423 3300035725 Bacteria 2039
129 Ga0373937_0018696 3300036401 Bacteria 6192
130 Ga0436364_0215257 3300037853 Unclassified 1024
131 Ga0436364_0252175 3300037853 Bacteria 2100
132 Ga0436364_0529458 3300037853 Bacteria 5764
133 Ga0436364_0811880 3300037853 Bacteria 852
134 Ga0436364_1103155 3300037853 Bacteria 1661
135 Ga0436364_1284711 3300037853 Bacteria 1701
136 Ga0436364_1316563 3300037853 Bacteria 5833
137 Ga0436365_0595762 3300039437 Unclassified 2069
138 Ga0436365_0696906 3300039437 Unclassified 3064
139 Ga0436365_1829692 3300039437 Bacteria 2465
140 Ga0436365_1929755 3300039437 Bacteria 5739
141 Ga0451577_0258675 3300042876 Bacteria 1576
142 Ga0451577_0471190 3300042876 Bacteria 1140
143 Ga0453683_0006082 3300044673 Bacteria 8316
144 Ga0453683_0234127 3300044673 Bacteria 1169
145 Ga0466963_0293086 3300044694 Bacteria 1144
146 Ga0451576_0025956 3300045051 Bacteria 6306
147 Ga0451576_0122682 3300045051 Bacteria 2705
148 Ga0451576_0493420 3300045051 Bacteria 1286
149 Ga0451576_0959390 3300045051 Bacteria 896
150 Ga0466958_0050425 3300045836 Bacteria 2520
151 Ga0495592_0621587 3300046454 Bacteria 657
152 Ga0495580_0269952 3300046472 Bacteria 1162
153 Ga0495630_0300109 3300046517 Bacteria 1227
154 Ga0495663_0086081 3300046525 Bacteria 1018
155 Ga0495663_0232004 3300046525 Bacteria 651
156 Ga0495640_0295046 3300046533 Bacteria 1008
157 Ga0495586_0194743 3300046535 Bacteria 1148
158 Ga0495622_0027787 3300046557 Bacteria 2640
159 Ga0495669_0096035 3300046684 Bacteria 1373
160 Ga0495669_0317561 3300046684 Bacteria 751
161 Ga0495674_0773997 3300047319 Bacteria 748
162 Ga0495680_0224638 3300047322 Bacteria 1339
163 Ga0495677_0051373 3300047445 Bacteria 1518
164 Ga0501076_0059622 3300049592 Bacteria 3036
165 Ga0501076_0138591 3300049592 Bacteria 1976
166 Ga0501077_0063949 3300049593 Bacteria 2334
167 Ga0501079_0146480 3300049741 Bacteria 1840
168 Ga0501079_1229462 3300049741 Bacteria 590
169 Ga0501080_0017337 3300049742 Bacteria 6658
170 Ga0501080_1187516 3300049742 Bacteria 656
171 Ga0501081_0011857 3300049743 Bacteria 5710
172 Ga0501081_0224120 3300049743 Bacteria 1368
173 nmdc:mga05p37_1602855_c1 3300050507 Bacteria 641
174 nmdc:mga05p37_1880_c1 3300050507 Bacteria 24467
175 nmdc:mga05p37_249728_c1 3300050507 Bacteria 2128
176 nmdc:mga06r32_6157_c1 3300050510 Bacteria 10771
177 nmdc:mga08y16_761513_c1 3300050511 Bacteria 964
178 nmdc:mga0n895_1677_c1 3300050512 Bacteria 16725
179 nmdc:mga0n895_471334_c1 3300050512 Bacteria 1267
180 nmdc:mga0n895_9435_c1 3300050512 Bacteria 6055
181 nmdc:mga0rr50_140028_c1 3300050513 Bacteria 1945
182 nmdc:mga0rr50_61694_c1 3300050513 Bacteria 2825
183 nmdc:mga08x19_20273_c1 3300050514 Bacteria 4095
184 nmdc:mga08x19_225572_c1 3300050514 Bacteria 1288
185 nmdc:mga08x19_45173_c1 3300050514 Bacteria 2815
186 nmdc:mga08x19_69270_c1 3300050514 Bacteria 2298
187 nmdc:mga08x19_71700_c1 3300050514 Bacteria 2259
188 nmdc:mga0a205_10030_c1 3300050515 Bacteria 8690
189 nmdc:mga0a205_1036882_c1 3300050515 Bacteria 667
190 nmdc:mga0a205_255594_c1 3300050515 Bacteria 1631
191 nmdc:mga0a205_42882_c1 3300050515 Bacteria 4361
192 nmdc:mga0a205_757057_c1 3300050515 Bacteria 820
193 Ga0501082_0150677 3300060353 Bacteria 2020
194 Ga0501072_0592748
195 Ga0070680_100060809
196 Ga0070692_10006684
197 Ga0070714_100697807
198 Ga0070713_100211307
199 Ga0070710_10229327
200 Ga0070701_10000503
201 Ga0070711_100004125
202 Ga0070705_100011997
203 Ga0070705_100021844
204 Ga0070705_100112472
205 Ga0070705_100602981
206 Ga0070705_100621453
207 Ga0070694_100006856
208 Ga0070694_100051254
209 Ga0070694_100223145
210 Ga0070708_100015288
211 Ga0070708_100140252
212 Ga0070708_100176515
213 Ga0070708_100384476
214 Ga0070708_100656817
215 Ga0070681_11009798
216 Ga0068867_100229841
217 Ga0070706_100031508
218 Ga0070706_100063594
219 Ga0070706_100300536
220 Ga0070706_100306105
221 Ga0070707_100073287
222 Ga0070707_100091075
223 Ga0070707_100401625
224 Ga0070707_100839852
225 Ga0070698_100014184
226 Ga0070698_100500707
227 Ga0070698_100807053
228 Ga0070698_101353755
229 Ga0070699_100066286
230 Ga0070699_100074822
231 Ga0070699_100108281
232 Ga0070699_100168423
233 Ga0070699_100217638
234 Ga0070699_100499037
235 Ga0070699_100628833
236 Ga0070699_100957426
237 Ga0070697_100008562
238 Ga0070697_100026151
239 Ga0070697_100119841
240 Ga0070697_100295266
241 Ga0070697_100297367
242 Ga0070697_100537963
243 Ga0070697_100812647
244 Ga0070695_100002446
245 Ga0070695_100121337
246 Ga0070695_100308402
247 Ga0070696_100007549
248 Ga0070696_100058258
249 Ga0070696_100217782
250 Ga0070704_100006456
251 Ga0070704_100013015
252 Ga0070704_100021619
253 Ga0070704_100092987
254 Ga0070704_100190695
255 Ga0068863_100830919
256 Ga0081455_10003850
257 Ga0081455_10015866
258 Ga0081539_10033236
259 Ga0070716_100048840
260 Ga0075428_100052413
261 Ga0075431_100004690
262 Ga0075431_100387158
263 Ga0075433_10011016
264 Ga0075433_10247619
265 Ga0075433_10653494
266 Ga0075433_10963313
267 Ga0075434_100001309
268 Ga0075434_100013195
269 Ga0075434_101306826
270 Ga0075436_100033319
271 Ga0075436_100305038
272 Ga0075436_100386534
273 Ga0075436_100671305
274 Ga0075436_100945738
275 Ga0075435_100160028
276 Ga0075435_100376705
277 Ga0075435_100390846
278 Ga0099794_10064551
279 Ga0111539_10067675
280 Ga0105245_10856018
281 Ga0114129_10219902
282 Ga0114129_10228776
283 Ga0114129_10327087
284 Ga0114129_10622585
285 Ga0157370_10516276
286 Ga0157370_11060885
287 Ga0163163_10078157
288 Ga0157379_10015737
289 Ga0213874_10166574
290 Ga0213875_10002808
291 Ga0213875_10004565
292 Ga0213875_10011495
293 Ga0213875_10025282
294 Ga0213875_10045751
295 Ga0207653_10021089
296 Ga0207692_10303887
297 Ga0207684_10008303
298 Ga0207684_10020184
299 Ga0207684_10659305
300 Ga0207707_10349727
301 Ga0207663_10002687
302 Ga0207646_10001572
303 Ga0207646_10019177
304 Ga0207646_10254414
305 Ga0207700_10413846
306 Ga0207665_10008082
307 Ga0207665_10094429
308 Ga0209588_1086109
309 Ga0207428_10149226
310 Ga0265337_1088600
311 Ga0265761_103884
312 Ga0265330_10079148
313 Ga0265313_10071279
314 Ga0316592_1054042
315 Ga0316588_1078659
316 Ga0373926_0024344
317 Ga0373940_0006108
318 Ga0373942_0078623
319 Ga0373927_0001798
320 Ga0373933_0069184
321 Ga0373947_0078423
322 Ga0373937_0018696
323 Ga0436364_0215257
324 Ga0436364_0252175
325 Ga0436364_0529458
326 Ga0436364_0811880
327 Ga0436364_1103155
328 Ga0436364_1284711
329 Ga0436364_1316563
330 Ga0436365_0595762
331 Ga0436365_0696906
332 Ga0436365_1829692
333 Ga0436365_1929755
334 Ga0451577_0258675
335 Ga0451577_0471190
336 Ga0453683_0006082
337 Ga0453683_0234127
338 Ga0466963_0293086
339 Ga0451576_0025956
340 Ga0451576_0122682
341 Ga0451576_0493420
342 Ga0451576_0959390
343 Ga0466958_0050425
344 Ga0495592_0621587
345 Ga0495580_0269952
346 Ga0495630_0300109
347 Ga0495663_0086081
348 Ga0495663_0232004
349 Ga0495640_0295046
350 Ga0495586_0194743
351 Ga0495622_0027787
352 Ga0495669_0096035
353 Ga0495669_0317561
354 Ga0495674_0773997
355 Ga0495680_0224638
356 Ga0495677_0051373
357 Ga0501076_0059622
358 Ga0501076_0138591
359 Ga0501077_0063949
360 Ga0501079_0146480
361 Ga0501079_1229462
362 Ga0501080_0017337
363 Ga0501080_1187516
364 Ga0501081_0011857
365 Ga0501081_0224120
366 nmdc:mga05p37_1602855_c1
367 nmdc:mga05p37_1880_c1
368 nmdc:mga05p37_249728_c1
369 nmdc:mga06r32_6157_c1
370 nmdc:mga08y16_761513_c1
371 nmdc:mga0n895_1677_c1
372 nmdc:mga0n895_471334_c1
373 nmdc:mga0n895_9435_c1
374 nmdc:mga0rr50_140028_c1
375 nmdc:mga0rr50_61694_c1
376 nmdc:mga08x19_20273_c1
377 nmdc:mga08x19_225572_c1
378 nmdc:mga08x19_45173_c1
379 nmdc:mga08x19_69270_c1
380 nmdc:mga08x19_71700_c1
381 nmdc:mga0a205_10030_c1
382 nmdc:mga0a205_1036882_c1
383 nmdc:mga0a205_255594_c1
384 nmdc:mga0a205_42882_c1
385 nmdc:mga0a205_757057_c1
386 Ga0501082_0150677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

27

99

0.92

PF00347

Ribosomal_L6

Ribosomal protein L6

107

189

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9706 1 162
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9634 1 163
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9594 1 164
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9594 1 164
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9569 3 164
ID Description Score Start End Superfamily
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9715 1 74 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9511 75 163 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.948 75 160 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9453 75 161 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9408 75 156 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2M6YAH1-F1-model_v4 50S ribosomal protein L6 0.9889 2 75 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9864 43 153 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9845 65 160
AF-A0A142GSU0-F1-model_v4 50S ribosomal protein L6 0.9816 2 132 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A257W4R2-F1-model_v4 deleted 0.9803 47 164

Map