F296372

General Info

Members Datasets Scaffolds Average Seq Length
192 174 78 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510065059|2510315090
Length 378
Sequence TVVGRSHDPCARVIPLRLKVDTDAIDPYVVRLRSFEGMPQPPDNCGFLDAALETADGETALFAGATGNLRVFGVDPSELDGDIVFVVPSRKTAHRLIRASSPHNTLLITERCDQLCVMCSQPPKKQHVNMFPFFETAVLLAPENSTIGLSGGEPTLFKSELFEFLRETMARRHDIDFHILTNAQHFGRADLAELRDLDLSRILWGVPVYSSAGAIHDQIVGKQGAFEQVRKNLSVLCEAGARIELRTVLMKPNAPGLLDLAKFVAVTLPFTDTWAIMQLENIGYGRQNWGSLFFDSSLGFDLVGKALDFAVSRGINTKLYNFPLCTVPADYRVFAPSTISDWKRAYVADCADCDLRNECGGFFEWHPKAHGYGRFGVA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
9 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
10 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
11 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
12 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
13 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
14 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
15 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
16 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
17 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
18 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
19 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
20 2791355262 Rhizobium sp. M1 Isolate Nodule
21 2791355263 Rhizobium chutanense C5 Isolate Nodule
22 2791355264 Rhizobium sp. S9 Isolate Nodule
23 2802429634 Rhizobium anhuiense S10 Isolate Nodule
24 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
25 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
26 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
27 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
28 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
29 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
30 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
31 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
32 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
33 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
34 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
35 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
36 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
37 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
38 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
39 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
40 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
41 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
42 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
43 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
44 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
45 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
46 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
47 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
48 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
49 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
50 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
51 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
52 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
53 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
54 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
55 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
56 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
57 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
58 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
59 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
60 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
61 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
62 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
63 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
64 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
65 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
66 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
67 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
68 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
69 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
70 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
71 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
72 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
73 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
74 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
75 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
76 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
77 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
78 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
79 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
80 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
81 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
82 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
83 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
84 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
85 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
86 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
87 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
88 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
89 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
90 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
91 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
92 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
93 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
94 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
95 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
96 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
97 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
98 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
99 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
100 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
101 2996887358 Rhizobium sp. R711 Isolate Nodule
102 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
103 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
104 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
105 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
106 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
109 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
117 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
121 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
135 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
144 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
166 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
167 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
168 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
169 8005321885 Rhizobium sp. R72 Isolate Nodule
170 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
171 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
172 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
173 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
174 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.62
Metatranscriptomes 0
Isolates 59.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 59.38
Rhizoplane 0.52
Rhizosphere 15.1
Stem 0
Stem Tuber 0
Unclassified 15.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001144 3300003187 Bacteria 19232
2 JGI25153J46596_10000239 3300003215 Bacteria 46098
3 Ga0055526_1008128 3300003771 Bacteria 5288
4 Ga0055528_1000193 3300003790 Bacteria 51831
5 Ga0070670_100000133 3300005331 Bacteria 69691
6 Ga0068868_100000011 3300005338 Bacteria 117273
7 Ga0070675_100050717 3300005354 Bacteria 3408
8 Ga0070659_100000376 3300005366 Bacteria 33719
9 Ga0068859_100000269 3300005617 Bacteria 51775
10 Ga0068863_100002406 3300005841 Bacteria 18588
11 Ga0075434_100256020 3300006871 Bacteria 1769
12 Ga0097620_100000269 3300006931 Bacteria 51775
13 Ga0099826_10003232 3300006948 Bacteria 10984
14 Ga0123341_1000219 3300009765 Bacteria 29972
15 Ga0123341_1000269 3300009765 Bacteria 28468
16 Ga0123342_1005154 3300009766 Bacteria 19253
17 Ga0123342_1006738 3300009766 Bacteria 15725
18 Ga0123342_1007924 3300009766 Bacteria 13741
19 Ga0157373_10003723 3300013100 Bacteria 11532
20 Ga0157371_10000619 3300013102 Bacteria 42290
21 Ga0228711_1006958 3300022739 Bacteria 16593
22 Ga0228710_1007165 3300022740 Bacteria 16591
23 Ga0207425_1010450 3300025245 Bacteria 2258
24 Ga0209129_1000284 3300025258 Bacteria 48264
25 Ga0209673_1000025 3300025273 Bacteria 404572
26 Ga0209673_1031263 3300025273 Bacteria 1660
27 Ga0209025_1000058 3300025294 Bacteria 311398
28 Ga0209564_1000618 3300025295 Bacteria 54453
29 Ga0209758_1000565 3300025297 Bacteria 58312
30 Ga0209256_1000561 3300025299 Bacteria 53094
31 Ga0209256_1004002 3300025299 Bacteria 9653
32 Ga0207650_10000532 3300025925 Bacteria 31166
33 Ga0207659_10033326 3300025926 Bacteria 3544
34 Ga0207690_10000001 3300025932 Bacteria 807539
35 Ga0207690_10000002 3300025932 Bacteria 807473
36 Ga0207690_10000003 3300025932 Bacteria 783011
37 Ga0207690_10000004 3300025932 Bacteria 746138
38 Ga0207640_10474686 3300025981 Bacteria 1036
39 Ga0207641_10006395 3300026088 Bacteria 9932
40 Ga0209282_1002233 3300027666 Bacteria 11089
41 Ga0315914_1011033 3300031967 Bacteria 10992
42 Ga0307411_10200231 3300032005 Bacteria 1533
43 Ga0315913_1010036 3300033430 Bacteria 10993
44 Ga0315915_1011583 3300033464 Bacteria 9499
45 Ga0400490_23392 3300038726 Bacteria 2957
46 Ga0439465_0000783 3300041413 Bacteria 9911
47 Ga0451847_0066666 3300041503 Bacteria 23813
48 Ga0451849_0198375 3300041505 Bacteria 4185
49 Ga0451851_1193460 3300041507 Bacteria 3515
50 Ga0451855_1502023 3300041511 Bacteria 8375
51 Ga0495638_0001339 3300046460 Bacteria 22617
52 Ga0495583_0010775 3300046506 Bacteria 5300
53 Ga0495606_0034920 3300046507 Bacteria 3444
54 Ga0496116_0000309 3300048919 Bacteria 81667
55 Ga0496116_0000649 3300048919 Bacteria 45467
56 Ga0496116_0052429 3300048919 Bacteria 2703
57 Ga0496116_0058308 3300048919 Bacteria 2518
58 Ga0496117_0001285 3300048920 Bacteria 37005
59 Ga0496121_0000115 3300048924 Bacteria 178411
60 Ga0496121_0197596 3300048924 Bacteria 1436
61 Ga0496122_0000996 3300048925 Bacteria 50450
62 Ga0496123_0000337 3300048926 Bacteria 88727
63 Ga0496123_0002621 3300048926 Bacteria 21796
64 Ga0496124_0000184 3300048927 Bacteria 123894
65 Ga0496124_0002108 3300048927 Bacteria 26827
66 Ga0496124_0002774 3300048927 Bacteria 22252
67 Ga0496125_0000053 3300048928 Bacteria 279909
68 Ga0496125_0112779 3300048928 Bacteria 1963
69 Ga0496126_0100865 3300048929 Bacteria 2526
70 Ga0501034_0071698 3300049571 Bacteria 3474
71 Ga0501067_0043793 3300049583 Bacteria 2486
72 Ga0501077_0052916 3300049593 Bacteria 2577
73 Ga0500641_0105380 3300053096 Bacteria 1211
74 Ga0500560_000534 3300053107 Bacteria 5398
75 Ga0500618_000098 3300053125 Bacteria 71763
76 Ga0500616_0000606 3300053153 Bacteria 43378
77 Ga0500638_001656 3300053162 Bacteria 7201
78 Ga0500636_0027883 3300053177 Bacteria 3336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2965047637 2965055243 300
2 iso_pu_bacteria 2513237138 2513871910 303
3 3300025981 Ga0207640_10474686 Ga0207640_104746861 305
4 3300049583 Ga0501067_0043793 Ga0501067_0043793_12_1049 328
5 iso_pu_bacteria 2856320880 2856322002 333
6 3300013102 Ga0157371_10000619 Ga0157371_1000061928 335
7 3300048925 Ga0496122_0000996 Ga0496122_0000996_25279_26358 345
8 3300048926 Ga0496123_0000337 Ga0496123_0000337_78422_79501 345
9 3300049593 Ga0501077_0052916 Ga0501077_0052916_1213_2301 345
10 3300005841 Ga0068863_100002406 Ga0068863_10000240615 353
11 3300026088 Ga0207641_10006395 Ga0207641_1000639510 353
12 iso_pu_bacteria 2510917022 2511132588 356
13 iso_pu_bacteria 2524023209 2524462910 356
14 iso_pu_bacteria 2615840626 2616312649 356
15 iso_pu_bacteria 2775507266 2778177734 356
16 iso_pu_bacteria 2791355264 2793351155 356
17 iso_pu_bacteria 2838022645 2838026065 356
18 iso_pu_bacteria 2838029111 2838035139 356
19 iso_pu_bacteria 2842077413 2842083211 356
20 iso_pu_bacteria 2842198810 2842204135 356
21 iso_pu_bacteria 2842205361 2842211370 356
22 iso_pu_bacteria 2842278818 2842284824 356
23 iso_pu_bacteria 2842317721 2842324062 356
24 iso_pu_bacteria 2842357229 2842363037 356
25 iso_pu_bacteria 2842475841 2842481821 356
26 iso_pu_bacteria 2842482326 2842488922 356
27 iso_pu_bacteria 2842502639 2842508702 356
28 iso_pu_bacteria 2852387548 2852392613 356
29 iso_pu_bacteria 8005682033 8005687997 356
30 iso_pu_bacteria 8057575449 8057579187 356
31 iso_pu_bacteria 2513237084 2513573124 357
32 iso_pu_bacteria 2513237088 2513597551 357
33 iso_pu_bacteria 2515154113 2515639362 357
34 iso_pu_bacteria 2517093000 2517098055 357
35 iso_pu_bacteria 2693429784 2694638118 357
36 iso_pu_bacteria 2751185821 2753463222 357
37 iso_pu_bacteria 2802429634 2806055776 357
38 iso_pu_bacteria 2802429635 2806063765 357
39 iso_pu_bacteria 2838686498 2838690939 357
40 iso_pu_bacteria 2842110456 2842117202 357
41 iso_pu_bacteria 2842271015 2842275414 357
42 iso_pu_bacteria 2842311132 2842313422 357
43 iso_pu_bacteria 2856314179 2856320094 357
44 iso_pu_bacteria 2856328259 2856330767 357
45 iso_pu_bacteria 2856364286 2856371727 357
46 iso_pu_bacteria 2869271264 2869274168 357
47 iso_pu_bacteria 2869285874 2869289348 357
48 iso_pu_bacteria 2871429161 2871431416 357
49 iso_pu_bacteria 2874139085 2874139732 357
50 iso_pu_bacteria 2874146452 2874154552 357
51 iso_pu_bacteria 2874155637 2874161939 357
52 iso_pu_bacteria 2876399893 2876400403 357
53 iso_pu_bacteria 2876413966 2876420122 357
54 iso_pu_bacteria 2878745973 2878748020 357
55 iso_pu_bacteria 2878753008 2878756143 357
56 iso_pu_bacteria 2881861095 2881863875 357
57 iso_pu_bacteria 2881861095 2881864600 357
58 iso_pu_bacteria 2888343758 2888346232 357
59 iso_pu_bacteria 2903492973 2903493551 357
60 iso_pu_bacteria 2906308376 2906311638 357
61 iso_pu_bacteria 2906321335 2906323378 357
62 iso_pu_bacteria 2906414383 2906421127 357
63 iso_pu_bacteria 2924784321 2924784804 357
64 iso_pu_bacteria 2933586486 2933590117 357
65 iso_pu_bacteria 2937049772 2937053180 357
66 iso_pu_bacteria 2937813078 2937818544 357
67 iso_pu_bacteria 2937972304 2937972601 357
68 iso_pu_bacteria 2958034702 2958038566 357
69 iso_pu_bacteria 2958130278 2958133724 357
70 iso_pu_bacteria 2958144490 2958149445 357
71 iso_pu_bacteria 2958179912 2958183368 357
72 iso_pu_bacteria 2961077736 2961081335 357
73 iso_pu_bacteria 2961136820 2961138630 357
74 iso_pu_bacteria 2965025482 2965028069 357
75 iso_pu_bacteria 2965102966 2965103518 357
76 iso_pu_bacteria 2967693043 2967696798 357
77 iso_pu_bacteria 2968016561 2968023834 357
78 iso_pu_bacteria 2970040964 2970044204 357
79 iso_pu_bacteria 2970116247 2970119461 357
80 iso_pu_bacteria 2970129317 2970133096 357
81 iso_pu_bacteria 2970469710 2970469875 357
82 iso_pu_bacteria 2970547951 2970554943 357
83 iso_pu_bacteria 2977579622 2977583128 357
84 iso_pu_bacteria 2977821940 2977826086 357
85 iso_pu_bacteria 2977843712 2977850708 357
86 iso_pu_bacteria 2977864932 2977868269 357
87 iso_pu_bacteria 2977942078 2977949456 357
88 iso_pu_bacteria 2996348954 2996355058 357
89 iso_pu_bacteria 3004275668 3004281592 357
90 iso_pu_bacteria 8004374579 8004377733 357
91 iso_pu_bacteria 8004387939 8004391226 357
92 iso_pu_bacteria 8004640170 8004640379 357
93 iso_pu_bacteria 8004714634 8004716598 357
94 iso_pu_bacteria 8005430974 8005435471 357
95 iso_pu_bacteria 8057529695 8057533578 357
96 3300032005 Ga0307411_10200231 Ga0307411_102002312 358
97 3300048928 Ga0496125_0000053 Ga0496125_0000053_228631_229707 358
98 3300053096 Ga0500641_0105380 Ga0500641_0105380_34_1110 358
99 iso_pu_bacteria 2508501122 2509112382 358
100 iso_pu_bacteria 2513237144 2513908621 358
101 iso_pu_bacteria 2554235003 2554249197 358
102 iso_pu_bacteria 2585427634 2586004267 358
103 iso_pu_bacteria 2599185352 2600197745 358
104 iso_pu_bacteria 2718218232 2720613534 358
105 iso_pu_bacteria 2837678835 2837683293 358
106 iso_pu_bacteria 2899845264 2899846837 358
107 iso_pu_bacteria 2921257292 2921262701 358
108 iso_pu_bacteria 2933594066 2933598456 358
109 iso_pu_bacteria 2937023124 2937027835 358
110 iso_pu_bacteria 2937119839 2937125343 358
111 iso_pu_bacteria 2957382221 2957383923 358
112 iso_pu_bacteria 2957395598 2957400984 358
113 iso_pu_bacteria 2957402308 2957405264 358
114 iso_pu_bacteria 2960603979 2960604955 358
115 iso_pu_bacteria 2964615318 2964620827 358
116 iso_pu_bacteria 2967755722 2967760988 358
117 iso_pu_bacteria 2970102677 2970107363 358
118 3300049571 Ga0501034_0071698 Ga0501034_0071698_225_1304 359
119 iso_pu_bacteria 8005695170 8005699046 359
120 3300005338 Ga0068868_100000011 Ga0068868_10000001130 360
121 3300005354 Ga0070675_100050717 Ga0070675_1000507173 360
122 3300005366 Ga0070659_100000376 Ga0070659_10000037629 360
123 3300005617 Ga0068859_100000269 Ga0068859_10000026954 360
124 3300006931 Ga0097620_100000269 Ga0097620_10000026954 360
125 3300009766 Ga0123342_1007924 Ga0123342_10079247 360
126 3300025273 Ga0209673_1031263 Ga0209673_10312632 360
127 3300025926 Ga0207659_10033326 Ga0207659_100333263 360
128 3300025932 Ga0207690_10000001 Ga0207690_10000001589 360
129 3300025932 Ga0207690_10000002 Ga0207690_10000002589 360
130 3300025932 Ga0207690_10000003 Ga0207690_10000003589 360
131 3300025932 Ga0207690_10000004 Ga0207690_10000004589 360
132 3300041503 Ga0451847_0066666 Ga0451847_0066666_12576_13658 360
133 3300041505 Ga0451849_0198375 Ga0451849_0198375_2092_3174 360
134 3300041507 Ga0451851_1193460 Ga0451851_1193460_2349_3431 360
135 3300041511 Ga0451855_1502023 Ga0451855_1502023_999_2081 360
136 3300046507 Ga0495606_0034920 Ga0495606_0034920_570_1652 360
137 3300048927 Ga0496124_0002774 Ga0496124_0002774_17233_18315 360
138 iso_pu_bacteria 2791355259 2793318898 360
139 iso_pu_bacteria 2791355262 2793338026 360
140 iso_pu_bacteria 2791355263 2793345045 360
141 iso_pu_bacteria 2996887358 2996891077 360
142 iso_pu_bacteria 8005321885 8005325604 360
143 iso_pu_bacteria 8005430974 8005436536 360
144 3300005331 Ga0070670_100000133 Ga0070670_10000013316 361
145 3300006871 Ga0075434_100256020 Ga0075434_1002560201 361
146 3300009765 Ga0123341_1000219 Ga0123341_10002196 361
147 3300009766 Ga0123342_1005154 Ga0123342_100515411 361
148 3300025925 Ga0207650_10000532 Ga0207650_100005324 361
149 3300038726 Ga0400490_23392 Ga0400490_23392_1632_2744 361
150 3300041413 Ga0439465_0000783 Ga0439465_0000783_4565_5650 361
151 3300048926 Ga0496123_0002621 Ga0496123_0002621_8283_9389 361
152 3300048929 Ga0496126_0100865 Ga0496126_0100865_211_1296 361
153 3300053125 Ga0500618_000098 Ga0500618_000098_34334_35419 361
154 3300053153 Ga0500616_0000606 Ga0500616_0000606_2300_3385 361
155 iso_pu_bacteria 2510065059 2510315090 361
156 3300003187 JGI25151J46595_10001144 JGI25151J46595_1000114415 362
157 3300003215 JGI25153J46596_10000239 JGI25153J46596_1000023935 362
158 3300003771 Ga0055526_1008128 Ga0055526_10081287 362
159 3300003790 Ga0055528_1000193 Ga0055528_100019330 362
160 3300006948 Ga0099826_10003232 Ga0099826_100032324 362
161 3300009765 Ga0123341_1000269 Ga0123341_100026928 362
162 3300009766 Ga0123342_1006738 Ga0123342_10067389 362
163 3300013100 Ga0157373_10003723 Ga0157373_1000372311 362
164 3300022739 Ga0228711_1006958 Ga0228711_100695814 362
165 3300022740 Ga0228710_1007165 Ga0228710_10071655 362
166 3300025245 Ga0207425_1010450 Ga0207425_10104502 362
167 3300025258 Ga0209129_1000284 Ga0209129_100028413 362
168 3300025273 Ga0209673_1000025 Ga0209673_1000025379 362
169 3300025294 Ga0209025_1000058 Ga0209025_1000058309 362
170 3300025295 Ga0209564_1000618 Ga0209564_100061830 362
171 3300025297 Ga0209758_1000565 Ga0209758_100056543 362
172 3300025299 Ga0209256_1000561 Ga0209256_100056130 362
173 3300025299 Ga0209256_1004002 Ga0209256_10040025 362
174 3300027666 Ga0209282_1002233 Ga0209282_10022335 362
175 3300031967 Ga0315914_1011033 Ga0315914_10110334 362
176 3300033430 Ga0315913_1010036 Ga0315913_10100369 362
177 3300033464 Ga0315915_1011583 Ga0315915_10115834 362
178 3300046460 Ga0495638_0001339 Ga0495638_0001339_5037_6125 362
179 3300046506 Ga0495583_0010775 Ga0495583_0010775_1132_2220 362
180 3300048919 Ga0496116_0000309 Ga0496116_0000309_15683_16771 362
181 3300048919 Ga0496116_0000649 Ga0496116_0000649_33250_34338 362
182 3300048919 Ga0496116_0052429 Ga0496116_0052429_1028_2116 362
183 3300048919 Ga0496116_0058308 Ga0496116_0058308_46_1134 362
184 3300048920 Ga0496117_0001285 Ga0496117_0001285_17358_18446 362
185 3300048924 Ga0496121_0000115 Ga0496121_0000115_25282_26370 362
186 3300048924 Ga0496121_0197596 Ga0496121_0197596_160_1248 362
187 3300048927 Ga0496124_0000184 Ga0496124_0000184_24882_25970 362
188 3300048927 Ga0496124_0002108 Ga0496124_0002108_18064_19152 362
189 3300048928 Ga0496125_0112779 Ga0496125_0112779_46_1134 362
190 3300053107 Ga0500560_000534 Ga0500560_000534_4099_5187 362
191 3300053162 Ga0500638_001656 Ga0500638_001656_3190_4278 362
192 3300053177 Ga0500636_0027883 Ga0500636_0027883_178_1266 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

106

264

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1q-assembly1.cif.gz_A crystal structure of streptococcus suis suib 0.7979 83 303
5vsm-assembly1.cif.gz_A crystal structure of viperin with bound [4fe-4s] cluster, 5'-deoxyadenosine, and l-methionine 0.7713 87 304
6b4c-assembly9.cif.gz_I structure of viperin from trichoderma virens 0.7704 85 307
6b4c-assembly5.cif.gz_E structure of viperin from trichoderma virens 0.7697 85 307
5v1s-assembly2.cif.gz_B crystal structure of streptococcus suis suib bound to s-adenosylmethionine 0.7693 83 304
ID Description Score Start End Superfamily
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7828 82 302 3.20.20.70
af_B9FW77_1_53_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7674 34 60 3.30.160.20
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7647 85 296 3.20.20.70
af_Q2FXH0_48_255_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.7647 126 275 3.80.30.20
af_Q2FX16_20_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7606 82 308 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4S0I5I4-F1-model_v4 deleted 0.9797 208 307
AF-A0A2N8N5J8-F1-model_v4 His-Xaa-Ser system radical SAM maturase HxsC 0.9772 156 362
AF-A0A4V3GTM9-F1-model_v4 deleted 0.9724 1 362
AF-A0A4S0I5I4-F1-model_v4 deleted 0.9702 208 307
AF-A0A4V3GTM9-F1-model_v4 deleted 0.9698 1 362

Feature Viewer

pLDDT pTM Quality
92.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map