F294492

General Info

Members Datasets Scaffolds Average Seq Length
191 65 190 68

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0000120|Ga0495603_0000120_2261_2464
Length 67
Sequence VDRYHLTLTLDGRPAMHGWWADEATAQGQFPGWVGSWGIPGARIVLVDELEQRELASWPDDPPQLRD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
3 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
4 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
5 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
6 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
7 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
8 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
9 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
10 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
11 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
12 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
13 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
14 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
15 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
16 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
17 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
18 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
19 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
20 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
21 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
22 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
23 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
24 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
25 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
26 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
27 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
28 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
29 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
30 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
31 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
32 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
33 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
34 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
35 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
36 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
37 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
38 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
39 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
40 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
41 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
42 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
43 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
44 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
45 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
46 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
47 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
48 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
49 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
50 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
51 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
52 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
53 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
54 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
55 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
56 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
57 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
58 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
59 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
62 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.24
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100797694 3300005468 Bacteria 908
2 Ga0105251_10143823 3300009011 Bacteria 1079
3 Ga0157375_12549560 3300013308 Bacteria 611
4 Ga0207646_10566342 3300025922 Bacteria 1021
5 Ga0395900_0527626 3300037418 Bacteria 1128
6 Ga0495592_0210452 3300046454 Bacteria 1306
7 Ga0495603_0000010 3300046455 Bacteria 69908
8 Ga0495603_0000120 3300046455 Bacteria 38417
9 Ga0495603_0000316 3300046455 Bacteria 25928
10 Ga0495603_0012885 3300046455 Bacteria 5056
11 Ga0495603_0036411 3300046455 Bacteria 2954
12 Ga0495603_0147188 3300046455 Bacteria 1369
13 Ga0495603_0243741 3300046455 Bacteria 1035
14 Ga0495629_0000069 3300046459 Bacteria 92199
15 Ga0495629_0008913 3300046459 Bacteria 7375
16 Ga0495629_0070647 3300046459 Bacteria 2436
17 Ga0495629_0091457 3300046459 Bacteria 2123
18 Ga0495629_0153682 3300046459 Bacteria 1599
19 Ga0495629_0785235 3300046459 Unclassified 629
20 Ga0495580_0498123 3300046472 Bacteria 813
21 Ga0495582_0000158 3300046473 Bacteria 36466
22 Ga0495582_0561715 3300046473 Bacteria 660
23 Ga0495605_0003017 3300046474 Bacteria 10158
24 Ga0495605_0155342 3300046474 Bacteria 1018
25 Ga0495605_0261590 3300046474 Bacteria 738
26 Ga0495605_0348841 3300046474 Bacteria 621
27 Ga0495639_0000730 3300046475 Bacteria 15054
28 Ga0495639_0002592 3300046475 Bacteria 7872
29 Ga0495639_0048199 3300046475 Bacteria 1931
30 Ga0495639_0048592 3300046475 Bacteria 1924
31 Ga0495639_0060880 3300046475 Bacteria 1730
32 Ga0495639_0089488 3300046475 Bacteria 1442
33 Ga0495639_0274194 3300046475 Bacteria 837
34 Ga0495639_0718530 3300046475 Unclassified 516
35 Ga0495662_0000514 3300046476 Bacteria 17652
36 Ga0495662_0050320 3300046476 Bacteria 2011
37 Ga0495662_0307195 3300046476 Bacteria 780
38 Ga0495585_0208173 3300046492 Bacteria 992
39 Ga0495585_0235940 3300046492 Bacteria 917
40 Ga0495585_0301247 3300046492 Bacteria 788
41 Ga0495585_0595442 3300046492 Bacteria 520
42 Ga0495594_0000024 3300046499 Bacteria 70334
43 Ga0495594_0000048 3300046499 Bacteria 52885
44 Ga0495594_0000059 3300046499 Bacteria 47935
45 Ga0495594_0001909 3300046499 Bacteria 10852
46 Ga0495594_0012942 3300046499 Bacteria 4350
47 Ga0495594_0034057 3300046499 Bacteria 2770
48 Ga0495594_0039061 3300046499 Bacteria 2593
49 Ga0495594_0194550 3300046499 Bacteria 1155
50 Ga0495594_0441530 3300046499 Unclassified 740
51 Ga0495594_0757203 3300046499 Bacteria 548
52 Ga0495607_0030943 3300046501 Bacteria 3280
53 Ga0495583_0000530 3300046506 Bacteria 54004
54 Ga0495583_0000677 3300046506 Bacteria 44272
55 Ga0495583_0016011 3300046506 Bacteria 4049
56 Ga0495583_0039595 3300046506 Bacteria 2219
57 Ga0495583_0100299 3300046506 Bacteria 1236
58 Ga0495610_0268482 3300046512 Bacteria 669
59 Ga0495628_0312025 3300046516 Bacteria 1162
60 Ga0495628_0961910 3300046516 Bacteria 589
61 Ga0495630_0123678 3300046517 Bacteria 1963
62 Ga0495631_0340276 3300046518 Bacteria 638
63 Ga0495643_0000687 3300046522 Bacteria 39232
64 Ga0495643_0085087 3300046522 Bacteria 1640
65 Ga0495648_0004072 3300046524 Bacteria 12611
66 Ga0495666_0000280 3300046526 Bacteria 22213
67 Ga0495642_0130666 3300046528 Bacteria 1081
68 Ga0495652_0354960 3300046529 Bacteria 1049
69 Ga0495640_0293314 3300046533 Bacteria 1011
70 Ga0495640_0516166 3300046533 Bacteria 726
71 Ga0495640_0598358 3300046533 Unclassified 666
72 Ga0495586_0000796 3300046535 Bacteria 18144
73 Ga0495587_0001296 3300046536 Bacteria 16606
74 Ga0495587_0104869 3300046536 Bacteria 1627
75 Ga0495622_0000099 3300046557 Bacteria 76538
76 Ga0495622_0000166 3300046557 Bacteria 54414
77 Ga0495622_0000176 3300046557 Bacteria 52189
78 Ga0495622_0000315 3300046557 Bacteria 35856
79 Ga0495622_0013543 3300046557 Bacteria 3782
80 Ga0495622_0097904 3300046557 Bacteria 1345
81 Ga0495633_0050484 3300046558 Bacteria 1961
82 Ga0495633_0106010 3300046558 Bacteria 1304
83 Ga0495656_0004712 3300046615 Bacteria 4688
84 Ga0495656_0111545 3300046615 Bacteria 1280
85 Ga0495668_0313525 3300046616 Unclassified 860
86 Ga0495634_0000983 3300046642 Bacteria 26856
87 Ga0495634_0003524 3300046642 Bacteria 12530
88 Ga0495634_0026055 3300046642 Bacteria 4083
89 Ga0495634_0254932 3300046642 Bacteria 1072
90 Ga0495634_0545382 3300046642 Bacteria 676
91 Ga0495611_0005582 3300046648 Bacteria 5367
92 Ga0495611_0142235 3300046648 Bacteria 1120
93 Ga0495611_0220459 3300046648 Bacteria 882
94 Ga0495625_0309615 3300046660 Bacteria 1008
95 Ga0495625_0351117 3300046660 Bacteria 932
96 Ga0495625_0653296 3300046660 Bacteria 626
97 Ga0495625_0879166 3300046660 Bacteria 515
98 Ga0495635_0121035 3300046663 Bacteria 1785
99 Ga0495588_0000234 3300046674 Bacteria 48733
100 Ga0495588_0001060 3300046674 Bacteria 11917
101 Ga0495588_0020213 3300046674 Bacteria 3269
102 Ga0495588_0750204 3300046674 Bacteria 510
103 Ga0495657_0006390 3300046675 Bacteria 9225
104 Ga0495657_0007593 3300046675 Bacteria 8362
105 Ga0495657_0011478 3300046675 Bacteria 6622
106 Ga0495599_0782534 3300046678 Bacteria 546
107 Ga0495669_0000534 3300046684 Bacteria 17138
108 Ga0495613_0000140 3300046689 Bacteria 72331
109 Ga0495613_0003149 3300046689 Bacteria 12359
110 Ga0495613_0011171 3300046689 Bacteria 6668
111 Ga0495613_0128565 3300046689 Bacteria 1815
112 Ga0495670_0033808 3300046691 Bacteria 2545
113 Ga0495670_0130190 3300046691 Bacteria 1311
114 Ga0495670_0535885 3300046691 Bacteria 637
115 Ga0495670_0591993 3300046691 Bacteria 604
116 Ga0495589_0008864 3300046794 Bacteria 5232
117 Ga0495589_0091485 3300046794 Bacteria 1477
118 Ga0495589_0144634 3300046794 Bacteria 1137
119 Ga0495589_0175422 3300046794 Bacteria 1018
120 Ga0495600_0000056 3300046809 Bacteria 68909
121 Ga0495600_0032957 3300046809 Bacteria 3362
122 Ga0495600_0058375 3300046809 Bacteria 2521
123 Ga0495600_0412496 3300046809 Bacteria 839
124 Ga0495600_0829244 3300046809 Unclassified 549
125 Ga0495600_0894058 3300046809 Bacteria 524
126 Ga0495581_0000002 3300047315 Bacteria 93443
127 Ga0495581_0000068 3300047315 Bacteria 40411
128 Ga0495581_0000080 3300047315 Bacteria 38435
129 Ga0495581_0000165 3300047315 Bacteria 29613
130 Ga0495581_0000349 3300047315 Bacteria 22969
131 Ga0495581_0006596 3300047315 Bacteria 6723
132 Ga0495581_0145097 3300047315 Bacteria 1385
133 Ga0495581_0165216 3300047315 Bacteria 1294
134 Ga0495581_0457003 3300047315 Bacteria 743
135 Ga0495581_0473687 3300047315 Unclassified 729
136 Ga0495581_0809344 3300047315 Bacteria 537
137 Ga0495581_0829533 3300047315 Bacteria 530
138 Ga0495604_0099653 3300047317 Bacteria 2138
139 Ga0495636_0002148 3300047318 Bacteria 7573
140 Ga0495636_0010742 3300047318 Bacteria 3620
141 Ga0495636_0187194 3300047318 Bacteria 941
142 Ga0495676_0004279 3300047321 Bacteria 13025
143 Ga0495676_0143778 3300047321 Bacteria 1706
144 Ga0495680_0425084 3300047322 Unclassified 913
145 Ga0495683_0040350 3300047323 Bacteria 2358
146 Ga0495683_0089774 3300047323 Archaea 1490
147 Ga0495687_000218 3300047443 Bacteria 81306
148 Ga0495687_006993 3300047443 Bacteria 6771
149 Ga0495687_007895 3300047443 Bacteria 6186
150 Ga0495687_009568 3300047443 Bacteria 5402
151 Ga0495687_010162 3300047443 Bacteria 5182
152 Ga0495687_014272 3300047443 Bacteria 4095
153 Ga0495687_021308 3300047443 Bacteria 3139
154 Ga0495687_033994 3300047443 Bacteria 2308
155 Ga0495687_166394 3300047443 Bacteria 735
156 Ga0495687_241329 3300047443 Bacteria 545
157 Ga0495675_0002770 3300047444 Bacteria 10510
158 Ga0495675_0002831 3300047444 Bacteria 10391
159 Ga0495675_0436140 3300047444 Unclassified 759
160 Ga0495675_0526446 3300047444 Bacteria 676
161 Ga0495677_0016006 3300047445 Bacteria 2722
162 Ga0495677_0026063 3300047445 Bacteria 2122
163 Ga0495677_0132995 3300047445 Bacteria 952
164 Ga0495677_0139625 3300047445 Bacteria 930
165 Ga0495685_002380 3300047447 Bacteria 5888
166 Ga0495685_003145 3300047447 Bacteria 5234
167 Ga0495685_014137 3300047447 Bacteria 2710
168 Ga0495685_020097 3300047447 Bacteria 2294
169 Ga0495685_029316 3300047447 Bacteria 1892
170 Ga0495685_068287 3300047447 Bacteria 1193
171 Ga0495685_210357 3300047447 Bacteria 622
172 Ga0495681_0136380 3300047470 Bacteria 1040
173 Ga0495686_0036884 3300047472 Bacteria 3135
174 Ga0495593_0057546 3300047673 Bacteria 2041
175 Ga0495593_0094737 3300047673 Bacteria 1536
176 Ga0495593_0199130 3300047673 Bacteria 1007
177 Ga0495593_0608836 3300047673 Bacteria 548
178 Ga0495614_0197054 3300048089 Bacteria 910
179 Ga0495614_0209327 3300048089 Unclassified 884
180 Ga0495614_0606237 3300048089 Bacteria 526
181 Ga0496101_0729406 3300048904 Unclassified 782
182 Ga0496104_0016967 3300048907 Bacteria 6624
183 Ga0496104_0538910 3300048907 Bacteria 1078
184 Ga0496105_0000074 3300048908 Bacteria 75488
185 Ga0496105_0000618 3300048908 Bacteria 23823
186 Ga0496105_0141550 3300048908 Bacteria 1980
187 Ga0496106_0178443 3300048909 Bacteria 1685
188 Ga0496109_0192816 3300048912 Bacteria 1915
189 Ga0496109_0588159 3300048912 Unclassified 1049
190 Ga0496115_0737940 3300048918 Bacteria 771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_12549560 Ga0157375_125495603 63
2 3300046455 Ga0495603_0147188 Ga0495603_0147188_241_432 63
3 3300046459 Ga0495629_0070647 Ga0495629_0070647_954_1145 63
4 3300046459 Ga0495629_0785235 Ga0495629_0785235_189_380 63
5 3300046473 Ga0495582_0000158 Ga0495582_0000158_23252_23443 63
6 3300046473 Ga0495582_0561715 Ga0495582_0561715_124_315 63
7 3300046475 Ga0495639_0089488 Ga0495639_0089488_982_1173 63
8 3300046475 Ga0495639_0274194 Ga0495639_0274194_484_675 63
9 3300046499 Ga0495594_0000048 Ga0495594_0000048_17718_17909 63
10 3300046499 Ga0495594_0001909 Ga0495594_0001909_3082_3273 63
11 3300046518 Ga0495631_0340276 Ga0495631_0340276_172_363 63
12 3300046535 Ga0495586_0000796 Ga0495586_0000796_173_364 63
13 3300046536 Ga0495587_0001296 Ga0495587_0001296_5456_5647 63
14 3300046558 Ga0495633_0106010 Ga0495633_0106010_216_407 63
15 3300046615 Ga0495656_0111545 Ga0495656_0111545_146_337 63
16 3300046689 Ga0495613_0000140 Ga0495613_0000140_3634_3825 63
17 3300046689 Ga0495613_0128565 Ga0495613_0128565_1478_1669 63
18 3300046691 Ga0495670_0033808 Ga0495670_0033808_2072_2263 63
19 3300046691 Ga0495670_0591993 Ga0495670_0591993_321_512 63
20 3300046809 Ga0495600_0000056 Ga0495600_0000056_38931_39122 63
21 3300047315 Ga0495581_0000068 Ga0495581_0000068_2963_3154 63
22 3300047315 Ga0495581_0000165 Ga0495581_0000165_3632_3823 63
23 3300047315 Ga0495581_0457003 Ga0495581_0457003_147_338 63
24 3300047315 Ga0495581_0473687 Ga0495581_0473687_28_219 63
25 3300047318 Ga0495636_0010742 Ga0495636_0010742_2175_2366 63
26 3300047444 Ga0495675_0002770 Ga0495675_0002770_1092_1283 63
27 3300047444 Ga0495675_0002831 Ga0495675_0002831_6676_6867 63
28 3300047445 Ga0495677_0026063 Ga0495677_0026063_434_625 63
29 3300047447 Ga0495685_029316 Ga0495685_029316_1114_1311 63
30 3300047447 Ga0495685_210357 Ga0495685_210357_326_517 63
31 3300047673 Ga0495593_0057546 Ga0495593_0057546_1016_1207 63
32 3300009011 Ga0105251_10143823 Ga0105251_101438234 64
33 3300046455 Ga0495603_0000010 Ga0495603_0000010_64196_64390 64
34 3300046455 Ga0495603_0000010 Ga0495603_0000010_903_1097 64
35 3300046459 Ga0495629_0091457 Ga0495629_0091457_1819_2043 64
36 3300046459 Ga0495629_0153682 Ga0495629_0153682_503_718 64
37 3300046475 Ga0495639_0000730 Ga0495639_0000730_3417_3641 64
38 3300046475 Ga0495639_0002592 Ga0495639_0002592_6290_6505 64
39 3300046475 Ga0495639_0060880 Ga0495639_0060880_1411_1605 64
40 3300046475 Ga0495639_0718530 Ga0495639_0718530_280_474 64
41 3300046476 Ga0495662_0000514 Ga0495662_0000514_8399_8623 64
42 3300046499 Ga0495594_0034057 Ga0495594_0034057_412_606 64
43 3300046499 Ga0495594_0441530 Ga0495594_0441530_282_506 64
44 3300046517 Ga0495630_0123678 Ga0495630_0123678_798_1022 64
45 3300046533 Ga0495640_0598358 Ga0495640_0598358_72_296 64
46 3300046536 Ga0495587_0104869 Ga0495587_0104869_34_258 64
47 3300046557 Ga0495622_0097904 Ga0495622_0097904_450_644 64
48 3300046615 Ga0495656_0004712 Ga0495656_0004712_94_288 64
49 3300046642 Ga0495634_0000983 Ga0495634_0000983_2445_2669 64
50 3300046663 Ga0495635_0121035 Ga0495635_0121035_971_1195 64
51 3300046674 Ga0495588_0001060 Ga0495588_0001060_2669_2884 64
52 3300046674 Ga0495588_0020213 Ga0495588_0020213_2362_2556 64
53 3300046674 Ga0495588_0750204 Ga0495588_0750204_302_496 64
54 3300046675 Ga0495657_0006390 Ga0495657_0006390_6938_7162 64
55 3300046675 Ga0495657_0007593 Ga0495657_0007593_7922_8146 64
56 3300046689 Ga0495613_0003149 Ga0495613_0003149_10414_10638 64
57 3300046809 Ga0495600_0829244 Ga0495600_0829244_40_264 64
58 3300047315 Ga0495581_0000002 Ga0495581_0000002_23234_23458 64
59 3300047315 Ga0495581_0006596 Ga0495581_0006596_4168_4362 64
60 3300047318 Ga0495636_0002148 Ga0495636_0002148_7275_7490 64
61 3300047318 Ga0495636_0187194 Ga0495636_0187194_422_616 64
62 3300047322 Ga0495680_0425084 Ga0495680_0425084_234_458 64
63 3300047444 Ga0495675_0436140 Ga0495675_0436140_115_339 64
64 3300047447 Ga0495685_002380 Ga0495685_002380_176_370 64
65 3300047447 Ga0495685_003145 Ga0495685_003145_1569_1763 64
66 3300048089 Ga0495614_0209327 Ga0495614_0209327_210_434 64
67 3300048908 Ga0496105_0141550 Ga0496105_0141550_1091_1285 64
68 3300048912 Ga0496109_0588159 Ga0496109_0588159_601_795 64
69 3300048918 Ga0496115_0737940 Ga0496115_0737940_560_754 64
70 3300037418 Ga0395900_0527626 Ga0395900_0527626_106_306 65
71 3300046475 Ga0495639_0048592 Ga0495639_0048592_1437_1646 65
72 3300046516 Ga0495628_0312025 Ga0495628_0312025_28_225 65
73 3300046648 Ga0495611_0142235 Ga0495611_0142235_364_561 65
74 3300047315 Ga0495581_0145097 Ga0495581_0145097_482_691 65
75 3300048089 Ga0495614_0606237 Ga0495614_0606237_294_491 65
76 3300048904 Ga0496101_0729406 Ga0496101_0729406_511_711 65
77 3300048907 Ga0496104_0016967 Ga0496104_0016967_4772_4972 65
78 3300048908 Ga0496105_0000618 Ga0496105_0000618_2030_2230 65
79 3300048912 Ga0496109_0192816 Ga0496109_0192816_693_893 65
80 3300046474 Ga0495605_0003017 Ga0495605_0003017_6236_6436 66
81 3300047443 Ga0495687_006993 Ga0495687_006993_1730_1930 66
82 3300047443 Ga0495687_010162 Ga0495687_010162_3744_3944 66
83 3300047673 Ga0495593_0094737 Ga0495593_0094737_547_747 66
84 3300046455 Ga0495603_0000120 Ga0495603_0000120_2261_2464 67
85 3300046475 Ga0495639_0048199 Ga0495639_0048199_860_1063 67
86 3300046557 Ga0495622_0000315 Ga0495622_0000315_33365_33568 67
87 3300046684 Ga0495669_0000534 Ga0495669_0000534_3476_3679 67
88 3300047315 Ga0495581_0000080 Ga0495581_0000080_2274_2477 67
89 3300046674 Ga0495588_0000234 Ga0495588_0000234_6634_6840 68
90 3300048909 Ga0496106_0178443 Ga0496106_0178443_837_1043 68
91 3300046492 Ga0495585_0595442 Ga0495585_0595442_202_414 69
92 3300046512 Ga0495610_0268482 Ga0495610_0268482_426_638 69
93 3300046691 Ga0495670_0130190 Ga0495670_0130190_287_499 69
94 3300047443 Ga0495687_033994 Ga0495687_033994_1738_1947 69
95 3300005468 Ga0070707_100797694 Ga0070707_1007976942 70
96 3300025922 Ga0207646_10566342 Ga0207646_105663422 70
97 3300046454 Ga0495592_0210452 Ga0495592_0210452_931_1143 70
98 3300046455 Ga0495603_0000316 Ga0495603_0000316_24860_25072 70
99 3300046455 Ga0495603_0012885 Ga0495603_0012885_1163_1375 70
100 3300046455 Ga0495603_0036411 Ga0495603_0036411_727_939 70
101 3300046455 Ga0495603_0243741 Ga0495603_0243741_101_313 70
102 3300046459 Ga0495629_0000069 Ga0495629_0000069_88792_89028 70
103 3300046459 Ga0495629_0008913 Ga0495629_0008913_2652_2864 70
104 3300046472 Ga0495580_0498123 Ga0495580_0498123_447_659 70
105 3300046474 Ga0495605_0155342 Ga0495605_0155342_124_336 70
106 3300046474 Ga0495605_0261590 Ga0495605_0261590_116_328 70
107 3300046474 Ga0495605_0348841 Ga0495605_0348841_184_396 70
108 3300046476 Ga0495662_0050320 Ga0495662_0050320_1373_1585 70
109 3300046476 Ga0495662_0307195 Ga0495662_0307195_409_621 70
110 3300046492 Ga0495585_0208173 Ga0495585_0208173_697_909 70
111 3300046492 Ga0495585_0235940 Ga0495585_0235940_547_759 70
112 3300046492 Ga0495585_0301247 Ga0495585_0301247_384_596 70
113 3300046499 Ga0495594_0000024 Ga0495594_0000024_39081_39293 70
114 3300046499 Ga0495594_0000059 Ga0495594_0000059_18137_18349 70
115 3300046499 Ga0495594_0012942 Ga0495594_0012942_3002_3214 70
116 3300046499 Ga0495594_0039061 Ga0495594_0039061_918_1130 70
117 3300046499 Ga0495594_0194550 Ga0495594_0194550_675_887 70
118 3300046499 Ga0495594_0757203 Ga0495594_0757203_193_405 70
119 3300046501 Ga0495607_0030943 Ga0495607_0030943_1920_2132 70
120 3300046506 Ga0495583_0000530 Ga0495583_0000530_43405_43617 70
121 3300046506 Ga0495583_0000677 Ga0495583_0000677_6872_7084 70
122 3300046506 Ga0495583_0016011 Ga0495583_0016011_1421_1633 70
123 3300046506 Ga0495583_0039595 Ga0495583_0039595_294_506 70
124 3300046506 Ga0495583_0100299 Ga0495583_0100299_457_675 70
125 3300046516 Ga0495628_0961910 Ga0495628_0961910_97_309 70
126 3300046522 Ga0495643_0000687 Ga0495643_0000687_37313_37525 70
127 3300046522 Ga0495643_0085087 Ga0495643_0085087_256_468 70
128 3300046524 Ga0495648_0004072 Ga0495648_0004072_489_701 70
129 3300046526 Ga0495666_0000280 Ga0495666_0000280_19391_19603 70
130 3300046528 Ga0495642_0130666 Ga0495642_0130666_493_705 70
131 3300046529 Ga0495652_0354960 Ga0495652_0354960_138_350 70
132 3300046533 Ga0495640_0293314 Ga0495640_0293314_199_411 70
133 3300046533 Ga0495640_0516166 Ga0495640_0516166_285_497 70
134 3300046557 Ga0495622_0000099 Ga0495622_0000099_66155_66367 70
135 3300046557 Ga0495622_0000166 Ga0495622_0000166_30836_31048 70
136 3300046557 Ga0495622_0000176 Ga0495622_0000176_51220_51432 70
137 3300046557 Ga0495622_0013543 Ga0495622_0013543_2728_2940 70
138 3300046558 Ga0495633_0050484 Ga0495633_0050484_1362_1574 70
139 3300046616 Ga0495668_0313525 Ga0495668_0313525_268_480 70
140 3300046642 Ga0495634_0003524 Ga0495634_0003524_10278_10490 70
141 3300046642 Ga0495634_0026055 Ga0495634_0026055_2621_2833 70
142 3300046642 Ga0495634_0254932 Ga0495634_0254932_512_724 70
143 3300046642 Ga0495634_0545382 Ga0495634_0545382_264_476 70
144 3300046648 Ga0495611_0005582 Ga0495611_0005582_2585_2797 70
145 3300046648 Ga0495611_0220459 Ga0495611_0220459_382_594 70
146 3300046660 Ga0495625_0309615 Ga0495625_0309615_337_549 70
147 3300046660 Ga0495625_0351117 Ga0495625_0351117_693_905 70
148 3300046660 Ga0495625_0653296 Ga0495625_0653296_71_283 70
149 3300046660 Ga0495625_0879166 Ga0495625_0879166_247_459 70
150 3300046675 Ga0495657_0011478 Ga0495657_0011478_801_1013 70
151 3300046678 Ga0495599_0782534 Ga0495599_0782534_246_458 70
152 3300046689 Ga0495613_0011171 Ga0495613_0011171_3149_3361 70
153 3300046691 Ga0495670_0535885 Ga0495670_0535885_358_570 70
154 3300046794 Ga0495589_0008864 Ga0495589_0008864_2581_2793 70
155 3300046794 Ga0495589_0091485 Ga0495589_0091485_1048_1260 70
156 3300046794 Ga0495589_0144634 Ga0495589_0144634_901_1113 70
157 3300046794 Ga0495589_0175422 Ga0495589_0175422_674_886 70
158 3300046809 Ga0495600_0032957 Ga0495600_0032957_430_642 70
159 3300046809 Ga0495600_0058375 Ga0495600_0058375_952_1164 70
160 3300046809 Ga0495600_0412496 Ga0495600_0412496_379_591 70
161 3300046809 Ga0495600_0894058 Ga0495600_0894058_84_296 70
162 3300047315 Ga0495581_0000349 Ga0495581_0000349_11849_12061 70
163 3300047315 Ga0495581_0165216 Ga0495581_0165216_681_893 70
164 3300047315 Ga0495581_0809344 Ga0495581_0809344_163_375 70
165 3300047315 Ga0495581_0829533 Ga0495581_0829533_133_345 70
166 3300047317 Ga0495604_0099653 Ga0495604_0099653_947_1159 70
167 3300047321 Ga0495676_0004279 Ga0495676_0004279_301_513 70
168 3300047321 Ga0495676_0143778 Ga0495676_0143778_199_411 70
169 3300047323 Ga0495683_0040350 Ga0495683_0040350_1633_1845 70
170 3300047323 Ga0495683_0089774 Ga0495683_0089774_573_785 70
171 3300047443 Ga0495687_000218 Ga0495687_000218_34573_34785 70
172 3300047443 Ga0495687_007895 Ga0495687_007895_2057_2269 70
173 3300047443 Ga0495687_009568 Ga0495687_009568_2118_2330 70
174 3300047443 Ga0495687_014272 Ga0495687_014272_42_254 70
175 3300047443 Ga0495687_021308 Ga0495687_021308_1482_1694 70
176 3300047443 Ga0495687_166394 Ga0495687_166394_468_680 70
177 3300047443 Ga0495687_241329 Ga0495687_241329_184_396 70
178 3300047444 Ga0495675_0526446 Ga0495675_0526446_292_504 70
179 3300047445 Ga0495677_0016006 Ga0495677_0016006_1896_2108 70
180 3300047445 Ga0495677_0132995 Ga0495677_0132995_159_371 70
181 3300047445 Ga0495677_0139625 Ga0495677_0139625_549_761 70
182 3300047447 Ga0495685_014137 Ga0495685_014137_82_294 70
183 3300047447 Ga0495685_020097 Ga0495685_020097_1819_2031 70
184 3300047447 Ga0495685_068287 Ga0495685_068287_138_350 70
185 3300047470 Ga0495681_0136380 Ga0495681_0136380_455_667 70
186 3300047472 Ga0495686_0036884 Ga0495686_0036884_917_1129 70
187 3300047673 Ga0495593_0199130 Ga0495593_0199130_742_954 70
188 3300047673 Ga0495593_0608836 Ga0495593_0608836_41_253 70
189 3300048089 Ga0495614_0197054 Ga0495614_0197054_443_655 70
190 3300048907 Ga0496104_0538910 Ga0496104_0538910_852_1064 70
191 3300048908 Ga0496105_0000074 Ga0496105_0000074_12637_12849 70

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xpw-assembly1.cif.gz_A-2 structure of amphioxus igvj-c2 molecule 0.8965 5 21
5xpv-assembly1.cif.gz_B structure of the v domain of amphioxus igvj-c2 0.8953 5 21
4uv2-assembly2.cif.gz_O structure of the curli transport lipoprotein csgg in a non-lipidated, pre-pore conformation 0.8391 45 60
4q6z-assembly1.cif.gz_A lpob c-terminal domain from escherichia coli 0.8352 45 60
5yyl-assembly1.cif.gz_A-2 structure of major royal jelly protein 1 oligomer 0.8256 45 60
ID Description Score Start End Superfamily
af_Q4DEE7_304_559_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9859 46 60 2.130.10.10
af_Q8IKZ5_835_1005_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9646 46 60 2.130.10.10
af_A4HSZ0_212_427_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9275 46 60 2.130.10.10
af_Q19433_523_701_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9233 46 60 2.130.10.10
af_A9UL45_12_205_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9098 45 60 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A652LY72-F1-model_v4 deleted 0.9937 4 64
AF-A0A4R3BFT1-F1-model_v4 deleted 0.9887 5 62
AF-A0A1M6D787-F1-model_v4 Uncharacterized protein 0.9869 4 65
AF-A0A1H4NNI6-F1-model_v4 Uncharacterized protein 0.9848 5 65
AF-A0A510TQC0-F1-model_v4 Uncharacterized protein 0.9829 4 64

Feature Viewer

pLDDT pTM Quality
86.78 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map