F293924

General Info

Members Datasets Scaffolds Average Seq Length
191 121 382 302

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000824|Ga0105240_1000082433
Length 321
Sequence MPALNRRQFSISAASAISAALISQAYAAPEDVWGGPVVDCHHHLRRSRPDQPVDANIVHMDGCGVSNAMALARENSAEQIQGIEAKYPGRILGWFASADITKPEAEAQLTAAVKQGAIGLGELKFHVEASGPELRRMYALAADLSVPILVHFQEVPHTPTEGLFATGFKNFEAILKAYPKTRFIGHADAFWANISADYANQDAYPSGKIKPGGISDKLLSDYPNLFGDLAANSGNNALTRDPDFTPGFLKRHEAKLIFGSDCACTDGKGGGISQGGNPGASRLAGKCVARETLGVLKRTVSPASFRRLTWENAHNTYKLKA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 2.09
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 30.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000824 3300009093 Bacteria 56281
2 Ga0070658_10067419 3300005327 Bacteria 2924
3 Ga0070658_10108309 3300005327 Bacteria 2300
4 Ga0070683_100000003 3300005329 Bacteria 375084
5 Ga0070670_100043842 3300005331 Bacteria 3845
6 Ga0070680_100013459 3300005336 Bacteria 6371
7 Ga0070680_100245031 3300005336 Bacteria 1515
8 Ga0070660_100316055 3300005339 Unclassified 1282
9 Ga0070659_100011733 3300005366 Bacteria 6486
10 Ga0070714_100058294 3300005435 Bacteria 3308
11 Ga0070681_10092158 3300005458 Bacteria 2979
12 Ga0070679_100233180 3300005530 Bacteria 1800
13 Ga0070684_100000014 3300005535 Bacteria 158815
14 Ga0070665_100230680 3300005548 Unclassified 1851
15 Ga0070665_100322170 3300005548 Bacteria 1550
16 Ga0068855_100006171 3300005563 Bacteria 14613
17 Ga0068855_100080890 3300005563 Unclassified 3767
18 Ga0068855_100097156 3300005563 Bacteria 3393
19 Ga0070664_100139066 3300005564 Unclassified 2137
20 Ga0068856_100015788 3300005614 Bacteria 7302
21 Ga0068852_100183286 3300005616 Unclassified 1970
22 Ga0068859_100197730 3300005617 Unclassified 2095
23 Ga0068864_100275069 3300005618 Bacteria 1570
24 Ga0068863_100058528 3300005841 Unclassified 3646
25 Ga0068863_100589999 3300005841 Bacteria 1099
26 Ga0081455_10005349 3300005937 Bacteria 14101
27 Ga0075367_10015552 3300006178 Bacteria 4141
28 Ga0075366_10026565 3300006195 Bacteria 3392
29 Ga0097621_100046204 3300006237 Bacteria 3522
30 Ga0068871_100093267 3300006358 Bacteria 2512
31 Ga0075428_100001934 3300006844 Bacteria 22244
32 Ga0075428_100002027 3300006844 Bacteria 21847
33 Ga0075428_100088533 3300006844 Bacteria 3377
34 Ga0075428_100384112 3300006844 Bacteria 1505
35 Ga0075431_100047459 3300006847 Unclassified 4428
36 Ga0075431_100076935 3300006847 Bacteria 3444
37 Ga0075431_100095174 3300006847 Bacteria 3074
38 Ga0075431_100419847 3300006847 Bacteria 1337
39 Ga0075429_100059710 3300006880 Bacteria 3322
40 Ga0075429_100144542 3300006880 Bacteria 2082
41 Ga0097620_100197725 3300006931 Unclassified 2095
42 Ga0105240_10115392 3300009093 Bacteria 3242
43 Ga0105245_10815819 3300009098 Unclassified 971
44 Ga0114129_10195235 3300009147 Bacteria 2745
45 Ga0105243_10111534 3300009148 Unclassified 2290
46 Ga0105242_10050465 3300009176 Bacteria 3387
47 Ga0105242_10432842 3300009176 Bacteria 1236
48 Ga0105248_10030272 3300009177 Bacteria 6044
49 Ga0105248_10189844 3300009177 Bacteria 2315
50 Ga0105248_10294361 3300009177 Unclassified 1828
51 Ga0105237_10007153 3300009545 Bacteria 12264
52 Ga0105238_10021166 3300009551 Bacteria 6629
53 Ga0105238_10173510 3300009551 Bacteria 2132
54 Ga0105238_10442615 3300009551 Bacteria 1296
55 Ga0105249_10067441 3300009553 Bacteria 3296
56 Ga0105239_10257606 3300010375 Bacteria 1960
57 Ga0105239_10269834 3300010375 Bacteria 1913
58 Ga0105239_10373337 3300010375 Bacteria 1612
59 Ga0157371_10056908 3300013102 Unclassified 2773
60 Ga0157370_10002711 3300013104 Bacteria 21180
61 Ga0157370_10403526 3300013104 Bacteria 1258
62 Ga0157369_10045656 3300013105 Bacteria 4763
63 Ga0157369_10053783 3300013105 Bacteria 4349
64 Ga0157374_10016451 3300013296 Bacteria 6502
65 Ga0157374_10035463 3300013296 Bacteria 4564
66 Ga0157374_10636822 3300013296 Unclassified 1077
67 Ga0157378_10008872 3300013297 Bacteria 8750
68 Ga0157378_10230472 3300013297 Bacteria 1765
69 Ga0157372_10114711 3300013307 Unclassified 3088
70 Ga0157372_10166887 3300013307 Bacteria 2546
71 Ga0157372_10401400 3300013307 Bacteria 1597
72 Ga0163163_10204268 3300014325 Unclassified 2024
73 Ga0157379_10086432 3300014968 Unclassified 2812
74 Ga0157376_10074227 3300014969 Bacteria 2899
75 Ga0157376_10306580 3300014969 Bacteria 1505
76 Ga0157376_10362560 3300014969 Bacteria 1390
77 Ga0157376_10432967 3300014969 Bacteria 1279
78 Ga0207645_10172920 3300025907 Bacteria 1416
79 Ga0207705_10082393 3300025909 Bacteria 2346
80 Ga0207705_10107952 3300025909 Unclassified 2054
81 Ga0207695_10001611 3300025913 Bacteria 36602
82 Ga0207671_10035107 3300025914 Bacteria 3723
83 Ga0207681_10296894 3300025923 Bacteria 1277
84 Ga0207664_10059589 3300025929 Bacteria 3041
85 Ga0207664_10335701 3300025929 Bacteria 1336
86 Ga0207709_10071344 3300025935 Unclassified 2205
87 Ga0207704_10123285 3300025938 Bacteria 1778
88 Ga0207711_10109199 3300025941 Bacteria 2458
89 Ga0207661_10000014 3300025944 Bacteria 322246
90 Ga0207667_10052759 3300025949 Bacteria 4280
91 Ga0207667_10196735 3300025949 Bacteria 2068
92 Ga0207667_10206570 3300025949 Bacteria 2014
93 Ga0207667_10221319 3300025949 Bacteria 1939
94 Ga0207712_10148692 3300025961 Bacteria 1807
95 Ga0207639_10029953 3300026041 Bacteria 3989
96 Ga0207639_10282243 3300026041 Unclassified 1461
97 Ga0207678_10015378 3300026067 Bacteria 6729
98 Ga0207702_10059111 3300026078 Bacteria 3265
99 Ga0207641_10028212 3300026088 Unclassified 4637
100 Ga0207674_10332406 3300026116 Bacteria 1469
101 Ga0207675_100435950 3300026118 Unclassified 1296
102 Ga0207698_10015363 3300026142 Bacteria 5124
103 Ga0207698_10118960 3300026142 Bacteria 2232
104 Ga0207698_10131186 3300026142 Bacteria 2142
105 Ga0207698_10149983 3300026142 Unclassified 2022
106 Ga0207428_10009085 3300027907 Bacteria 8938
107 Ga0268264_10358482 3300028381 Bacteria 1390
108 Ga0265325_10074838 3300031241 Bacteria 1693
109 Ga0373934_0075792 3300035086 Bacteria 1348
110 Ga0373954_0019156 3300035118 Bacteria 3085
111 Ga0373956_0009445 3300035119 Bacteria 3970
112 Ga0373955_0035011 3300035172 Unclassified 2656
113 Ga0373931_0226970 3300035691 Unclassified 1127
114 Ga0373931_0327252 3300035691 Bacteria 954
115 Ga0373933_0056485 3300035724 Unclassified 2357
116 Ga0373937_0035433 3300036401 Bacteria 4542
117 Ga0373925_0187219 3300037068 Unclassified 1641
118 Ga0373925_0215874 3300037068 Unclassified 1530
119 Ga0436364_1169265 3300037853 Bacteria 5759
120 Ga0436364_1459160 3300037853 Bacteria 4643
121 Ga0436365_0227368 3300039437 Bacteria 1428
122 Ga0439435_0017695 3300042436 Unclassified 1805
123 Ga0466963_0413847 3300044694 Unclassified 951
124 Ga0451576_0068539 3300045051 Unclassified 3692
125 Ga0466967_0172326 3300045976 Bacteria 2037
126 Ga0466967_0330047 3300045976 Bacteria 1473
127 Ga0495629_0199591 3300046459 Unclassified 1383
128 Ga0495651_0106168 3300046462 Unclassified 2082
129 Ga0495651_0186117 3300046462 Bacteria 1465
130 Ga0495582_0086758 3300046473 Unclassified 1742
131 Ga0495662_0030993 3300046476 Unclassified 2582
132 Ga0495664_0095394 3300046477 Unclassified 1791
133 Ga0495608_0090204 3300046511 Unclassified 1983
134 Ga0495608_0133853 3300046511 Bacteria 1585
135 Ga0495618_0079342 3300046514 Bacteria 2094
136 Ga0495628_0020615 3300046516 Bacteria 5434
137 Ga0495628_0222104 3300046516 Unclassified 1419
138 Ga0495628_0319793 3300046516 Unclassified 1145
139 Ga0495630_0035321 3300046517 Unclassified 3736
140 Ga0495630_0057567 3300046517 Unclassified 2913
141 Ga0495666_0186994 3300046526 Unclassified 955
142 Ga0495665_0063125 3300046531 Bacteria 1956
143 Ga0495665_0075579 3300046531 Bacteria 1773
144 Ga0495665_0079528 3300046531 Bacteria 1725
145 Ga0495645_0014115 3300046543 Bacteria 5662
146 Ga0495645_0069818 3300046543 Unclassified 2536
147 Ga0495667_0035942 3300046559 Unclassified 3309
148 Ga0495667_0092825 3300046559 Bacteria 1954
149 Ga0495667_0097443 3300046559 Bacteria 1904
150 Ga0495635_0153433 3300046663 Unclassified 1568
151 Ga0495635_0164702 3300046663 Bacteria 1509
152 Ga0495657_0157782 3300046675 Unclassified 1405
153 Ga0495599_0008956 3300046678 Bacteria 6096
154 Ga0495623_0173458 3300046679 Unclassified 1258
155 Ga0495624_0115795 3300046690 Unclassified 1648
156 Ga0495600_0052267 3300046809 Unclassified 2668
157 Ga0495604_0030683 3300047317 Unclassified 4268
158 Ga0495604_0101267 3300047317 Bacteria 2116
159 Ga0495604_0278088 3300047317 Unclassified 1132
160 Ga0495674_0000685 3300047319 Bacteria 31942
161 Ga0495674_0019688 3300047319 Bacteria 6260
162 Ga0495674_0027486 3300047319 Bacteria 5200
163 Ga0495674_0071867 3300047319 Bacteria 2985
164 Ga0495675_0064633 3300047444 Unclassified 2314
165 Ga0495675_0239064 3300047444 Bacteria 1094
166 Ga0495675_0243102 3300047444 Unclassified 1083
167 Ga0495684_0001416 3300047471 Bacteria 19218
168 Ga0495684_0023346 3300047471 Bacteria 4755
169 Ga0495684_0199892 3300047471 Unclassified 1474
170 Ga0495684_0278421 3300047471 Bacteria 1208
171 Ga0495602_0208806 3300048088 Bacteria 1484
172 Ga0495602_0429590 3300048088 Unclassified 936
173 Ga0495614_0121113 3300048089 Unclassified 1154
174 Ga0496104_0381208 3300048907 Bacteria 1323
175 Ga0496109_0000069 3300048912 Bacteria 109077
176 Ga0496112_0009574 3300048915 Bacteria 8738
177 Ga0496115_0007253 3300048918 Bacteria 8148
178 Ga0501034_0030337 3300049571 Bacteria 5497
179 Ga0501250_005231 3300049680 Bacteria 1325
180 nmdc:mga03683_12441_c1 3300050489 Unclassified 3108
181 nmdc:mga06z11_5944_c1 3300050494 Bacteria 4931
182 nmdc:mga05p37_302057_c1 3300050507 Bacteria 1901
183 nmdc:mga05p37_51645_c1 3300050507 Bacteria 5055
184 nmdc:mga0qj67_22287_c1 3300050509 Unclassified 4865
185 nmdc:mga06r32_178594_c1 3300050510 Unclassified 2108
186 nmdc:mga06r32_256657_c1 3300050510 Bacteria 1736
187 nmdc:mga06r32_277531_c1 3300050510 Bacteria 1663
188 nmdc:mga08y16_192038_c1 3300050511 Bacteria 2118
189 nmdc:mga08y16_199324_c1 3300050511 Bacteria 2075
190 nmdc:mga0rr50_92783_c1 3300050513 Bacteria 2354
191 Ga0501082_0000147 3300060353 Bacteria 58883
192 Ga0105240_10000824
193 Ga0070658_10067419
194 Ga0070658_10108309
195 Ga0070683_100000003
196 Ga0070670_100043842
197 Ga0070680_100013459
198 Ga0070680_100245031
199 Ga0070660_100316055
200 Ga0070659_100011733
201 Ga0070714_100058294
202 Ga0070681_10092158
203 Ga0070679_100233180
204 Ga0070684_100000014
205 Ga0070665_100230680
206 Ga0070665_100322170
207 Ga0068855_100006171
208 Ga0068855_100080890
209 Ga0068855_100097156
210 Ga0070664_100139066
211 Ga0068856_100015788
212 Ga0068852_100183286
213 Ga0068859_100197730
214 Ga0068864_100275069
215 Ga0068863_100058528
216 Ga0068863_100589999
217 Ga0081455_10005349
218 Ga0075367_10015552
219 Ga0075366_10026565
220 Ga0097621_100046204
221 Ga0068871_100093267
222 Ga0075428_100001934
223 Ga0075428_100002027
224 Ga0075428_100088533
225 Ga0075428_100384112
226 Ga0075431_100047459
227 Ga0075431_100076935
228 Ga0075431_100095174
229 Ga0075431_100419847
230 Ga0075429_100059710
231 Ga0075429_100144542
232 Ga0097620_100197725
233 Ga0105240_10115392
234 Ga0105245_10815819
235 Ga0114129_10195235
236 Ga0105243_10111534
237 Ga0105242_10050465
238 Ga0105242_10432842
239 Ga0105248_10030272
240 Ga0105248_10189844
241 Ga0105248_10294361
242 Ga0105237_10007153
243 Ga0105238_10021166
244 Ga0105238_10173510
245 Ga0105238_10442615
246 Ga0105249_10067441
247 Ga0105239_10257606
248 Ga0105239_10269834
249 Ga0105239_10373337
250 Ga0157371_10056908
251 Ga0157370_10002711
252 Ga0157370_10403526
253 Ga0157369_10045656
254 Ga0157369_10053783
255 Ga0157374_10016451
256 Ga0157374_10035463
257 Ga0157374_10636822
258 Ga0157378_10008872
259 Ga0157378_10230472
260 Ga0157372_10114711
261 Ga0157372_10166887
262 Ga0157372_10401400
263 Ga0163163_10204268
264 Ga0157379_10086432
265 Ga0157376_10074227
266 Ga0157376_10306580
267 Ga0157376_10362560
268 Ga0157376_10432967
269 Ga0207645_10172920
270 Ga0207705_10082393
271 Ga0207705_10107952
272 Ga0207695_10001611
273 Ga0207671_10035107
274 Ga0207681_10296894
275 Ga0207664_10059589
276 Ga0207664_10335701
277 Ga0207709_10071344
278 Ga0207704_10123285
279 Ga0207711_10109199
280 Ga0207661_10000014
281 Ga0207667_10052759
282 Ga0207667_10196735
283 Ga0207667_10206570
284 Ga0207667_10221319
285 Ga0207712_10148692
286 Ga0207639_10029953
287 Ga0207639_10282243
288 Ga0207678_10015378
289 Ga0207702_10059111
290 Ga0207641_10028212
291 Ga0207674_10332406
292 Ga0207675_100435950
293 Ga0207698_10015363
294 Ga0207698_10118960
295 Ga0207698_10131186
296 Ga0207698_10149983
297 Ga0207428_10009085
298 Ga0268264_10358482
299 Ga0265325_10074838
300 Ga0373934_0075792
301 Ga0373954_0019156
302 Ga0373956_0009445
303 Ga0373955_0035011
304 Ga0373931_0226970
305 Ga0373931_0327252
306 Ga0373933_0056485
307 Ga0373937_0035433
308 Ga0373925_0187219
309 Ga0373925_0215874
310 Ga0436364_1169265
311 Ga0436364_1459160
312 Ga0436365_0227368
313 Ga0439435_0017695
314 Ga0466963_0413847
315 Ga0451576_0068539
316 Ga0466967_0172326
317 Ga0466967_0330047
318 Ga0495629_0199591
319 Ga0495651_0106168
320 Ga0495651_0186117
321 Ga0495582_0086758
322 Ga0495662_0030993
323 Ga0495664_0095394
324 Ga0495608_0090204
325 Ga0495608_0133853
326 Ga0495618_0079342
327 Ga0495628_0020615
328 Ga0495628_0222104
329 Ga0495628_0319793
330 Ga0495630_0035321
331 Ga0495630_0057567
332 Ga0495666_0186994
333 Ga0495665_0063125
334 Ga0495665_0075579
335 Ga0495665_0079528
336 Ga0495645_0014115
337 Ga0495645_0069818
338 Ga0495667_0035942
339 Ga0495667_0092825
340 Ga0495667_0097443
341 Ga0495635_0153433
342 Ga0495635_0164702
343 Ga0495657_0157782
344 Ga0495599_0008956
345 Ga0495623_0173458
346 Ga0495624_0115795
347 Ga0495600_0052267
348 Ga0495604_0030683
349 Ga0495604_0101267
350 Ga0495604_0278088
351 Ga0495674_0000685
352 Ga0495674_0019688
353 Ga0495674_0027486
354 Ga0495674_0071867
355 Ga0495675_0064633
356 Ga0495675_0239064
357 Ga0495675_0243102
358 Ga0495684_0001416
359 Ga0495684_0023346
360 Ga0495684_0199892
361 Ga0495684_0278421
362 Ga0495602_0208806
363 Ga0495602_0429590
364 Ga0495614_0121113
365 Ga0496104_0381208
366 Ga0496109_0000069
367 Ga0496112_0009574
368 Ga0496115_0007253
369 Ga0501034_0030337
370 Ga0501250_005231
371 nmdc:mga03683_12441_c1
372 nmdc:mga06z11_5944_c1
373 nmdc:mga05p37_302057_c1
374 nmdc:mga05p37_51645_c1
375 nmdc:mga0qj67_22287_c1
376 nmdc:mga06r32_178594_c1
377 nmdc:mga06r32_256657_c1
378 nmdc:mga06r32_277531_c1
379 nmdc:mga08y16_192038_c1
380 nmdc:mga08y16_199324_c1
381 nmdc:mga0rr50_92783_c1
382 Ga0501082_0000147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

38

187

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.6536 32 309
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.6426 32 309
1krm-assembly1.cif.gz_A crystal structure of bovine adenosine deaminase complexed with 6-hydroxyl-1,6-dihydropurine riboside 0.6282 43 172
2ola-assembly1.cif.gz_A crystal structure of o-succinylbenzoic acid synthetase from staphylococcus aureus, cubic crystal form 0.6226 34 173
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.6215 32 306
ID Description Score Start End Superfamily
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7076 39 307 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7062 42 310 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7044 32 308 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6994 32 308 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6745 31 307 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A831LXP0-F1-model_v4 Amidohydrolase 0.9785 15 309 GO:0016787
AF-A0A2U3LW58-F1-model_v4 Amidohydrolase 2 0.9776 33 310 GO:0016787
GO:0016829
AF-A0A2U3LW58-F1-model_v4 Amidohydrolase 2 0.9637 33 310 GO:0016787
GO:0016829
AF-A0A7X2TX44-F1-model_v4 Amidohydrolase 0.9387 16 307 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A533SF12-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9359 67 306 GO:0016787

Map