F292783

General Info

Members Datasets Scaffolds Average Seq Length
190 146 380 223

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0158996|Ga0373953_0158996_131_841
Length 236
Sequence MMAIDRPYATGSLVAYDSDSELSRSMTAAQKVESRSDRRKRRNRQALIEAGYQIMAEKGIDAATMSEISELADVGAGTVYNYFASKDELAMCVMEQVMDRLSQRIEAVTNSFTDPAQVYAFGIRNVMKAATTDQRWRWLLRRSEVIADAMYRVMGPYAIRDIRNAVAAGRYRVEDPELAWRQATHAIVGFSLAVCDKNILPHKIDEAVVNLLGMVGVDRTEAWEVAKRPCPELPGE

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
72 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
143 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
144 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
145 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
146 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.58
Nodule 1.05
Rhizoplane 10.53
Rhizosphere 72.63
Stem 0
Stem Tuber 0
Unclassified 16.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0158996 3300035117 Unclassified 971
2 Ga0070682_100170804 3300005337 Bacteria 1511
3 Ga0068868_100077095 3300005338 Bacteria 2666
4 Ga0070688_100240085 3300005365 Bacteria 1285
5 Ga0070713_100917155 3300005436 Unclassified 843
6 Ga0070663_100010179 3300005455 Bacteria 5853
7 Ga0070663_100471699 3300005455 Bacteria 1038
8 Ga0070662_100482421 3300005457 Bacteria 1032
9 Ga0070684_100161945 3300005535 Bacteria 2030
10 Ga0070686_100705320 3300005544 Bacteria 805
11 Ga0070665_100219733 3300005548 Bacteria 1900
12 Ga0070664_100440786 3300005564 Bacteria 1195
13 Ga0068860_100000631 3300005843 Bacteria 41527
14 Ga0070717_10108879 3300006028 Bacteria 2361
15 Ga0075365_10030366 3300006038 Bacteria 3461
16 Ga0075365_10165610 3300006038 Bacteria 1542
17 Ga0075363_100001671 3300006048 Bacteria 8579
18 Ga0075363_100029230 3300006048 Bacteria 2843
19 Ga0075364_10012159 3300006051 Bacteria 5255
20 Ga0075364_10023274 3300006051 Bacteria 3920
21 Ga0075367_10000322 3300006178 Bacteria 16929
22 Ga0075428_100119463 3300006844 Bacteria 2870
23 Ga0075430_100025502 3300006846 Bacteria 5029
24 Ga0075431_100013866 3300006847 Bacteria 8140
25 Ga0075429_100000329 3300006880 Bacteria 34260
26 Ga0111539_10011042 3300009094 Bacteria 11362
27 Ga0105245_10036500 3300009098 Bacteria 4366
28 Ga0105245_10387746 3300009098 Bacteria 1393
29 Ga0114129_10024318 3300009147 Bacteria 8583
30 Ga0105238_10107550 3300009551 Bacteria 2770
31 Ga0105249_10216878 3300009553 Bacteria 1881
32 Ga0105249_10433688 3300009553 Unclassified 1350
33 Ga0105246_10256982 3300011119 Bacteria 1389
34 Ga0105246_10869734 3300011119 Unclassified 806
35 Ga0163162_10688335 3300013306 Bacteria 1145
36 Ga0163162_11154893 3300013306 Unclassified 878
37 Ga0157375_10894506 3300013308 Bacteria 1032
38 Ga0163163_10506373 3300014325 Bacteria 1269
39 Ga0157380_10205326 3300014326 Bacteria 1751
40 Ga0157377_10043618 3300014745 Bacteria 2497
41 Ga0157376_10579726 3300014969 Bacteria 1114
42 Ga0157376_10806767 3300014969 Bacteria 951
43 Ga0213873_10000163 3300021358 Bacteria 12443
44 Ga0213876_10036885 3300021384 Bacteria 2579
45 Ga0209051_1003121 3300025303 Bacteria 11169
46 Ga0209051_1004498 3300025303 Bacteria 8563
47 Ga0207688_10141278 3300025901 Bacteria 1417
48 Ga0207688_10172847 3300025901 Bacteria 1285
49 Ga0207700_10242119 3300025928 Unclassified 1538
50 Ga0207706_10464952 3300025933 Bacteria 1093
51 Ga0207686_10157169 3300025934 Bacteria 1590
52 Ga0207711_10168922 3300025941 Bacteria 1984
53 Ga0207689_10269846 3300025942 Bacteria 1409
54 Ga0207661_10352433 3300025944 Bacteria 1328
55 Ga0207651_10551036 3300025960 Bacteria 1003
56 Ga0207712_10147824 3300025961 Bacteria 1811
57 Ga0207712_10283230 3300025961 Bacteria 1353
58 Ga0207712_10318665 3300025961 Bacteria 1282
59 Ga0207677_10107461 3300026023 Bacteria 2070
60 Ga0207639_10520023 3300026041 Bacteria 1090
61 Ga0207678_10073583 3300026067 Bacteria 2928
62 Ga0207698_10197440 3300026142 Bacteria 1799
63 Ga0207698_10466994 3300026142 Bacteria 1221
64 Ga0209371_1034092 3300027312 Bacteria 1081
65 Ga0209813_10003965 3300027866 Bacteria 3507
66 Ga0268266_10116739 3300028379 Bacteria 2371
67 Ga0268266_10215818 3300028379 Bacteria 1761
68 Ga0268264_10000269 3300028381 Bacteria 91321
69 Ga0268256_1038764 3300030500 Bacteria 1081
70 Ga0265340_10017323 3300031247 Bacteria 3725
71 Ga0265313_10050175 3300031595 Bacteria 2004
72 Ga0373954_0079557 3300035118 Unclassified 1565
73 Ga0373946_0256612 3300035171 Unclassified 854
74 Ga0373955_0123747 3300035172 Unclassified 1505
75 Ga0373935_0484084 3300035692 Unclassified 897
76 Ga0373933_0334434 3300035724 Unclassified 983
77 Ga0373947_0233238 3300035725 Bacteria 1213
78 Ga0373937_0561255 3300036401 Bacteria 1084
79 Ga0395900_0048075 3300037418 Bacteria 4394
80 Ga0395900_0260616 3300037418 Bacteria 1732
81 Ga0395898_0028024 3300037466 Bacteria 5648
82 Ga0395898_0266371 3300037466 Bacteria 1634
83 Ga0436364_1057552 3300037853 Bacteria 862
84 Ga0436365_1700074 3300039437 Bacteria 7719
85 Ga0436362_0686071 3300039453 Bacteria 7859
86 Ga0439461_0001624 3300041410 Bacteria 3489
87 Ga0439466_0000571 3300041411 Bacteria 13837
88 Ga0451789_0272062 3300041443 Bacteria 971
89 Ga0451793_1643545 3300041452 Bacteria 1278
90 Ga0451807_0689083 3300041486 Bacteria 900
91 Ga0451843_1067702 3300041509 Bacteria 4856
92 Ga0439431_0032672 3300041997 Bacteria 1298
93 Ga0439434_0007372 3300042435 Bacteria 3224
94 Ga0466969_0080300 3300044656 Bacteria 1558
95 Ga0466963_0146210 3300044694 Bacteria 1640
96 Ga0466957_0291607 3300044842 Bacteria 1094
97 Ga0466959_0022557 3300045049 Bacteria 4655
98 Ga0466967_0110137 3300045976 Bacteria 2529
99 Ga0466967_0515448 3300045976 Bacteria 1175
100 Ga0495651_0076063 3300046462 Bacteria 2544
101 Ga0495653_0128535 3300046463 Bacteria 1797
102 Ga0495608_0138011 3300046511 Bacteria 1557
103 Ga0495618_0048182 3300046514 Plasmid 2690
104 Ga0495628_0096214 3300046516 Unclassified 2287
105 Ga0495630_0278145 3300046517 Unclassified 1279
106 Ga0495652_0305665 3300046529 Unclassified 1154
107 Ga0495665_0244527 3300046531 Bacteria 924
108 Ga0495621_0069857 3300046539 Bacteria 1292
109 Ga0495645_0239677 3300046543 Unclassified 1211
110 Ga0495667_0358068 3300046559 Unclassified 921
111 Ga0495634_0079079 3300046642 Unclassified 2154
112 Ga0495625_0355859 3300046660 Bacteria 924
113 Ga0495635_0177495 3300046663 Unclassified 1448
114 Ga0495646_0201512 3300046680 Unclassified 1084
115 Ga0495624_0361168 3300046690 Unclassified 873
116 Ga0495604_0361554 3300047317 Unclassified 962
117 Ga0495674_0037301 3300047319 Bacteria 4367
118 Ga0495674_0440751 3300047319 Bacteria 1048
119 Ga0495672_0190932 3300047320 Bacteria 1030
120 Ga0495676_0365892 3300047321 Unclassified 962
121 Ga0495680_0228060 3300047322 Unclassified 1327
122 Ga0495675_0254423 3300047444 Unclassified 1054
123 Ga0495602_0408899 3300048088 Bacteria 966
124 Ga0496102_0083738 3300048905 Bacteria 2943
125 Ga0496104_0798324 3300048907 Unclassified 850
126 Ga0496105_0130532 3300048908 Bacteria 2071
127 Ga0496108_0016334 3300048911 Bacteria 6055
128 Ga0496108_0698165 3300048911 Unclassified 880
129 Ga0496109_0003655 3300048912 Bacteria 12851
130 Ga0496109_0057415 3300048912 Bacteria 3553
131 Ga0496109_0607382 3300048912 Bacteria 1030
132 Ga0496109_0799060 3300048912 Bacteria 881
133 Ga0496110_0008859 3300048913 Bacteria 8109
134 Ga0496111_0008081 3300048914 Bacteria 6948
135 Ga0496111_0341868 3300048914 Bacteria 1108
136 Ga0496112_0438867 3300048915 Bacteria 1244
137 Ga0496112_0640309 3300048915 Bacteria 993
138 Ga0496114_0317057 3300048917 Bacteria 1377
139 Ga0496114_0984256 3300048917 Bacteria 726
140 Ga0496115_0407431 3300048918 Bacteria 1103
141 Ga0496118_0001434 3300048921 Bacteria 35889
142 Ga0496121_0014637 3300048924 Bacteria 8298
143 Ga0501032_0001692 3300049569 Bacteria 17461
144 Ga0501032_0471415 3300049569 Bacteria 803
145 Ga0501034_0009374 3300049571 Bacteria 10255
146 Ga0501034_0010671 3300049571 Bacteria 9547
147 Ga0501034_0074733 3300049571 Bacteria 3396
148 Ga0501034_0400950 3300049571 Bacteria 1294
149 Ga0501036_0363911 3300049572 Bacteria 1207
150 Ga0501036_0487599 3300049572 Unclassified 1026
151 Ga0501037_0000196 3300049573 Bacteria 54903
152 Ga0501038_0002463 3300049574 Bacteria 17233
153 Ga0501038_0204011 3300049574 Bacteria 1585
154 Ga0501039_0000631 3300049575 Bacteria 25483
155 Ga0501043_0001264 3300049579 Bacteria 22214
156 Ga0501046_0559887 3300049580 Bacteria 814
157 Ga0501047_0557711 3300049581 Unclassified 969
158 Ga0501047_0604737 3300049581 Bacteria 918
159 Ga0501048_0503250 3300049582 Bacteria 869
160 Ga0501068_0141135 3300049584 Bacteria 1510
161 Ga0501070_0000427 3300049586 Bacteria 38281
162 Ga0501070_0806281 3300049586 Unclassified 737
163 Ga0501073_0014669 3300049589 Bacteria 5693
164 Ga0501073_0057795 3300049589 Bacteria 2711
165 Ga0501073_0102693 3300049589 Bacteria 1985
166 Ga0501073_0159331 3300049589 Unclassified 1564
167 Ga0501077_0140736 3300049593 Bacteria 1530
168 Ga0501077_0335579 3300049593 Bacteria 964
169 Ga0501044_0006180 3300049823 Bacteria 13235
170 Ga0501044_0146632 3300049823 Unclassified 2345
171 nmdc:mga03n38_174519_c1 3300050490 Bacteria 1097
172 nmdc:mga00v17_11236_c1 3300050491 Bacteria 4918
173 nmdc:mga00v17_20523_c1 3300050491 Bacteria 3786
174 nmdc:mga0yw44_158332_c1 3300050492 Bacteria 1481
175 nmdc:mga0yw44_20238_c1 3300050492 Bacteria 3688
176 nmdc:mga0yw44_225297_c1 3300050492 Bacteria 1243
177 nmdc:mga06z11_63195_c1 3300050494 Bacteria 1937
178 nmdc:mga04h51_121089_c1 3300050495 Bacteria 975
179 Ga0495612_0014011 3300053078 Plasmid 3229
180 Ga0495595_0018014 3300053084 Bacteria 3046
181 Ga0495619_0078858 3300053085 Bacteria 2214
182 Ga0500593_120378 3300053117 Bacteria 1064
183 Ga0500616_0016097 3300053153 Bacteria 4264
184 Ga0500616_0061217 3300053153 Bacteria 1949
185 Ga0500616_0217113 3300053153 Unclassified 836
186 2511093130 2510917013 Bacteria 9951648
187 2513714584 2513237104 Bacteria 10034502
188 2644486901 2643221687 Bacteria 6500351
189 2891971610 2891968417 Bacteria 5821697
190 8054559797 8054558443 Bacteria 5204801
191 Ga0373953_0158996
192 Ga0070682_100170804
193 Ga0068868_100077095
194 Ga0070688_100240085
195 Ga0070713_100917155
196 Ga0070663_100010179
197 Ga0070663_100471699
198 Ga0070662_100482421
199 Ga0070684_100161945
200 Ga0070686_100705320
201 Ga0070665_100219733
202 Ga0070664_100440786
203 Ga0068860_100000631
204 Ga0070717_10108879
205 Ga0075365_10030366
206 Ga0075365_10165610
207 Ga0075363_100001671
208 Ga0075363_100029230
209 Ga0075364_10012159
210 Ga0075364_10023274
211 Ga0075367_10000322
212 Ga0075428_100119463
213 Ga0075430_100025502
214 Ga0075431_100013866
215 Ga0075429_100000329
216 Ga0111539_10011042
217 Ga0105245_10036500
218 Ga0105245_10387746
219 Ga0114129_10024318
220 Ga0105238_10107550
221 Ga0105249_10216878
222 Ga0105249_10433688
223 Ga0105246_10256982
224 Ga0105246_10869734
225 Ga0163162_10688335
226 Ga0163162_11154893
227 Ga0157375_10894506
228 Ga0163163_10506373
229 Ga0157380_10205326
230 Ga0157377_10043618
231 Ga0157376_10579726
232 Ga0157376_10806767
233 Ga0213873_10000163
234 Ga0213876_10036885
235 Ga0209051_1003121
236 Ga0209051_1004498
237 Ga0207688_10141278
238 Ga0207688_10172847
239 Ga0207700_10242119
240 Ga0207706_10464952
241 Ga0207686_10157169
242 Ga0207711_10168922
243 Ga0207689_10269846
244 Ga0207661_10352433
245 Ga0207651_10551036
246 Ga0207712_10147824
247 Ga0207712_10283230
248 Ga0207712_10318665
249 Ga0207677_10107461
250 Ga0207639_10520023
251 Ga0207678_10073583
252 Ga0207698_10197440
253 Ga0207698_10466994
254 Ga0209371_1034092
255 Ga0209813_10003965
256 Ga0268266_10116739
257 Ga0268266_10215818
258 Ga0268264_10000269
259 Ga0268256_1038764
260 Ga0265340_10017323
261 Ga0265313_10050175
262 Ga0373954_0079557
263 Ga0373946_0256612
264 Ga0373955_0123747
265 Ga0373935_0484084
266 Ga0373933_0334434
267 Ga0373947_0233238
268 Ga0373937_0561255
269 Ga0395900_0048075
270 Ga0395900_0260616
271 Ga0395898_0028024
272 Ga0395898_0266371
273 Ga0436364_1057552
274 Ga0436365_1700074
275 Ga0436362_0686071
276 Ga0439461_0001624
277 Ga0439466_0000571
278 Ga0451789_0272062
279 Ga0451793_1643545
280 Ga0451807_0689083
281 Ga0451843_1067702
282 Ga0439431_0032672
283 Ga0439434_0007372
284 Ga0466969_0080300
285 Ga0466963_0146210
286 Ga0466957_0291607
287 Ga0466959_0022557
288 Ga0466967_0110137
289 Ga0466967_0515448
290 Ga0495651_0076063
291 Ga0495653_0128535
292 Ga0495608_0138011
293 Ga0495618_0048182
294 Ga0495628_0096214
295 Ga0495630_0278145
296 Ga0495652_0305665
297 Ga0495665_0244527
298 Ga0495621_0069857
299 Ga0495645_0239677
300 Ga0495667_0358068
301 Ga0495634_0079079
302 Ga0495625_0355859
303 Ga0495635_0177495
304 Ga0495646_0201512
305 Ga0495624_0361168
306 Ga0495604_0361554
307 Ga0495674_0037301
308 Ga0495674_0440751
309 Ga0495672_0190932
310 Ga0495676_0365892
311 Ga0495680_0228060
312 Ga0495675_0254423
313 Ga0495602_0408899
314 Ga0496102_0083738
315 Ga0496104_0798324
316 Ga0496105_0130532
317 Ga0496108_0016334
318 Ga0496108_0698165
319 Ga0496109_0003655
320 Ga0496109_0057415
321 Ga0496109_0607382
322 Ga0496109_0799060
323 Ga0496110_0008859
324 Ga0496111_0008081
325 Ga0496111_0341868
326 Ga0496112_0438867
327 Ga0496112_0640309
328 Ga0496114_0317057
329 Ga0496114_0984256
330 Ga0496115_0407431
331 Ga0496118_0001434
332 Ga0496121_0014637
333 Ga0501032_0001692
334 Ga0501032_0471415
335 Ga0501034_0009374
336 Ga0501034_0010671
337 Ga0501034_0074733
338 Ga0501034_0400950
339 Ga0501036_0363911
340 Ga0501036_0487599
341 Ga0501037_0000196
342 Ga0501038_0002463
343 Ga0501038_0204011
344 Ga0501039_0000631
345 Ga0501043_0001264
346 Ga0501046_0559887
347 Ga0501047_0557711
348 Ga0501047_0604737
349 Ga0501048_0503250
350 Ga0501068_0141135
351 Ga0501070_0000427
352 Ga0501070_0806281
353 Ga0501073_0014669
354 Ga0501073_0057795
355 Ga0501073_0102693
356 Ga0501073_0159331
357 Ga0501077_0140736
358 Ga0501077_0335579
359 Ga0501044_0006180
360 Ga0501044_0146632
361 nmdc:mga03n38_174519_c1
362 nmdc:mga00v17_11236_c1
363 nmdc:mga00v17_20523_c1
364 nmdc:mga0yw44_158332_c1
365 nmdc:mga0yw44_20238_c1
366 nmdc:mga0yw44_225297_c1
367 nmdc:mga06z11_63195_c1
368 nmdc:mga04h51_121089_c1
369 Ga0495612_0014011
370 Ga0495595_0018014
371 Ga0495619_0078858
372 Ga0500593_120378
373 Ga0500616_0016097
374 Ga0500616_0061217
375 Ga0500616_0217113
376 2511093130
377 2513714584
378 2644486901
379 2891971610
380 8054559797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

47

91

0.97

PF21306

TetR_C_40

Tetracyclin repressor-like, C-terminal domain

114

228

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ppb-assembly1.cif.gz_B crystal structure of a putative tetr family transcription regulator (shew_3104) from shewanella sp. pv-4 at 2.10 a resolution 0.8644 19 195
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8581 20 189
5gpc-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8471 19 189
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8453 21 189
3vib-assembly2.cif.gz_C structural basis for multidrug recognition and antimicrobial resistance by mtrr, an efflux pump regulator from neisseria gonorrhoeae 0.8374 16 192
ID Description Score Start End Superfamily
1t33B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8929 14 67 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8879 14 67 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.887 18 67 1.10.10.60
1jtxE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8855 19 65 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8835 18 67 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A8B4EGB1-F1-model_v4 deleted 0.9794 70 209
AF-A0A2T2YYJ3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9724 24 209 GO:0003677
GO:0006355
AF-A0A849AJL4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9697 11 210 GO:0003677
GO:0006355
AF-A0A2N3TZ75-F1-model_v4 deleted 0.967 54 207
AF-A0A417XT32-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9625 11 220 GO:0003677
GO:0006355

Map