F291760

General Info

Members Datasets Scaffolds Average Seq Length
189 152 378 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006486233|3006491814
Length 260
Sequence VHDVTLTYPDGESRLTALDKVCLEVAAGTVTAVVGPSGSGKSSLLAVAATLVTPDSGRVEVAGQDTTVLSPAEKAALRREKIGIVFQQSNLLASLTAAEQLQVMAHLSGRPSKALRRRALELLDAVGMADKADKRPHQLSGGQRQRVNIARALMNEPAVLLVDEPTSALDHERGASVLDLLVTLTRERATATVLVTHDRTHLERMDRTATMTDGRLTETAAVTDTAVGPAAAAGFAAGFVAGSAAPSAAPQPAGRADGAR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
37 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
45 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
46 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
47 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
48 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
49 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
50 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
53 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
59 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
60 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
65 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
66 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
67 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
68 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
103 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
104 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
105 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
106 2643221548 Streptomyces sp. Root55 Isolate Unclassified
107 2643221561 Nocardioides sp. Root151 Isolate Unclassified
108 2643221578 Streptomyces sp. Root63 Isolate Unclassified
109 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
110 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
111 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
112 2643221670 Streptomyces sp. Root431 Isolate Unclassified
113 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
114 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
115 2643221696 Nocardioides sp. Root140 Isolate Unclassified
116 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
117 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
118 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
119 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
120 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
121 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
122 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
123 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
124 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
125 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
126 2855683550 Micromonospora sp. RP3T Isolate Unclassified
127 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
128 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
129 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
130 2862574272 Streptomyces sp. AcE210 Isolate Nodule
131 2867475112 Streptomyces sp. TM32 Isolate Unclassified
132 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
133 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
134 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
135 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
136 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
137 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
138 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
139 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
140 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
141 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
142 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
143 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
144 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
145 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
146 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
147 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
148 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
149 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
150 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
151 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
152 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.49
Metatranscriptomes 0.53
Isolates 26.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0.53
Rhizoplane 3.17
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10048249 3300001979 Bacteria 1238
2 JGI24739J22299_10015937 3300001989 Bacteria 2726
3 JGI24737J22298_10006115 3300001990 Bacteria 4124
4 JGI24735J21928_10017445 3300002067 Bacteria 2220
5 JGI25160J50197_1024244 3300003354 Bacteria 1725
6 Ga0070667_100156609 3300005367 Bacteria 2004
7 Ga0070714_100008434 3300005435 Bacteria 8047
8 Ga0070713_100047686 3300005436 Bacteria 3523
9 Ga0070663_100014856 3300005455 Bacteria 5007
10 Ga0070663_100350600 3300005455 Bacteria 1195
11 Ga0070679_100117368 3300005530 Bacteria 2646
12 Ga0068853_100403788 3300005539 Bacteria 1279
13 Ga0068857_100288334 3300005577 Bacteria 1511
14 Ga0105244_10023771 3300009036 Bacteria 3355
15 Ga0105244_10058278 3300009036 Bacteria 1950
16 Ga0105243_10001032 3300009148 Bacteria 25576
17 Ga0105243_10095430 3300009148 Bacteria 2458
18 Ga0105239_10440437 3300010375 Bacteria 1477
19 Ga0105246_10007315 3300011119 Bacteria 6763
20 Ga0105246_10044272 3300011119 Bacteria 3024
21 Ga0105246_10238183 3300011119 Bacteria 1437
22 Ga0157370_10003183 3300013104 Bacteria 19414
23 Ga0157369_10008270 3300013105 Bacteria 11924
24 Ga0157369_10029667 3300013105 Bacteria 6042
25 Ga0157369_10070754 3300013105 Bacteria 3747
26 Ga0157372_10253247 3300013307 Bacteria 2044
27 Ga0206353_11845645 3300020082 Bacteria 1149
28 Ga0207426_1003186 3300025302 Bacteria 9249
29 Ga0207697_10004306 3300025315 Bacteria 6823
30 Ga0207655_1012544 3300025728 Bacteria 4944
31 Ga0207682_10271915 3300025893 Bacteria 791
32 Ga0207647_10018754 3300025904 Bacteria 4670
33 Ga0207652_10325528 3300025921 Bacteria 1388
34 Ga0207700_10149866 3300025928 Bacteria 1926
35 Ga0207709_10000888 3300025935 Bacteria 22597
36 Ga0207658_10320210 3300025986 Bacteria 1342
37 Ga0207678_10080930 3300026067 Bacteria 2780
38 Ga0207702_10245688 3300026078 Bacteria 1678
39 Ga0207674_10027558 3300026116 Bacteria 6007
40 Ga0207683_10567220 3300026121 Bacteria 1050
41 Ga0307413_10241428 3300031824 Bacteria 1334
42 Ga0307413_10750586 3300031824 Bacteria 816
43 Ga0307510_10293395 3300033180 Bacteria 1091
44 Ga0373933_0234564 3300035724 Bacteria 1179
45 Ga0450900_013649 3300042136 Bacteria 1076
46 Ga0466969_0003037 3300044656 Bacteria 8943
47 Ga0466969_0004220 3300044656 Bacteria 7631
48 Ga0466961_0106312 3300044693 Bacteria 1766
49 Ga0466959_0082290 3300045049 Bacteria 2319
50 Ga0466967_0354680 3300045976 Bacteria 1420
51 Ga0495617_050293 3300046452 Bacteria 1387
52 Ga0495603_0003120 3300046455 Bacteria 9849
53 Ga0495603_0004675 3300046455 Bacteria 8181
54 Ga0495603_0011785 3300046455 Bacteria 5292
55 Ga0495603_0030918 3300046455 Bacteria 3224
56 Ga0495629_0009748 3300046459 Bacteria 7008
57 Ga0495629_0061042 3300046459 Bacteria 2634
58 Ga0495629_0062145 3300046459 Bacteria 2609
59 Ga0495629_0135284 3300046459 Bacteria 1716
60 Ga0495651_0080804 3300046462 Bacteria 2454
61 Ga0495653_0033311 3300046463 Bacteria 4083
62 Ga0495580_0015109 3300046472 Bacteria 5842
63 Ga0495580_0056893 3300046472 Bacteria 2753
64 Ga0495639_0046968 3300046475 Bacteria 1955
65 Ga0495662_0000420 3300046476 Bacteria 18983
66 Ga0495662_0009034 3300046476 Bacteria 4893
67 Ga0495662_0010340 3300046476 Bacteria 4571
68 Ga0495662_0028629 3300046476 Bacteria 2689
69 Ga0495664_0038449 3300046477 Bacteria 2824
70 Ga0495594_0097518 3300046499 Bacteria 1652
71 Ga0495607_0056268 3300046501 Bacteria 2259
72 Ga0495630_0149991 3300046517 Bacteria 1774
73 Ga0495630_0289966 3300046517 Bacteria 1250
74 Ga0495666_0001355 3300046526 Bacteria 11875
75 Ga0495665_0007043 3300046531 Bacteria 6069
76 Ga0495640_0005802 3300046533 Bacteria 9807
77 Ga0495586_0017082 3300046535 Bacteria 3857
78 Ga0495587_0092651 3300046536 Bacteria 1745
79 Ga0495609_0078700 3300046538 Bacteria 1443
80 Ga0495645_0039513 3300046543 Bacteria 3441
81 Ga0495645_0097253 3300046543 Bacteria 2096
82 Ga0495645_0117630 3300046543 Bacteria 1875
83 Ga0495622_0199635 3300046557 Bacteria 891
84 Ga0495667_0025963 3300046559 Bacteria 3945
85 Ga0495634_0102058 3300046642 Bacteria 1852
86 Ga0495611_0048861 3300046648 Bacteria 1902
87 Ga0495588_0008841 3300046674 Bacteria 4632
88 Ga0495657_0004522 3300046675 Bacteria 11124
89 Ga0495657_0021916 3300046675 Bacteria 4581
90 Ga0495599_0093156 3300046678 Bacteria 1879
91 Ga0495623_0175098 3300046679 Bacteria 1250
92 Ga0495613_0020927 3300046689 Bacteria 4876
93 Ga0495613_0212990 3300046689 Bacteria 1358
94 Ga0495670_0080143 3300046691 Bacteria 1662
95 Ga0495589_0004362 3300046794 Bacteria 7545
96 Ga0495589_0026328 3300046794 Bacteria 2947
97 Ga0495600_0031311 3300046809 Bacteria 3446
98 Ga0495600_0122346 3300046809 Bacteria 1692
99 Ga0495581_0018916 3300047315 Bacteria 3998
100 Ga0495581_0092335 3300047315 Bacteria 1757
101 Ga0495604_0007195 3300047317 Bacteria 8815
102 Ga0495636_0007857 3300047318 Bacteria 4199
103 Ga0495636_0295538 3300047318 Bacteria 757
104 Ga0495674_0008160 3300047319 Bacteria 9990
105 Ga0495683_0056431 3300047323 Bacteria 1954
106 Ga0495675_0008943 3300047444 Bacteria 6225
107 Ga0495675_0020094 3300047444 Bacteria 4244
108 Ga0495675_0028240 3300047444 Bacteria 3577
109 Ga0495685_003961 3300047447 Bacteria 4757
110 Ga0495685_006543 3300047447 Bacteria 3821
111 Ga0495684_0052341 3300047471 Bacteria 3115
112 Ga0495593_0010168 3300047673 Bacteria 5445
113 Ga0495602_0053906 3300048088 Bacteria 3556
114 Ga0495614_0040827 3300048089 Bacteria 1991
115 Ga0496103_0113421 3300048906 Bacteria 1723
116 Ga0496110_0374273 3300048913 Bacteria 1298
117 Ga0496111_0068939 3300048914 Bacteria 2571
118 Ga0496111_0320514 3300048914 Bacteria 1148
119 Ga0496112_0099996 3300048915 Bacteria 2870
120 Ga0496113_0294864 3300048916 Bacteria 1298
121 Ga0496126_0014678 3300048929 Bacteria 7907
122 Ga0501032_0005422 3300049569 Bacteria 9479
123 Ga0501034_0000190 3300049571 Bacteria 115701
124 Ga0501036_0099298 3300049572 Bacteria 2462
125 Ga0501037_0010022 3300049573 Bacteria 6950
126 Ga0501037_0031988 3300049573 Bacteria 3884
127 Ga0501038_0003428 3300049574 Bacteria 14780
128 Ga0501038_0050151 3300049574 Bacteria 3608
129 Ga0501039_0002400 3300049575 Bacteria 13934
130 Ga0501039_0005401 3300049575 Bacteria 9665
131 Ga0501043_0042940 3300049579 Bacteria 3554
132 Ga0501043_0140881 3300049579 Bacteria 1888
133 Ga0501070_0141329 3300049586 Bacteria 1987
134 Ga0501073_0282620 3300049589 Bacteria 1145
135 nmdc:mga06z11_377988_c1 3300050494 Bacteria 851
136 Ga0495601_0007595 3300053077 Bacteria 6367
137 Ga0495601_0379229 3300053077 Bacteria 918
138 Ga0495619_0046382 3300053085 Bacteria 2857
139 3006491814 3006486233 Bacteria 8157040
140 2547412665 2547132111 Bacteria 8013147
141 2585298827 2582581312 Bacteria 7308206
142 2616902599 2616644941 Bacteria 8510691
143 2643761966 2643221548 Bacteria 8053412
144 2643826102 2643221561 Bacteria 4984412
145 2643903878 2643221578 Bacteria 9213798
146 2643942840 2643221587 Bacteria 7586415
147 2644019279 2643221601 Bacteria 7493239
148 2644174187 2643221631 Bacteria 8168043
149 2644388088 2643221670 Bacteria 6497041
150 2644430299 2643221677 Bacteria 7584031
151 2644460607 2643221682 Bacteria 6743283
152 2644532093 2643221696 Bacteria 5431823
153 2739238161 2738543011 Bacteria 5731169
154 2775658292 2775506735 Bacteria 4556596
155 2808828654 2808606357 Bacteria 4466944
156 2808849920 2808606360 Bacteria 4404006
157 2808877516 2808606366 Bacteria 4415912
158 2809589896 2808606522 Bacteria 9488490
159 2811843620 2808606982 Bacteria 7791042
160 2812319633 2811994871 Bacteria 4497550
161 2819743767 2818991472 Bacteria 10089953
162 2848554238 2848551377 Bacteria 3720646
163 2855684330 2855683550 Bacteria 7134265
164 2858904365 2858902515 Bacteria 7086037
165 2862183909 2862178590 Bacteria 8583590
166 2862294984 2862290372 Bacteria 7471434
167 2862576541 2862574272 Bacteria 10567477
168 2867476200 2867475112 Bacteria 6909112
169 2873153182 2873151551 Bacteria 8625867
170 2875397554 2875391855 Bacteria 7600475
171 2887447770 2887443736 Bacteria 4426037
172 2889303283 2889300758 Bacteria 5690814
173 2904779560 2904776348 Bacteria 4658726
174 2912728865 2912723979 Bacteria 8557534
175 2917740840 2917736166 Bacteria 9690793
176 2918507385 2918501144 Bacteria 8668083
177 2932433520 2932431166 Bacteria 4215299
178 2933420495 2933418574 Bacteria 4476724
179 2935395322 2935390628 Bacteria 7043367
180 2939745828 2939743619 Bacteria 5762299
181 2945917369 2945916053 Bacteria 4555517
182 2946046956 2946045630 Bacteria 8527308
183 2966599974 2966598605 Bacteria 7676064
184 2974305382 2974302888 Bacteria 4369871
185 2990045311 2990044586 Bacteria 6603797
186 2995464566 2995463766 Bacteria 8577691
187 2997459483 2997451912 Bacteria 8492419
188 2997607797 2997600082 Bacteria 9896405
189 8054164372 8054160619 Bacteria 7783213
190 JGI24740J21852_10048249
191 JGI24739J22299_10015937
192 JGI24737J22298_10006115
193 JGI24735J21928_10017445
194 JGI25160J50197_1024244
195 Ga0070667_100156609
196 Ga0070714_100008434
197 Ga0070713_100047686
198 Ga0070663_100014856
199 Ga0070663_100350600
200 Ga0070679_100117368
201 Ga0068853_100403788
202 Ga0068857_100288334
203 Ga0105244_10023771
204 Ga0105244_10058278
205 Ga0105243_10001032
206 Ga0105243_10095430
207 Ga0105239_10440437
208 Ga0105246_10007315
209 Ga0105246_10044272
210 Ga0105246_10238183
211 Ga0157370_10003183
212 Ga0157369_10008270
213 Ga0157369_10029667
214 Ga0157369_10070754
215 Ga0157372_10253247
216 Ga0206353_11845645
217 Ga0207426_1003186
218 Ga0207697_10004306
219 Ga0207655_1012544
220 Ga0207682_10271915
221 Ga0207647_10018754
222 Ga0207652_10325528
223 Ga0207700_10149866
224 Ga0207709_10000888
225 Ga0207658_10320210
226 Ga0207678_10080930
227 Ga0207702_10245688
228 Ga0207674_10027558
229 Ga0207683_10567220
230 Ga0307413_10241428
231 Ga0307413_10750586
232 Ga0307510_10293395
233 Ga0373933_0234564
234 Ga0450900_013649
235 Ga0466969_0003037
236 Ga0466969_0004220
237 Ga0466961_0106312
238 Ga0466959_0082290
239 Ga0466967_0354680
240 Ga0495617_050293
241 Ga0495603_0003120
242 Ga0495603_0004675
243 Ga0495603_0011785
244 Ga0495603_0030918
245 Ga0495629_0009748
246 Ga0495629_0061042
247 Ga0495629_0062145
248 Ga0495629_0135284
249 Ga0495651_0080804
250 Ga0495653_0033311
251 Ga0495580_0015109
252 Ga0495580_0056893
253 Ga0495639_0046968
254 Ga0495662_0000420
255 Ga0495662_0009034
256 Ga0495662_0010340
257 Ga0495662_0028629
258 Ga0495664_0038449
259 Ga0495594_0097518
260 Ga0495607_0056268
261 Ga0495630_0149991
262 Ga0495630_0289966
263 Ga0495666_0001355
264 Ga0495665_0007043
265 Ga0495640_0005802
266 Ga0495586_0017082
267 Ga0495587_0092651
268 Ga0495609_0078700
269 Ga0495645_0039513
270 Ga0495645_0097253
271 Ga0495645_0117630
272 Ga0495622_0199635
273 Ga0495667_0025963
274 Ga0495634_0102058
275 Ga0495611_0048861
276 Ga0495588_0008841
277 Ga0495657_0004522
278 Ga0495657_0021916
279 Ga0495599_0093156
280 Ga0495623_0175098
281 Ga0495613_0020927
282 Ga0495613_0212990
283 Ga0495670_0080143
284 Ga0495589_0004362
285 Ga0495589_0026328
286 Ga0495600_0031311
287 Ga0495600_0122346
288 Ga0495581_0018916
289 Ga0495581_0092335
290 Ga0495604_0007195
291 Ga0495636_0007857
292 Ga0495636_0295538
293 Ga0495674_0008160
294 Ga0495683_0056431
295 Ga0495675_0008943
296 Ga0495675_0020094
297 Ga0495675_0028240
298 Ga0495685_003961
299 Ga0495685_006543
300 Ga0495684_0052341
301 Ga0495593_0010168
302 Ga0495602_0053906
303 Ga0495614_0040827
304 Ga0496103_0113421
305 Ga0496110_0374273
306 Ga0496111_0068939
307 Ga0496111_0320514
308 Ga0496112_0099996
309 Ga0496113_0294864
310 Ga0496126_0014678
311 Ga0501032_0005422
312 Ga0501034_0000190
313 Ga0501036_0099298
314 Ga0501037_0010022
315 Ga0501037_0031988
316 Ga0501038_0003428
317 Ga0501038_0050151
318 Ga0501039_0002400
319 Ga0501039_0005401
320 Ga0501043_0042940
321 Ga0501043_0140881
322 Ga0501070_0141329
323 Ga0501073_0282620
324 nmdc:mga06z11_377988_c1
325 Ga0495601_0007595
326 Ga0495601_0379229
327 Ga0495619_0046382
328 3006491814
329 2547412665
330 2585298827
331 2616902599
332 2643761966
333 2643826102
334 2643903878
335 2643942840
336 2644019279
337 2644174187
338 2644388088
339 2644430299
340 2644460607
341 2644532093
342 2739238161
343 2775658292
344 2808828654
345 2808849920
346 2808877516
347 2809589896
348 2811843620
349 2812319633
350 2819743767
351 2848554238
352 2855684330
353 2858904365
354 2862183909
355 2862294984
356 2862576541
357 2867476200
358 2873153182
359 2875397554
360 2887447770
361 2889303283
362 2904779560
363 2912728865
364 2917740840
365 2918507385
366 2932433520
367 2933420495
368 2935395322
369 2939745828
370 2945917369
371 2946046956
372 2966599974
373 2974305382
374 2990045311
375 2995464566
376 2997459483
377 2997607797
378 8054164372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9539 3 210
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9284 2 211
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9197 3 210
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9184 1 207
5nik-assembly1.cif.gz_J structure of the macab-tolc abc-type tripartite multidrug efflux pump 0.9174 1 209
ID Description Score Start End Superfamily
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 3 208 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 21 209 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 1 214 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9419 1 199 3.40.50.300
af_Q4CYV3_7_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9413 1 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A524NV84-F1-model_v4 ABC transporter ATP-binding protein 0.9732 3 190 GO:0005524
GO:0016887
AF-A0A4U7CR65-F1-model_v4 ATP-binding cassette domain-containing protein 0.9696 3 82 GO:0005524
GO:0016887
AF-A0A7X9B9P8-F1-model_v4 ABC transporter ATP-binding protein 0.9656 3 104 GO:0005524
GO:0016887
AF-A0A377TL40-F1-model_v4 Methionine ABC transporter ATP-binding protein (EC 3.6.3.-) 0.9653 53 188 GO:0005524
GO:0005886
GO:0016887
AF-A0A356C0K2-F1-model_v4 ABC transporter domain-containing protein 0.9602 3 97 GO:0005524
GO:0016887

Map