F288847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 188 | 134 | 188 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300005343|Ga0070687_100026334|Ga0070687_1000263342 |
| Length | 334 |
| Sequence | MKRPASSIGTAGSSPNPELHYPTRRMMEQKKSADGVLLVDKISGITSHDVVERFRRRAKVKKAGHTGTLDPLATGLLVLCVGKATRLQAYLMGMEKTYEGTIQFGWATDSYDAEGEPVGEAVEASVEHVDFEPYLVPFRGEIEQMPPAFSAKKIDGVRAYALARKGEEVKLQPKRVTVYELVLTEVQGSTAKFRVRSSAGTYMRSLAHDLGQAIGIPAHLKDLRRTAIGTFHVDQAIAFDKLADAAPEAILAPPHFQSLSEIDLPLAKLRIDWAQQGKMMQGQSFIMVPPTPVAKGELIALGNPHDQLVAIGEVVNVLREGGPVEVKPKVVLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 91 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 93 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 96 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 97 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 98 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 99 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 124 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 93.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100003541 | 3300005329 | Bacteria | 12711 |
| 2 | Ga0070690_100062944 | 3300005330 | Unclassified | 2393 |
| 3 | Ga0070670_100000226 | 3300005331 | Bacteria | 52113 |
| 4 | Ga0070677_10171393 | 3300005333 | Unclassified | 1026 |
| 5 | Ga0068869_100006750 | 3300005334 | Bacteria | 7291 |
| 6 | Ga0070682_100000002 | 3300005337 | Bacteria | 506802 |
| 7 | Ga0068868_100000186 | 3300005338 | Bacteria | 41499 |
| 8 | Ga0068868_100000761 | 3300005338 | Bacteria | 21829 |
| 9 | Ga0070687_100026334 | 3300005343 | Bacteria | 2799 |
| 10 | Ga0070692_10010641 | 3300005345 | Bacteria | 4197 |
| 11 | Ga0070675_100000001 | 3300005354 | Bacteria | 448137 |
| 12 | Ga0070671_100142235 | 3300005355 | Bacteria | 2025 |
| 13 | Ga0070674_100065620 | 3300005356 | Bacteria | 2548 |
| 14 | Ga0070674_100246825 | 3300005356 | Bacteria | 1400 |
| 15 | Ga0070673_100201568 | 3300005364 | Bacteria | 1714 |
| 16 | Ga0070701_10000351 | 3300005438 | Bacteria | 15315 |
| 17 | Ga0070711_100043908 | 3300005439 | Bacteria | 3031 |
| 18 | Ga0070700_100000018 | 3300005441 | Bacteria | 137176 |
| 19 | Ga0070708_100000144 | 3300005445 | Bacteria | 49292 |
| 20 | Ga0070708_100086419 | 3300005445 | Bacteria | 2848 |
| 21 | Ga0070708_100315726 | 3300005445 | Bacteria | 1472 |
| 22 | Ga0070678_100099512 | 3300005456 | Bacteria | 2250 |
| 23 | Ga0068867_100088382 | 3300005459 | Bacteria | 2348 |
| 24 | Ga0070706_100022569 | 3300005467 | Bacteria | 5794 |
| 25 | Ga0070706_100049567 | 3300005467 | Bacteria | 3875 |
| 26 | Ga0070707_100024813 | 3300005468 | Bacteria | 5683 |
| 27 | Ga0070698_100098036 | 3300005471 | Bacteria | 2906 |
| 28 | Ga0070698_100149658 | 3300005471 | Bacteria | 2282 |
| 29 | Ga0070699_100048901 | 3300005518 | Bacteria | 3660 |
| 30 | Ga0070679_100415279 | 3300005530 | Bacteria | 1291 |
| 31 | Ga0070684_100004351 | 3300005535 | Bacteria | 10764 |
| 32 | Ga0070684_100014638 | 3300005535 | Bacteria | 6360 |
| 33 | Ga0070684_100207182 | 3300005535 | Bacteria | 1787 |
| 34 | Ga0070697_100183319 | 3300005536 | Bacteria | 1775 |
| 35 | Ga0070672_100000271 | 3300005543 | Bacteria | 29361 |
| 36 | Ga0070686_100156907 | 3300005544 | Bacteria | 1599 |
| 37 | Ga0070693_100004010 | 3300005547 | Bacteria | 6921 |
| 38 | Ga0068857_100238328 | 3300005577 | Unclassified | 1665 |
| 39 | Ga0068854_100008372 | 3300005578 | Bacteria | 6647 |
| 40 | Ga0068854_100036916 | 3300005578 | Bacteria | 3427 |
| 41 | Ga0068859_100179915 | 3300005617 | Bacteria | 2197 |
| 42 | Ga0068864_100000064 | 3300005618 | Bacteria | 119117 |
| 43 | Ga0068858_100000685 | 3300005842 | Bacteria | 35368 |
| 44 | Ga0070717_10000467 | 3300006028 | Bacteria | 25732 |
| 45 | Ga0075428_100006628 | 3300006844 | Bacteria | 12880 |
| 46 | Ga0075431_100053478 | 3300006847 | Bacteria | 4164 |
| 47 | Ga0068865_100039735 | 3300006881 | Bacteria | 3193 |
| 48 | Ga0075436_100001048 | 3300006914 | Bacteria | 18673 |
| 49 | Ga0097620_100179915 | 3300006931 | Bacteria | 2197 |
| 50 | Ga0075435_100001265 | 3300007076 | Bacteria | 16220 |
| 51 | Ga0075435_100010670 | 3300007076 | Bacteria | 6727 |
| 52 | Ga0075435_100317650 | 3300007076 | Bacteria | 1333 |
| 53 | Ga0105244_10007796 | 3300009036 | Bacteria | 6766 |
| 54 | Ga0105240_10035704 | 3300009093 | Bacteria | 6403 |
| 55 | Ga0105240_10264999 | 3300009093 | Unclassified | 1981 |
| 56 | Ga0111539_10000017 | 3300009094 | Bacteria | 275456 |
| 57 | Ga0105245_10000013 | 3300009098 | Bacteria | 266248 |
| 58 | Ga0105245_10000843 | 3300009098 | Bacteria | 27853 |
| 59 | Ga0105245_10003868 | 3300009098 | Bacteria | 13323 |
| 60 | Ga0105245_10088745 | 3300009098 | Bacteria | 2841 |
| 61 | Ga0105245_10359525 | 3300009098 | Bacteria | 1445 |
| 62 | Ga0105243_10363200 | 3300009148 | Bacteria | 1333 |
| 63 | Ga0105242_10053325 | 3300009176 | Bacteria | 3302 |
| 64 | Ga0105242_10079598 | 3300009176 | Bacteria | 2737 |
| 65 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 66 | Ga0157370_10421289 | 3300013104 | Unclassified | 1228 |
| 67 | Ga0157369_10006207 | 3300013105 | Bacteria | 13866 |
| 68 | Ga0157378_10004696 | 3300013297 | Bacteria | 11984 |
| 69 | Ga0157378_10021633 | 3300013297 | Bacteria | 5656 |
| 70 | Ga0157378_10070023 | 3300013297 | Bacteria | 3148 |
| 71 | Ga0157378_10321515 | 3300013297 | Bacteria | 1503 |
| 72 | Ga0163162_10021765 | 3300013306 | Bacteria | 6315 |
| 73 | Ga0157375_10000007 | 3300013308 | Bacteria | 377743 |
| 74 | Ga0157375_10000277 | 3300013308 | Bacteria | 46526 |
| 75 | Ga0157375_10013923 | 3300013308 | Bacteria | 7172 |
| 76 | Ga0157375_10649015 | 3300013308 | Bacteria | 1212 |
| 77 | Ga0163163_10334088 | 3300014325 | Unclassified | 1570 |
| 78 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 79 | Ga0157377_10000070 | 3300014745 | Bacteria | 80262 |
| 80 | Ga0157377_10139384 | 3300014745 | Bacteria | 1489 |
| 81 | Ga0157376_10000020 | 3300014969 | Bacteria | 246318 |
| 82 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 83 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 84 | Ga0213876_10000063 | 3300021384 | Bacteria | 128550 |
| 85 | Ga0213876_10022909 | 3300021384 | Bacteria | 3300 |
| 86 | Ga0207655_1040162 | 3300025728 | Bacteria | 2023 |
| 87 | Ga0207705_10027391 | 3300025909 | Bacteria | 4064 |
| 88 | Ga0207695_10200252 | 3300025913 | Unclassified | 1911 |
| 89 | Ga0207695_10259073 | 3300025913 | Bacteria | 1637 |
| 90 | Ga0207693_10136304 | 3300025915 | Bacteria | 1930 |
| 91 | Ga0207662_10088077 | 3300025918 | Bacteria | 1906 |
| 92 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 93 | Ga0207650_10000538 | 3300025925 | Bacteria | 30976 |
| 94 | Ga0207659_10000004 | 3300025926 | Bacteria | 476977 |
| 95 | Ga0207687_10000014 | 3300025927 | Bacteria | 297704 |
| 96 | Ga0207687_10001639 | 3300025927 | Bacteria | 15448 |
| 97 | Ga0207687_10004909 | 3300025927 | Bacteria | 8883 |
| 98 | Ga0207687_10051831 | 3300025927 | Bacteria | 2862 |
| 99 | Ga0207700_10119188 | 3300025928 | Bacteria | 2137 |
| 100 | Ga0207686_10040540 | 3300025934 | Bacteria | 2832 |
| 101 | Ga0207670_10000437 | 3300025936 | Bacteria | 23311 |
| 102 | Ga0207669_10044057 | 3300025937 | Bacteria | 2618 |
| 103 | Ga0207669_10170321 | 3300025937 | Bacteria | 1549 |
| 104 | Ga0207704_10026621 | 3300025938 | Bacteria | 3176 |
| 105 | Ga0207665_10073803 | 3300025939 | Bacteria | 2334 |
| 106 | Ga0207665_10103095 | 3300025939 | Bacteria | 1995 |
| 107 | Ga0207691_10000594 | 3300025940 | Bacteria | 36084 |
| 108 | Ga0207689_10012143 | 3300025942 | Bacteria | 7372 |
| 109 | Ga0207661_10000849 | 3300025944 | Bacteria | 20028 |
| 110 | Ga0207651_10290563 | 3300025960 | Bacteria | 1355 |
| 111 | Ga0207640_10006251 | 3300025981 | Bacteria | 6528 |
| 112 | Ga0207640_10024918 | 3300025981 | Bacteria | 3616 |
| 113 | Ga0207677_10000004 | 3300026023 | Bacteria | 299062 |
| 114 | Ga0207677_10000009 | 3300026023 | Bacteria | 252751 |
| 115 | Ga0207703_10000453 | 3300026035 | Bacteria | 43083 |
| 116 | Ga0207639_10000008 | 3300026041 | Bacteria | 434844 |
| 117 | Ga0207708_10000005 | 3300026075 | Bacteria | 284735 |
| 118 | Ga0207648_10150803 | 3300026089 | Bacteria | 2051 |
| 119 | Ga0207648_10291427 | 3300026089 | Bacteria | 1461 |
| 120 | Ga0207676_10000014 | 3300026095 | Bacteria | 339896 |
| 121 | Ga0207674_10055579 | 3300026116 | Bacteria | 4024 |
| 122 | Ga0207674_10286311 | 3300026116 | Unclassified | 1596 |
| 123 | Ga0207428_10000010 | 3300027907 | Bacteria | 397329 |
| 124 | Ga0265338_10172786 | 3300028800 | Bacteria | 1655 |
| 125 | Ga0307511_10008804 | 3300030521 | Bacteria | 10077 |
| 126 | Ga0307408_100184788 | 3300031548 | Bacteria | 1675 |
| 127 | Ga0373934_0001323 | 3300035086 | Bacteria | 9045 |
| 128 | Ga0373932_0001571 | 3300035112 | Bacteria | 6304 |
| 129 | Ga0373956_0094726 | 3300035119 | Bacteria | 1380 |
| 130 | Ga0373955_0153504 | 3300035172 | Unclassified | 1356 |
| 131 | Ga0373955_0191999 | 3300035172 | Bacteria | 1214 |
| 132 | Ga0373937_0012650 | 3300036401 | Bacteria | 7428 |
| 133 | Ga0373937_0017525 | 3300036401 | Bacteria | 6383 |
| 134 | Ga0436365_0128285 | 3300039437 | Bacteria | 2094 |
| 135 | Ga0436365_0374533 | 3300039437 | Bacteria | 3088 |
| 136 | Ga0436365_0454781 | 3300039437 | Bacteria | 4353 |
| 137 | Ga0436365_0535222 | 3300039437 | Unclassified | 2032 |
| 138 | Ga0436365_0788805 | 3300039437 | Bacteria | 42441 |
| 139 | Ga0436365_0818746 | 3300039437 | Bacteria | 84606 |
| 140 | Ga0436365_1069130 | 3300039437 | Bacteria | 1342 |
| 141 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 142 | Ga0451577_0058571 | 3300042876 | Bacteria | 3434 |
| 143 | Ga0466967_0016298 | 3300045976 | Bacteria | 5856 |
| 144 | Ga0495651_0010466 | 3300046462 | Bacteria | 7127 |
| 145 | Ga0495653_0016961 | 3300046463 | Bacteria | 5923 |
| 146 | Ga0495580_0041449 | 3300046472 | Bacteria | 3284 |
| 147 | Ga0495594_0026392 | 3300046499 | Bacteria | 3125 |
| 148 | Ga0495608_0139735 | 3300046511 | Unclassified | 1546 |
| 149 | Ga0495618_0050557 | 3300046514 | Bacteria | 2626 |
| 150 | Ga0495620_0001028 | 3300046515 | Bacteria | 17156 |
| 151 | Ga0495628_0013488 | 3300046516 | Bacteria | 6874 |
| 152 | Ga0495666_0044472 | 3300046526 | Bacteria | 2144 |
| 153 | Ga0495652_0011974 | 3300046529 | Bacteria | 7840 |
| 154 | Ga0495665_0019748 | 3300046531 | Bacteria | 3624 |
| 155 | Ga0495586_0064716 | 3300046535 | Bacteria | 1993 |
| 156 | Ga0495587_0002656 | 3300046536 | Bacteria | 11943 |
| 157 | Ga0495645_0006146 | 3300046543 | Bacteria | 8311 |
| 158 | Ga0495645_0058001 | 3300046543 | Bacteria | 2809 |
| 159 | Ga0495645_0137354 | 3300046543 | Bacteria | 1709 |
| 160 | Ga0495667_0001842 | 3300046559 | Bacteria | 14080 |
| 161 | Ga0495667_0305903 | 3300046559 | Bacteria | 1007 |
| 162 | Ga0495599_0002701 | 3300046678 | Bacteria | 10361 |
| 163 | Ga0495599_0167219 | 3300046678 | Bacteria | 1358 |
| 164 | Ga0495623_0010132 | 3300046679 | Bacteria | 6100 |
| 165 | Ga0495613_0309357 | 3300046689 | Bacteria | 1092 |
| 166 | Ga0495670_0207642 | 3300046691 | Bacteria | 1038 |
| 167 | Ga0495604_0003082 | 3300047317 | Bacteria | 13331 |
| 168 | Ga0495604_0026738 | 3300047317 | Bacteria | 4593 |
| 169 | Ga0495674_0137373 | 3300047319 | Bacteria | 2056 |
| 170 | Ga0495675_0034940 | 3300047444 | Unclassified | 3210 |
| 171 | Ga0495675_0037551 | 3300047444 | Bacteria | 3085 |
| 172 | Ga0495675_0152462 | 3300047444 | Unclassified | 1427 |
| 173 | Ga0495684_0008661 | 3300047471 | Bacteria | 7868 |
| 174 | Ga0495602_0014778 | 3300048088 | Bacteria | 7910 |
| 175 | Ga0496105_0085270 | 3300048908 | Bacteria | 2610 |
| 176 | Ga0501034_0002714 | 3300049571 | Bacteria | 20855 |
| 177 | Ga0501067_0291159 | 3300049583 | Bacteria | 909 |
| 178 | Ga0501073_0022941 | 3300049589 | Bacteria | 4488 |
| 179 | Ga0501081_0275250 | 3300049743 | Bacteria | 1232 |
| 180 | Ga0501044_0075392 | 3300049823 | Bacteria | 3425 |
| 181 | nmdc:mga08y16_15_c1 | 3300050511 | Bacteria | 397324 |
| 182 | nmdc:mga0rr50_431_c2 | 3300050513 | Bacteria | 18490 |
| 183 | nmdc:mga0rr50_7457_c1 | 3300050513 | Bacteria | 6749 |
| 184 | nmdc:mga0rr50_75202_c1 | 3300050513 | Bacteria | 2588 |
| 185 | nmdc:mga08x19_345_c1 | 3300050514 | Bacteria | 21206 |
| 186 | Ga0495612_0111437 | 3300053078 | Unclassified | 1171 |
| 187 | Ga0495655_0001489 | 3300053083 | Bacteria | 3600 |
| 188 | Ga0500616_0009205 | 3300053153 | Bacteria | 6026 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0291159 | Ga0501067_0291159_110_889 | 247 |
| 2 | 3300048908 | Ga0496105_0085270 | Ga0496105_0085270_341_1156 | 269 |
| 3 | 3300049571 | Ga0501034_0002714 | Ga0501034_0002714_542_1408 | 273 |
| 4 | 3300049823 | Ga0501044_0075392 | Ga0501044_0075392_870_1736 | 273 |
| 5 | 3300005445 | Ga0070708_100000144 | Ga0070708_10000014422 | 274 |
| 6 | 3300005467 | Ga0070706_100049567 | Ga0070706_1000495673 | 274 |
| 7 | 3300053153 | Ga0500616_0009205 | Ga0500616_0009205_2463_3293 | 274 |
| 8 | 3300009093 | Ga0105240_10264999 | Ga0105240_102649993 | 277 |
| 9 | 3300025913 | Ga0207695_10200252 | Ga0207695_102002521 | 277 |
| 10 | 3300013104 | Ga0157370_10421289 | Ga0157370_104212891 | 279 |
| 11 | 3300009098 | Ga0105245_10088745 | Ga0105245_100887452 | 285 |
| 12 | 3300009176 | Ga0105242_10053325 | Ga0105242_100533253 | 285 |
| 13 | 3300025927 | Ga0207687_10051831 | Ga0207687_100518314 | 285 |
| 14 | 3300046691 | Ga0495670_0207642 | Ga0495670_0207642_140_1012 | 286 |
| 15 | 3300045976 | Ga0466967_0016298 | Ga0466967_0016298_1804_2700 | 287 |
| 16 | 3300005439 | Ga0070711_100043908 | Ga0070711_1000439083 | 288 |
| 17 | 3300005530 | Ga0070679_100415279 | Ga0070679_1004152791 | 288 |
| 18 | 3300005535 | Ga0070684_100207182 | Ga0070684_1002071823 | 288 |
| 19 | 3300035086 | Ga0373934_0001323 | Ga0373934_0001323_1249_2121 | 288 |
| 20 | 3300035119 | Ga0373956_0094726 | Ga0373956_0094726_11_883 | 288 |
| 21 | 3300035172 | Ga0373955_0153504 | Ga0373955_0153504_447_1319 | 288 |
| 22 | 3300035172 | Ga0373955_0191999 | Ga0373955_0191999_301_1173 | 288 |
| 23 | 3300036401 | Ga0373937_0012650 | Ga0373937_0012650_516_1388 | 288 |
| 24 | 3300036401 | Ga0373937_0017525 | Ga0373937_0017525_206_1078 | 288 |
| 25 | 3300046462 | Ga0495651_0010466 | Ga0495651_0010466_5730_6602 | 288 |
| 26 | 3300046463 | Ga0495653_0016961 | Ga0495653_0016961_3912_4784 | 288 |
| 27 | 3300046472 | Ga0495580_0041449 | Ga0495580_0041449_1505_2377 | 288 |
| 28 | 3300046499 | Ga0495594_0026392 | Ga0495594_0026392_2131_3003 | 288 |
| 29 | 3300046511 | Ga0495608_0139735 | Ga0495608_0139735_442_1314 | 288 |
| 30 | 3300046514 | Ga0495618_0050557 | Ga0495618_0050557_1209_2081 | 288 |
| 31 | 3300046516 | Ga0495628_0013488 | Ga0495628_0013488_2198_3070 | 288 |
| 32 | 3300046526 | Ga0495666_0044472 | Ga0495666_0044472_867_1739 | 288 |
| 33 | 3300046529 | Ga0495652_0011974 | Ga0495652_0011974_1510_2382 | 288 |
| 34 | 3300046531 | Ga0495665_0019748 | Ga0495665_0019748_2352_3224 | 288 |
| 35 | 3300046535 | Ga0495586_0064716 | Ga0495586_0064716_367_1239 | 288 |
| 36 | 3300046536 | Ga0495587_0002656 | Ga0495587_0002656_4345_5217 | 288 |
| 37 | 3300046543 | Ga0495645_0006146 | Ga0495645_0006146_6908_7780 | 288 |
| 38 | 3300046559 | Ga0495667_0001842 | Ga0495667_0001842_8710_9582 | 288 |
| 39 | 3300046559 | Ga0495667_0305903 | Ga0495667_0305903_10_882 | 288 |
| 40 | 3300046678 | Ga0495599_0002701 | Ga0495599_0002701_5716_6588 | 288 |
| 41 | 3300046679 | Ga0495623_0010132 | Ga0495623_0010132_4703_5575 | 288 |
| 42 | 3300047317 | Ga0495604_0003082 | Ga0495604_0003082_7084_7956 | 288 |
| 43 | 3300047319 | Ga0495674_0137373 | Ga0495674_0137373_579_1451 | 288 |
| 44 | 3300047444 | Ga0495675_0034940 | Ga0495675_0034940_1901_2773 | 288 |
| 45 | 3300047444 | Ga0495675_0037551 | Ga0495675_0037551_1504_2376 | 288 |
| 46 | 3300047471 | Ga0495684_0008661 | Ga0495684_0008661_4192_5064 | 288 |
| 47 | 3300048088 | Ga0495602_0014778 | Ga0495602_0014778_526_1398 | 288 |
| 48 | 3300053078 | Ga0495612_0111437 | Ga0495612_0111437_219_1091 | 288 |
| 49 | 3300005617 | Ga0068859_100179915 | Ga0068859_1001799152 | 290 |
| 50 | 3300006931 | Ga0097620_100179915 | Ga0097620_1001799152 | 290 |
| 51 | 3300013308 | Ga0157375_10649015 | Ga0157375_106490152 | 290 |
| 52 | 3300028800 | Ga0265338_10172786 | Ga0265338_101727861 | 290 |
| 53 | 3300046543 | Ga0495645_0058001 | Ga0495645_0058001_703_1584 | 290 |
| 54 | 3300046543 | Ga0495645_0137354 | Ga0495645_0137354_303_1184 | 290 |
| 55 | 3300046689 | Ga0495613_0309357 | Ga0495613_0309357_87_968 | 290 |
| 56 | 3300047317 | Ga0495604_0026738 | Ga0495604_0026738_209_1090 | 290 |
| 57 | 3300047444 | Ga0495675_0152462 | Ga0495675_0152462_84_965 | 290 |
| 58 | 3300025915 | Ga0207693_10136304 | Ga0207693_101363042 | 292 |
| 59 | 3300005535 | Ga0070684_100014638 | Ga0070684_1000146384 | 293 |
| 60 | 3300005577 | Ga0068857_100238328 | Ga0068857_1002383282 | 293 |
| 61 | 3300026116 | Ga0207674_10286311 | Ga0207674_102863112 | 293 |
| 62 | 3300046678 | Ga0495599_0167219 | Ga0495599_0167219_410_1315 | 297 |
| 63 | 3300005471 | Ga0070698_100098036 | Ga0070698_1000980362 | 298 |
| 64 | 3300005536 | Ga0070697_100183319 | Ga0070697_1001833192 | 299 |
| 65 | 3300042876 | Ga0451577_0058571 | Ga0451577_0058571_2226_3155 | 299 |
| 66 | 3300049743 | Ga0501081_0275250 | Ga0501081_0275250_129_1112 | 299 |
| 67 | 3300039437 | Ga0436365_0128285 | Ga0436365_0128285_914_1852 | 306 |
| 68 | 3300039437 | Ga0436365_0535222 | Ga0436365_0535222_149_1087 | 306 |
| 69 | 3300005445 | Ga0070708_100086419 | Ga0070708_1000864192 | 308 |
| 70 | 3300005467 | Ga0070706_100022569 | Ga0070706_1000225692 | 308 |
| 71 | 3300005468 | Ga0070707_100024813 | Ga0070707_1000248137 | 308 |
| 72 | 3300005471 | Ga0070698_100149658 | Ga0070698_1001496582 | 308 |
| 73 | 3300007076 | Ga0075435_100010670 | Ga0075435_1000106704 | 308 |
| 74 | 3300021358 | Ga0213873_10000004 | Ga0213873_10000004542 | 308 |
| 75 | 3300021384 | Ga0213876_10000007 | Ga0213876_10000007542 | 308 |
| 76 | 3300021384 | Ga0213876_10022909 | Ga0213876_100229092 | 308 |
| 77 | 3300039437 | Ga0436365_0454781 | Ga0436365_0454781_803_1729 | 308 |
| 78 | 3300050513 | nmdc:mga0rr50_7457_c1 | nmdc:mga0rr50_7457_c1_4538_5464 | 308 |
| 79 | 3300005329 | Ga0070683_100003541 | Ga0070683_1000035417 | 309 |
| 80 | 3300005330 | Ga0070690_100062944 | Ga0070690_1000629443 | 309 |
| 81 | 3300005331 | Ga0070670_100000226 | Ga0070670_1000002268 | 309 |
| 82 | 3300005333 | Ga0070677_10171393 | Ga0070677_101713931 | 309 |
| 83 | 3300005334 | Ga0068869_100006750 | Ga0068869_1000067508 | 309 |
| 84 | 3300005337 | Ga0070682_100000002 | Ga0070682_100000002202 | 309 |
| 85 | 3300005338 | Ga0068868_100000186 | Ga0068868_10000018632 | 309 |
| 86 | 3300005338 | Ga0068868_100000761 | Ga0068868_10000076111 | 309 |
| 87 | 3300005343 | Ga0070687_100026334 | Ga0070687_1000263342 | 309 |
| 88 | 3300005345 | Ga0070692_10010641 | Ga0070692_100106415 | 309 |
| 89 | 3300005354 | Ga0070675_100000001 | Ga0070675_100000001226 | 309 |
| 90 | 3300005355 | Ga0070671_100142235 | Ga0070671_1001422353 | 309 |
| 91 | 3300005356 | Ga0070674_100065620 | Ga0070674_1000656203 | 309 |
| 92 | 3300005356 | Ga0070674_100246825 | Ga0070674_1002468252 | 309 |
| 93 | 3300005364 | Ga0070673_100201568 | Ga0070673_1002015682 | 309 |
| 94 | 3300005438 | Ga0070701_10000351 | Ga0070701_100003514 | 309 |
| 95 | 3300005441 | Ga0070700_100000018 | Ga0070700_10000001838 | 309 |
| 96 | 3300005445 | Ga0070708_100315726 | Ga0070708_1003157261 | 309 |
| 97 | 3300005456 | Ga0070678_100099512 | Ga0070678_1000995123 | 309 |
| 98 | 3300005459 | Ga0068867_100088382 | Ga0068867_1000883823 | 309 |
| 99 | 3300005518 | Ga0070699_100048901 | Ga0070699_1000489014 | 309 |
| 100 | 3300005535 | Ga0070684_100004351 | Ga0070684_10000435113 | 309 |
| 101 | 3300005543 | Ga0070672_100000271 | Ga0070672_1000002715 | 309 |
| 102 | 3300005544 | Ga0070686_100156907 | Ga0070686_1001569072 | 309 |
| 103 | 3300005547 | Ga0070693_100004010 | Ga0070693_1000040107 | 309 |
| 104 | 3300005578 | Ga0068854_100008372 | Ga0068854_1000083726 | 309 |
| 105 | 3300005578 | Ga0068854_100036916 | Ga0068854_1000369162 | 309 |
| 106 | 3300005618 | Ga0068864_100000064 | Ga0068864_10000006468 | 309 |
| 107 | 3300005842 | Ga0068858_100000685 | Ga0068858_1000006857 | 309 |
| 108 | 3300006028 | Ga0070717_10000467 | Ga0070717_1000046712 | 309 |
| 109 | 3300006844 | Ga0075428_100006628 | Ga0075428_1000066282 | 309 |
| 110 | 3300006847 | Ga0075431_100053478 | Ga0075431_1000534782 | 309 |
| 111 | 3300006881 | Ga0068865_100039735 | Ga0068865_1000397353 | 309 |
| 112 | 3300006914 | Ga0075436_100001048 | Ga0075436_1000010483 | 309 |
| 113 | 3300007076 | Ga0075435_100001265 | Ga0075435_10000126516 | 309 |
| 114 | 3300007076 | Ga0075435_100317650 | Ga0075435_1003176501 | 309 |
| 115 | 3300009036 | Ga0105244_10007796 | Ga0105244_100077965 | 309 |
| 116 | 3300009093 | Ga0105240_10035704 | Ga0105240_100357044 | 309 |
| 117 | 3300009094 | Ga0111539_10000017 | Ga0111539_10000017186 | 309 |
| 118 | 3300009098 | Ga0105245_10000013 | Ga0105245_10000013223 | 309 |
| 119 | 3300009098 | Ga0105245_10000843 | Ga0105245_100008435 | 309 |
| 120 | 3300009098 | Ga0105245_10003868 | Ga0105245_1000386814 | 309 |
| 121 | 3300009098 | Ga0105245_10359525 | Ga0105245_103595252 | 309 |
| 122 | 3300009148 | Ga0105243_10363200 | Ga0105243_103632001 | 309 |
| 123 | 3300009176 | Ga0105242_10079598 | Ga0105242_100795983 | 309 |
| 124 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001861 | 309 |
| 125 | 3300013105 | Ga0157369_10006207 | Ga0157369_1000620711 | 309 |
| 126 | 3300013297 | Ga0157378_10004696 | Ga0157378_100046962 | 309 |
| 127 | 3300013297 | Ga0157378_10021633 | Ga0157378_100216332 | 309 |
| 128 | 3300013297 | Ga0157378_10070023 | Ga0157378_100700232 | 309 |
| 129 | 3300013297 | Ga0157378_10321515 | Ga0157378_103215152 | 309 |
| 130 | 3300013306 | Ga0163162_10021765 | Ga0163162_100217654 | 309 |
| 131 | 3300013308 | Ga0157375_10000007 | Ga0157375_10000007246 | 309 |
| 132 | 3300013308 | Ga0157375_10000277 | Ga0157375_100002775 | 309 |
| 133 | 3300013308 | Ga0157375_10013923 | Ga0157375_100139238 | 309 |
| 134 | 3300014325 | Ga0163163_10334088 | Ga0163163_103340881 | 309 |
| 135 | 3300014745 | Ga0157377_10000002 | Ga0157377_1000000213 | 309 |
| 136 | 3300014745 | Ga0157377_10000070 | Ga0157377_1000007070 | 309 |
| 137 | 3300014745 | Ga0157377_10139384 | Ga0157377_101393841 | 309 |
| 138 | 3300014969 | Ga0157376_10000020 | Ga0157376_10000020159 | 309 |
| 139 | 3300021384 | Ga0213876_10000063 | Ga0213876_10000063125 | 309 |
| 140 | 3300025728 | Ga0207655_1040162 | Ga0207655_10401623 | 309 |
| 141 | 3300025909 | Ga0207705_10027391 | Ga0207705_100273911 | 309 |
| 142 | 3300025913 | Ga0207695_10259073 | Ga0207695_102590732 | 309 |
| 143 | 3300025918 | Ga0207662_10088077 | Ga0207662_100880772 | 309 |
| 144 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011901 | 309 |
| 145 | 3300025925 | Ga0207650_10000538 | Ga0207650_1000053815 | 309 |
| 146 | 3300025926 | Ga0207659_10000004 | Ga0207659_10000004224 | 309 |
| 147 | 3300025927 | Ga0207687_10000014 | Ga0207687_10000014223 | 309 |
| 148 | 3300025927 | Ga0207687_10001639 | Ga0207687_100016398 | 309 |
| 149 | 3300025927 | Ga0207687_10004909 | Ga0207687_100049096 | 309 |
| 150 | 3300025928 | Ga0207700_10119188 | Ga0207700_101191882 | 309 |
| 151 | 3300025934 | Ga0207686_10040540 | Ga0207686_100405403 | 309 |
| 152 | 3300025936 | Ga0207670_10000437 | Ga0207670_1000043714 | 309 |
| 153 | 3300025937 | Ga0207669_10044057 | Ga0207669_100440573 | 309 |
| 154 | 3300025937 | Ga0207669_10170321 | Ga0207669_101703212 | 309 |
| 155 | 3300025938 | Ga0207704_10026621 | Ga0207704_100266213 | 309 |
| 156 | 3300025939 | Ga0207665_10073803 | Ga0207665_100738032 | 309 |
| 157 | 3300025939 | Ga0207665_10103095 | Ga0207665_101030952 | 309 |
| 158 | 3300025940 | Ga0207691_10000594 | Ga0207691_1000059434 | 309 |
| 159 | 3300025942 | Ga0207689_10012143 | Ga0207689_100121436 | 309 |
| 160 | 3300025944 | Ga0207661_10000849 | Ga0207661_1000084917 | 309 |
| 161 | 3300025960 | Ga0207651_10290563 | Ga0207651_102905632 | 309 |
| 162 | 3300025981 | Ga0207640_10006251 | Ga0207640_100062517 | 309 |
| 163 | 3300025981 | Ga0207640_10024918 | Ga0207640_100249184 | 309 |
| 164 | 3300026023 | Ga0207677_10000004 | Ga0207677_10000004272 | 309 |
| 165 | 3300026023 | Ga0207677_10000009 | Ga0207677_1000000963 | 309 |
| 166 | 3300026035 | Ga0207703_10000453 | Ga0207703_1000045328 | 309 |
| 167 | 3300026041 | Ga0207639_10000008 | Ga0207639_1000000883 | 309 |
| 168 | 3300026075 | Ga0207708_10000005 | Ga0207708_10000005229 | 309 |
| 169 | 3300026089 | Ga0207648_10150803 | Ga0207648_101508033 | 309 |
| 170 | 3300026089 | Ga0207648_10291427 | Ga0207648_102914271 | 309 |
| 171 | 3300026095 | Ga0207676_10000014 | Ga0207676_10000014273 | 309 |
| 172 | 3300026116 | Ga0207674_10055579 | Ga0207674_100555794 | 309 |
| 173 | 3300027907 | Ga0207428_10000010 | Ga0207428_10000010182 | 309 |
| 174 | 3300030521 | Ga0307511_10008804 | Ga0307511_100088042 | 309 |
| 175 | 3300031548 | Ga0307408_100184788 | Ga0307408_1001847881 | 309 |
| 176 | 3300035112 | Ga0373932_0001571 | Ga0373932_0001571_4742_5689 | 309 |
| 177 | 3300039437 | Ga0436365_0374533 | Ga0436365_0374533_1159_2088 | 309 |
| 178 | 3300039437 | Ga0436365_0788805 | Ga0436365_0788805_37568_38497 | 309 |
| 179 | 3300039437 | Ga0436365_0818746 | Ga0436365_0818746_81546_82493 | 309 |
| 180 | 3300039437 | Ga0436365_1069130 | Ga0436365_1069130_124_1053 | 309 |
| 181 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_184589_185518 | 309 |
| 182 | 3300046515 | Ga0495620_0001028 | Ga0495620_0001028_14962_15891 | 309 |
| 183 | 3300049589 | Ga0501073_0022941 | Ga0501073_0022941_311_1255 | 309 |
| 184 | 3300050511 | nmdc:mga08y16_15_c1 | nmdc:mga08y16_15_c1_180223_181152 | 309 |
| 185 | 3300050513 | nmdc:mga0rr50_431_c2 | nmdc:mga0rr50_431_c2_13300_14232 | 309 |
| 186 | 3300050513 | nmdc:mga0rr50_75202_c1 | nmdc:mga0rr50_75202_c1_1449_2384 | 309 |
| 187 | 3300050514 | nmdc:mga08x19_345_c1 | nmdc:mga08x19_345_c1_17470_18402 | 309 |
| 188 | 3300053083 | Ga0495655_0001489 | Ga0495655_0001489_1465_2397 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ze2-assembly1.cif.gz_A | conformational change of pseudouridine 55 synthase upon its association with rna substrate | 0.8936 | 9 | 306 |
| 2ab4-assembly1.cif.gz_A | dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase | 0.886 | 9 | 306 |
| 1ze1-assembly4.cif.gz_D | conformational change of pseudouridine 55 synthase upon its association with rna substrate | 0.8835 | 9 | 289 |
| 1ze2-assembly1.cif.gz_A | conformational change of pseudouridine 55 synthase upon its association with rna substrate | 0.8767 | 9 | 306 |
| 1r3e-assembly1.cif.gz_A | crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit | 0.8707 | 9 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57612_45_223_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9413 | 10 | 220 | 3.30.2350.10 |
| af_B9F4Z0_25_81_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9301 | 8 | 59 | 3.30.2350.10 |
| 1ze1D01 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.925 | 9 | 237 | 3.30.2350.10 |
| 3u28A02 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9215 | 8 | 220 | 3.30.2350.10 |
| af_Q57612_45_223_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9211 | 10 | 220 | 3.30.2350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536TVW9-F1-model_v4 | tRNA pseudouridine(55) synthase (EC 5.4.99.25) | 0.9599 | 31 | 221 |
GO:0003723
GO:0006400 GO:0160148 GO:1990481 |
| AF-A0A7R9AL26-F1-model_v4 | tRNA pseudouridine(55) synthase (EC 5.4.99.25) | 0.9588 | 106 | 226 |
GO:0003723
GO:0006400 GO:0009982 GO:1990481 |
| AF-A0A1F4RDD4-F1-model_v4 | tRNA pseudouridine(55) synthase (EC 5.4.99.25) | 0.9585 | 9 | 213 |
GO:0003723
GO:0006400 GO:0160148 GO:1990481 |
| AF-A0A7X7MHF1-F1-model_v4 | tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) | 0.9568 | 5 | 225 |
GO:0003723
GO:0031119 GO:0160148 GO:1990481 |
| AF-X0RZ23-F1-model_v4 | tRNA pseudouridine(55) synthase (EC 5.4.99.25) | 0.9534 | 106 | 226 |
GO:0003723
GO:0006400 GO:0009982 GO:1990481 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar