F288847

General Info

Members Datasets Scaffolds Average Seq Length
188 134 188 304

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100026334|Ga0070687_1000263342
Length 334
Sequence MKRPASSIGTAGSSPNPELHYPTRRMMEQKKSADGVLLVDKISGITSHDVVERFRRRAKVKKAGHTGTLDPLATGLLVLCVGKATRLQAYLMGMEKTYEGTIQFGWATDSYDAEGEPVGEAVEASVEHVDFEPYLVPFRGEIEQMPPAFSAKKIDGVRAYALARKGEEVKLQPKRVTVYELVLTEVQGSTAKFRVRSSAGTYMRSLAHDLGQAIGIPAHLKDLRRTAIGTFHVDQAIAFDKLADAAPEAILAPPHFQSLSEIDLPLAKLRIDWAQQGKMMQGQSFIMVPPTPVAKGELIALGNPHDQLVAIGEVVNVLREGGPVEVKPKVVLAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0.53
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003541 3300005329 Bacteria 12711
2 Ga0070690_100062944 3300005330 Unclassified 2393
3 Ga0070670_100000226 3300005331 Bacteria 52113
4 Ga0070677_10171393 3300005333 Unclassified 1026
5 Ga0068869_100006750 3300005334 Bacteria 7291
6 Ga0070682_100000002 3300005337 Bacteria 506802
7 Ga0068868_100000186 3300005338 Bacteria 41499
8 Ga0068868_100000761 3300005338 Bacteria 21829
9 Ga0070687_100026334 3300005343 Bacteria 2799
10 Ga0070692_10010641 3300005345 Bacteria 4197
11 Ga0070675_100000001 3300005354 Bacteria 448137
12 Ga0070671_100142235 3300005355 Bacteria 2025
13 Ga0070674_100065620 3300005356 Bacteria 2548
14 Ga0070674_100246825 3300005356 Bacteria 1400
15 Ga0070673_100201568 3300005364 Bacteria 1714
16 Ga0070701_10000351 3300005438 Bacteria 15315
17 Ga0070711_100043908 3300005439 Bacteria 3031
18 Ga0070700_100000018 3300005441 Bacteria 137176
19 Ga0070708_100000144 3300005445 Bacteria 49292
20 Ga0070708_100086419 3300005445 Bacteria 2848
21 Ga0070708_100315726 3300005445 Bacteria 1472
22 Ga0070678_100099512 3300005456 Bacteria 2250
23 Ga0068867_100088382 3300005459 Bacteria 2348
24 Ga0070706_100022569 3300005467 Bacteria 5794
25 Ga0070706_100049567 3300005467 Bacteria 3875
26 Ga0070707_100024813 3300005468 Bacteria 5683
27 Ga0070698_100098036 3300005471 Bacteria 2906
28 Ga0070698_100149658 3300005471 Bacteria 2282
29 Ga0070699_100048901 3300005518 Bacteria 3660
30 Ga0070679_100415279 3300005530 Bacteria 1291
31 Ga0070684_100004351 3300005535 Bacteria 10764
32 Ga0070684_100014638 3300005535 Bacteria 6360
33 Ga0070684_100207182 3300005535 Bacteria 1787
34 Ga0070697_100183319 3300005536 Bacteria 1775
35 Ga0070672_100000271 3300005543 Bacteria 29361
36 Ga0070686_100156907 3300005544 Bacteria 1599
37 Ga0070693_100004010 3300005547 Bacteria 6921
38 Ga0068857_100238328 3300005577 Unclassified 1665
39 Ga0068854_100008372 3300005578 Bacteria 6647
40 Ga0068854_100036916 3300005578 Bacteria 3427
41 Ga0068859_100179915 3300005617 Bacteria 2197
42 Ga0068864_100000064 3300005618 Bacteria 119117
43 Ga0068858_100000685 3300005842 Bacteria 35368
44 Ga0070717_10000467 3300006028 Bacteria 25732
45 Ga0075428_100006628 3300006844 Bacteria 12880
46 Ga0075431_100053478 3300006847 Bacteria 4164
47 Ga0068865_100039735 3300006881 Bacteria 3193
48 Ga0075436_100001048 3300006914 Bacteria 18673
49 Ga0097620_100179915 3300006931 Bacteria 2197
50 Ga0075435_100001265 3300007076 Bacteria 16220
51 Ga0075435_100010670 3300007076 Bacteria 6727
52 Ga0075435_100317650 3300007076 Bacteria 1333
53 Ga0105244_10007796 3300009036 Bacteria 6766
54 Ga0105240_10035704 3300009093 Bacteria 6403
55 Ga0105240_10264999 3300009093 Unclassified 1981
56 Ga0111539_10000017 3300009094 Bacteria 275456
57 Ga0105245_10000013 3300009098 Bacteria 266248
58 Ga0105245_10000843 3300009098 Bacteria 27853
59 Ga0105245_10003868 3300009098 Bacteria 13323
60 Ga0105245_10088745 3300009098 Bacteria 2841
61 Ga0105245_10359525 3300009098 Bacteria 1445
62 Ga0105243_10363200 3300009148 Bacteria 1333
63 Ga0105242_10053325 3300009176 Bacteria 3302
64 Ga0105242_10079598 3300009176 Bacteria 2737
65 Ga0105238_10000001 3300009551 Bacteria 2036163
66 Ga0157370_10421289 3300013104 Unclassified 1228
67 Ga0157369_10006207 3300013105 Bacteria 13866
68 Ga0157378_10004696 3300013297 Bacteria 11984
69 Ga0157378_10021633 3300013297 Bacteria 5656
70 Ga0157378_10070023 3300013297 Bacteria 3148
71 Ga0157378_10321515 3300013297 Bacteria 1503
72 Ga0163162_10021765 3300013306 Bacteria 6315
73 Ga0157375_10000007 3300013308 Bacteria 377743
74 Ga0157375_10000277 3300013308 Bacteria 46526
75 Ga0157375_10013923 3300013308 Bacteria 7172
76 Ga0157375_10649015 3300013308 Bacteria 1212
77 Ga0163163_10334088 3300014325 Unclassified 1570
78 Ga0157377_10000002 3300014745 Bacteria 473827
79 Ga0157377_10000070 3300014745 Bacteria 80262
80 Ga0157377_10139384 3300014745 Bacteria 1489
81 Ga0157376_10000020 3300014969 Bacteria 246318
82 Ga0213873_10000004 3300021358 Bacteria 774374
83 Ga0213876_10000007 3300021384 Bacteria 670340
84 Ga0213876_10000063 3300021384 Bacteria 128550
85 Ga0213876_10022909 3300021384 Bacteria 3300
86 Ga0207655_1040162 3300025728 Bacteria 2023
87 Ga0207705_10027391 3300025909 Bacteria 4064
88 Ga0207695_10200252 3300025913 Unclassified 1911
89 Ga0207695_10259073 3300025913 Bacteria 1637
90 Ga0207693_10136304 3300025915 Bacteria 1930
91 Ga0207662_10088077 3300025918 Bacteria 1906
92 Ga0207694_10000001 3300025924 Bacteria 4078485
93 Ga0207650_10000538 3300025925 Bacteria 30976
94 Ga0207659_10000004 3300025926 Bacteria 476977
95 Ga0207687_10000014 3300025927 Bacteria 297704
96 Ga0207687_10001639 3300025927 Bacteria 15448
97 Ga0207687_10004909 3300025927 Bacteria 8883
98 Ga0207687_10051831 3300025927 Bacteria 2862
99 Ga0207700_10119188 3300025928 Bacteria 2137
100 Ga0207686_10040540 3300025934 Bacteria 2832
101 Ga0207670_10000437 3300025936 Bacteria 23311
102 Ga0207669_10044057 3300025937 Bacteria 2618
103 Ga0207669_10170321 3300025937 Bacteria 1549
104 Ga0207704_10026621 3300025938 Bacteria 3176
105 Ga0207665_10073803 3300025939 Bacteria 2334
106 Ga0207665_10103095 3300025939 Bacteria 1995
107 Ga0207691_10000594 3300025940 Bacteria 36084
108 Ga0207689_10012143 3300025942 Bacteria 7372
109 Ga0207661_10000849 3300025944 Bacteria 20028
110 Ga0207651_10290563 3300025960 Bacteria 1355
111 Ga0207640_10006251 3300025981 Bacteria 6528
112 Ga0207640_10024918 3300025981 Bacteria 3616
113 Ga0207677_10000004 3300026023 Bacteria 299062
114 Ga0207677_10000009 3300026023 Bacteria 252751
115 Ga0207703_10000453 3300026035 Bacteria 43083
116 Ga0207639_10000008 3300026041 Bacteria 434844
117 Ga0207708_10000005 3300026075 Bacteria 284735
118 Ga0207648_10150803 3300026089 Bacteria 2051
119 Ga0207648_10291427 3300026089 Bacteria 1461
120 Ga0207676_10000014 3300026095 Bacteria 339896
121 Ga0207674_10055579 3300026116 Bacteria 4024
122 Ga0207674_10286311 3300026116 Unclassified 1596
123 Ga0207428_10000010 3300027907 Bacteria 397329
124 Ga0265338_10172786 3300028800 Bacteria 1655
125 Ga0307511_10008804 3300030521 Bacteria 10077
126 Ga0307408_100184788 3300031548 Bacteria 1675
127 Ga0373934_0001323 3300035086 Bacteria 9045
128 Ga0373932_0001571 3300035112 Bacteria 6304
129 Ga0373956_0094726 3300035119 Bacteria 1380
130 Ga0373955_0153504 3300035172 Unclassified 1356
131 Ga0373955_0191999 3300035172 Bacteria 1214
132 Ga0373937_0012650 3300036401 Bacteria 7428
133 Ga0373937_0017525 3300036401 Bacteria 6383
134 Ga0436365_0128285 3300039437 Bacteria 2094
135 Ga0436365_0374533 3300039437 Bacteria 3088
136 Ga0436365_0454781 3300039437 Bacteria 4353
137 Ga0436365_0535222 3300039437 Unclassified 2032
138 Ga0436365_0788805 3300039437 Bacteria 42441
139 Ga0436365_0818746 3300039437 Bacteria 84606
140 Ga0436365_1069130 3300039437 Bacteria 1342
141 Ga0436362_0290430 3300039453 Bacteria 772596
142 Ga0451577_0058571 3300042876 Bacteria 3434
143 Ga0466967_0016298 3300045976 Bacteria 5856
144 Ga0495651_0010466 3300046462 Bacteria 7127
145 Ga0495653_0016961 3300046463 Bacteria 5923
146 Ga0495580_0041449 3300046472 Bacteria 3284
147 Ga0495594_0026392 3300046499 Bacteria 3125
148 Ga0495608_0139735 3300046511 Unclassified 1546
149 Ga0495618_0050557 3300046514 Bacteria 2626
150 Ga0495620_0001028 3300046515 Bacteria 17156
151 Ga0495628_0013488 3300046516 Bacteria 6874
152 Ga0495666_0044472 3300046526 Bacteria 2144
153 Ga0495652_0011974 3300046529 Bacteria 7840
154 Ga0495665_0019748 3300046531 Bacteria 3624
155 Ga0495586_0064716 3300046535 Bacteria 1993
156 Ga0495587_0002656 3300046536 Bacteria 11943
157 Ga0495645_0006146 3300046543 Bacteria 8311
158 Ga0495645_0058001 3300046543 Bacteria 2809
159 Ga0495645_0137354 3300046543 Bacteria 1709
160 Ga0495667_0001842 3300046559 Bacteria 14080
161 Ga0495667_0305903 3300046559 Bacteria 1007
162 Ga0495599_0002701 3300046678 Bacteria 10361
163 Ga0495599_0167219 3300046678 Bacteria 1358
164 Ga0495623_0010132 3300046679 Bacteria 6100
165 Ga0495613_0309357 3300046689 Bacteria 1092
166 Ga0495670_0207642 3300046691 Bacteria 1038
167 Ga0495604_0003082 3300047317 Bacteria 13331
168 Ga0495604_0026738 3300047317 Bacteria 4593
169 Ga0495674_0137373 3300047319 Bacteria 2056
170 Ga0495675_0034940 3300047444 Unclassified 3210
171 Ga0495675_0037551 3300047444 Bacteria 3085
172 Ga0495675_0152462 3300047444 Unclassified 1427
173 Ga0495684_0008661 3300047471 Bacteria 7868
174 Ga0495602_0014778 3300048088 Bacteria 7910
175 Ga0496105_0085270 3300048908 Bacteria 2610
176 Ga0501034_0002714 3300049571 Bacteria 20855
177 Ga0501067_0291159 3300049583 Bacteria 909
178 Ga0501073_0022941 3300049589 Bacteria 4488
179 Ga0501081_0275250 3300049743 Bacteria 1232
180 Ga0501044_0075392 3300049823 Bacteria 3425
181 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
182 nmdc:mga0rr50_431_c2 3300050513 Bacteria 18490
183 nmdc:mga0rr50_7457_c1 3300050513 Bacteria 6749
184 nmdc:mga0rr50_75202_c1 3300050513 Bacteria 2588
185 nmdc:mga08x19_345_c1 3300050514 Bacteria 21206
186 Ga0495612_0111437 3300053078 Unclassified 1171
187 Ga0495655_0001489 3300053083 Bacteria 3600
188 Ga0500616_0009205 3300053153 Bacteria 6026

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0291159 Ga0501067_0291159_110_889 247
2 3300048908 Ga0496105_0085270 Ga0496105_0085270_341_1156 269
3 3300049571 Ga0501034_0002714 Ga0501034_0002714_542_1408 273
4 3300049823 Ga0501044_0075392 Ga0501044_0075392_870_1736 273
5 3300005445 Ga0070708_100000144 Ga0070708_10000014422 274
6 3300005467 Ga0070706_100049567 Ga0070706_1000495673 274
7 3300053153 Ga0500616_0009205 Ga0500616_0009205_2463_3293 274
8 3300009093 Ga0105240_10264999 Ga0105240_102649993 277
9 3300025913 Ga0207695_10200252 Ga0207695_102002521 277
10 3300013104 Ga0157370_10421289 Ga0157370_104212891 279
11 3300009098 Ga0105245_10088745 Ga0105245_100887452 285
12 3300009176 Ga0105242_10053325 Ga0105242_100533253 285
13 3300025927 Ga0207687_10051831 Ga0207687_100518314 285
14 3300046691 Ga0495670_0207642 Ga0495670_0207642_140_1012 286
15 3300045976 Ga0466967_0016298 Ga0466967_0016298_1804_2700 287
16 3300005439 Ga0070711_100043908 Ga0070711_1000439083 288
17 3300005530 Ga0070679_100415279 Ga0070679_1004152791 288
18 3300005535 Ga0070684_100207182 Ga0070684_1002071823 288
19 3300035086 Ga0373934_0001323 Ga0373934_0001323_1249_2121 288
20 3300035119 Ga0373956_0094726 Ga0373956_0094726_11_883 288
21 3300035172 Ga0373955_0153504 Ga0373955_0153504_447_1319 288
22 3300035172 Ga0373955_0191999 Ga0373955_0191999_301_1173 288
23 3300036401 Ga0373937_0012650 Ga0373937_0012650_516_1388 288
24 3300036401 Ga0373937_0017525 Ga0373937_0017525_206_1078 288
25 3300046462 Ga0495651_0010466 Ga0495651_0010466_5730_6602 288
26 3300046463 Ga0495653_0016961 Ga0495653_0016961_3912_4784 288
27 3300046472 Ga0495580_0041449 Ga0495580_0041449_1505_2377 288
28 3300046499 Ga0495594_0026392 Ga0495594_0026392_2131_3003 288
29 3300046511 Ga0495608_0139735 Ga0495608_0139735_442_1314 288
30 3300046514 Ga0495618_0050557 Ga0495618_0050557_1209_2081 288
31 3300046516 Ga0495628_0013488 Ga0495628_0013488_2198_3070 288
32 3300046526 Ga0495666_0044472 Ga0495666_0044472_867_1739 288
33 3300046529 Ga0495652_0011974 Ga0495652_0011974_1510_2382 288
34 3300046531 Ga0495665_0019748 Ga0495665_0019748_2352_3224 288
35 3300046535 Ga0495586_0064716 Ga0495586_0064716_367_1239 288
36 3300046536 Ga0495587_0002656 Ga0495587_0002656_4345_5217 288
37 3300046543 Ga0495645_0006146 Ga0495645_0006146_6908_7780 288
38 3300046559 Ga0495667_0001842 Ga0495667_0001842_8710_9582 288
39 3300046559 Ga0495667_0305903 Ga0495667_0305903_10_882 288
40 3300046678 Ga0495599_0002701 Ga0495599_0002701_5716_6588 288
41 3300046679 Ga0495623_0010132 Ga0495623_0010132_4703_5575 288
42 3300047317 Ga0495604_0003082 Ga0495604_0003082_7084_7956 288
43 3300047319 Ga0495674_0137373 Ga0495674_0137373_579_1451 288
44 3300047444 Ga0495675_0034940 Ga0495675_0034940_1901_2773 288
45 3300047444 Ga0495675_0037551 Ga0495675_0037551_1504_2376 288
46 3300047471 Ga0495684_0008661 Ga0495684_0008661_4192_5064 288
47 3300048088 Ga0495602_0014778 Ga0495602_0014778_526_1398 288
48 3300053078 Ga0495612_0111437 Ga0495612_0111437_219_1091 288
49 3300005617 Ga0068859_100179915 Ga0068859_1001799152 290
50 3300006931 Ga0097620_100179915 Ga0097620_1001799152 290
51 3300013308 Ga0157375_10649015 Ga0157375_106490152 290
52 3300028800 Ga0265338_10172786 Ga0265338_101727861 290
53 3300046543 Ga0495645_0058001 Ga0495645_0058001_703_1584 290
54 3300046543 Ga0495645_0137354 Ga0495645_0137354_303_1184 290
55 3300046689 Ga0495613_0309357 Ga0495613_0309357_87_968 290
56 3300047317 Ga0495604_0026738 Ga0495604_0026738_209_1090 290
57 3300047444 Ga0495675_0152462 Ga0495675_0152462_84_965 290
58 3300025915 Ga0207693_10136304 Ga0207693_101363042 292
59 3300005535 Ga0070684_100014638 Ga0070684_1000146384 293
60 3300005577 Ga0068857_100238328 Ga0068857_1002383282 293
61 3300026116 Ga0207674_10286311 Ga0207674_102863112 293
62 3300046678 Ga0495599_0167219 Ga0495599_0167219_410_1315 297
63 3300005471 Ga0070698_100098036 Ga0070698_1000980362 298
64 3300005536 Ga0070697_100183319 Ga0070697_1001833192 299
65 3300042876 Ga0451577_0058571 Ga0451577_0058571_2226_3155 299
66 3300049743 Ga0501081_0275250 Ga0501081_0275250_129_1112 299
67 3300039437 Ga0436365_0128285 Ga0436365_0128285_914_1852 306
68 3300039437 Ga0436365_0535222 Ga0436365_0535222_149_1087 306
69 3300005445 Ga0070708_100086419 Ga0070708_1000864192 308
70 3300005467 Ga0070706_100022569 Ga0070706_1000225692 308
71 3300005468 Ga0070707_100024813 Ga0070707_1000248137 308
72 3300005471 Ga0070698_100149658 Ga0070698_1001496582 308
73 3300007076 Ga0075435_100010670 Ga0075435_1000106704 308
74 3300021358 Ga0213873_10000004 Ga0213873_10000004542 308
75 3300021384 Ga0213876_10000007 Ga0213876_10000007542 308
76 3300021384 Ga0213876_10022909 Ga0213876_100229092 308
77 3300039437 Ga0436365_0454781 Ga0436365_0454781_803_1729 308
78 3300050513 nmdc:mga0rr50_7457_c1 nmdc:mga0rr50_7457_c1_4538_5464 308
79 3300005329 Ga0070683_100003541 Ga0070683_1000035417 309
80 3300005330 Ga0070690_100062944 Ga0070690_1000629443 309
81 3300005331 Ga0070670_100000226 Ga0070670_1000002268 309
82 3300005333 Ga0070677_10171393 Ga0070677_101713931 309
83 3300005334 Ga0068869_100006750 Ga0068869_1000067508 309
84 3300005337 Ga0070682_100000002 Ga0070682_100000002202 309
85 3300005338 Ga0068868_100000186 Ga0068868_10000018632 309
86 3300005338 Ga0068868_100000761 Ga0068868_10000076111 309
87 3300005343 Ga0070687_100026334 Ga0070687_1000263342 309
88 3300005345 Ga0070692_10010641 Ga0070692_100106415 309
89 3300005354 Ga0070675_100000001 Ga0070675_100000001226 309
90 3300005355 Ga0070671_100142235 Ga0070671_1001422353 309
91 3300005356 Ga0070674_100065620 Ga0070674_1000656203 309
92 3300005356 Ga0070674_100246825 Ga0070674_1002468252 309
93 3300005364 Ga0070673_100201568 Ga0070673_1002015682 309
94 3300005438 Ga0070701_10000351 Ga0070701_100003514 309
95 3300005441 Ga0070700_100000018 Ga0070700_10000001838 309
96 3300005445 Ga0070708_100315726 Ga0070708_1003157261 309
97 3300005456 Ga0070678_100099512 Ga0070678_1000995123 309
98 3300005459 Ga0068867_100088382 Ga0068867_1000883823 309
99 3300005518 Ga0070699_100048901 Ga0070699_1000489014 309
100 3300005535 Ga0070684_100004351 Ga0070684_10000435113 309
101 3300005543 Ga0070672_100000271 Ga0070672_1000002715 309
102 3300005544 Ga0070686_100156907 Ga0070686_1001569072 309
103 3300005547 Ga0070693_100004010 Ga0070693_1000040107 309
104 3300005578 Ga0068854_100008372 Ga0068854_1000083726 309
105 3300005578 Ga0068854_100036916 Ga0068854_1000369162 309
106 3300005618 Ga0068864_100000064 Ga0068864_10000006468 309
107 3300005842 Ga0068858_100000685 Ga0068858_1000006857 309
108 3300006028 Ga0070717_10000467 Ga0070717_1000046712 309
109 3300006844 Ga0075428_100006628 Ga0075428_1000066282 309
110 3300006847 Ga0075431_100053478 Ga0075431_1000534782 309
111 3300006881 Ga0068865_100039735 Ga0068865_1000397353 309
112 3300006914 Ga0075436_100001048 Ga0075436_1000010483 309
113 3300007076 Ga0075435_100001265 Ga0075435_10000126516 309
114 3300007076 Ga0075435_100317650 Ga0075435_1003176501 309
115 3300009036 Ga0105244_10007796 Ga0105244_100077965 309
116 3300009093 Ga0105240_10035704 Ga0105240_100357044 309
117 3300009094 Ga0111539_10000017 Ga0111539_10000017186 309
118 3300009098 Ga0105245_10000013 Ga0105245_10000013223 309
119 3300009098 Ga0105245_10000843 Ga0105245_100008435 309
120 3300009098 Ga0105245_10003868 Ga0105245_1000386814 309
121 3300009098 Ga0105245_10359525 Ga0105245_103595252 309
122 3300009148 Ga0105243_10363200 Ga0105243_103632001 309
123 3300009176 Ga0105242_10079598 Ga0105242_100795983 309
124 3300009551 Ga0105238_10000001 Ga0105238_10000001861 309
125 3300013105 Ga0157369_10006207 Ga0157369_1000620711 309
126 3300013297 Ga0157378_10004696 Ga0157378_100046962 309
127 3300013297 Ga0157378_10021633 Ga0157378_100216332 309
128 3300013297 Ga0157378_10070023 Ga0157378_100700232 309
129 3300013297 Ga0157378_10321515 Ga0157378_103215152 309
130 3300013306 Ga0163162_10021765 Ga0163162_100217654 309
131 3300013308 Ga0157375_10000007 Ga0157375_10000007246 309
132 3300013308 Ga0157375_10000277 Ga0157375_100002775 309
133 3300013308 Ga0157375_10013923 Ga0157375_100139238 309
134 3300014325 Ga0163163_10334088 Ga0163163_103340881 309
135 3300014745 Ga0157377_10000002 Ga0157377_1000000213 309
136 3300014745 Ga0157377_10000070 Ga0157377_1000007070 309
137 3300014745 Ga0157377_10139384 Ga0157377_101393841 309
138 3300014969 Ga0157376_10000020 Ga0157376_10000020159 309
139 3300021384 Ga0213876_10000063 Ga0213876_10000063125 309
140 3300025728 Ga0207655_1040162 Ga0207655_10401623 309
141 3300025909 Ga0207705_10027391 Ga0207705_100273911 309
142 3300025913 Ga0207695_10259073 Ga0207695_102590732 309
143 3300025918 Ga0207662_10088077 Ga0207662_100880772 309
144 3300025924 Ga0207694_10000001 Ga0207694_100000011901 309
145 3300025925 Ga0207650_10000538 Ga0207650_1000053815 309
146 3300025926 Ga0207659_10000004 Ga0207659_10000004224 309
147 3300025927 Ga0207687_10000014 Ga0207687_10000014223 309
148 3300025927 Ga0207687_10001639 Ga0207687_100016398 309
149 3300025927 Ga0207687_10004909 Ga0207687_100049096 309
150 3300025928 Ga0207700_10119188 Ga0207700_101191882 309
151 3300025934 Ga0207686_10040540 Ga0207686_100405403 309
152 3300025936 Ga0207670_10000437 Ga0207670_1000043714 309
153 3300025937 Ga0207669_10044057 Ga0207669_100440573 309
154 3300025937 Ga0207669_10170321 Ga0207669_101703212 309
155 3300025938 Ga0207704_10026621 Ga0207704_100266213 309
156 3300025939 Ga0207665_10073803 Ga0207665_100738032 309
157 3300025939 Ga0207665_10103095 Ga0207665_101030952 309
158 3300025940 Ga0207691_10000594 Ga0207691_1000059434 309
159 3300025942 Ga0207689_10012143 Ga0207689_100121436 309
160 3300025944 Ga0207661_10000849 Ga0207661_1000084917 309
161 3300025960 Ga0207651_10290563 Ga0207651_102905632 309
162 3300025981 Ga0207640_10006251 Ga0207640_100062517 309
163 3300025981 Ga0207640_10024918 Ga0207640_100249184 309
164 3300026023 Ga0207677_10000004 Ga0207677_10000004272 309
165 3300026023 Ga0207677_10000009 Ga0207677_1000000963 309
166 3300026035 Ga0207703_10000453 Ga0207703_1000045328 309
167 3300026041 Ga0207639_10000008 Ga0207639_1000000883 309
168 3300026075 Ga0207708_10000005 Ga0207708_10000005229 309
169 3300026089 Ga0207648_10150803 Ga0207648_101508033 309
170 3300026089 Ga0207648_10291427 Ga0207648_102914271 309
171 3300026095 Ga0207676_10000014 Ga0207676_10000014273 309
172 3300026116 Ga0207674_10055579 Ga0207674_100555794 309
173 3300027907 Ga0207428_10000010 Ga0207428_10000010182 309
174 3300030521 Ga0307511_10008804 Ga0307511_100088042 309
175 3300031548 Ga0307408_100184788 Ga0307408_1001847881 309
176 3300035112 Ga0373932_0001571 Ga0373932_0001571_4742_5689 309
177 3300039437 Ga0436365_0374533 Ga0436365_0374533_1159_2088 309
178 3300039437 Ga0436365_0788805 Ga0436365_0788805_37568_38497 309
179 3300039437 Ga0436365_0818746 Ga0436365_0818746_81546_82493 309
180 3300039437 Ga0436365_1069130 Ga0436365_1069130_124_1053 309
181 3300039453 Ga0436362_0290430 Ga0436362_0290430_184589_185518 309
182 3300046515 Ga0495620_0001028 Ga0495620_0001028_14962_15891 309
183 3300049589 Ga0501073_0022941 Ga0501073_0022941_311_1255 309
184 3300050511 nmdc:mga08y16_15_c1 nmdc:mga08y16_15_c1_180223_181152 309
185 3300050513 nmdc:mga0rr50_431_c2 nmdc:mga0rr50_431_c2_13300_14232 309
186 3300050513 nmdc:mga0rr50_75202_c1 nmdc:mga0rr50_75202_c1_1449_2384 309
187 3300050514 nmdc:mga08x19_345_c1 nmdc:mga08x19_345_c1_17470_18402 309
188 3300053083 Ga0495655_0001489 Ga0495655_0001489_1465_2397 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01509

TruB_N

TruB family pseudouridylate synthase (N terminal domain)

55

203

0.98

PF16198

TruB_C_2

tRNA pseudouridylate synthase B C-terminal domain

204

254

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ze2-assembly1.cif.gz_A conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.8936 9 306
2ab4-assembly1.cif.gz_A dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase 0.886 9 306
1ze1-assembly4.cif.gz_D conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.8835 9 289
1ze2-assembly1.cif.gz_A conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.8767 9 306
1r3e-assembly1.cif.gz_A crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit 0.8707 9 309
ID Description Score Start End Superfamily
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9413 10 220 3.30.2350.10
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9301 8 59 3.30.2350.10
1ze1D01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.925 9 237 3.30.2350.10
3u28A02 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9215 8 220 3.30.2350.10
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9211 10 220 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A536TVW9-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9599 31 221 GO:0003723
GO:0006400
GO:0160148
GO:1990481
AF-A0A7R9AL26-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9588 106 226 GO:0003723
GO:0006400
GO:0009982
GO:1990481
AF-A0A1F4RDD4-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9585 9 213 GO:0003723
GO:0006400
GO:0160148
GO:1990481
AF-A0A7X7MHF1-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9568 5 225 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-X0RZ23-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9534 106 226 GO:0003723
GO:0006400
GO:0009982
GO:1990481

Feature Viewer

pLDDT pTM Quality
90.44 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map