F284542

General Info

Members Datasets Scaffolds Average Seq Length
185 99 370 425

Family's Representative Sequence

Representative Sequence 3300030878|Ga0265770_1000887|Ga0265770_10008872
Length 501
Sequence MRKTKSPNIEKPKADAAAARPVDSGTKAGPDAHHSPYNPDRKFTGNEAADPGRPDPAADGRSGAFGQVQVWPMDRLVFYARNPRKNDGAVDRMCSSIREFGFKCPVLARSDGEVVDGHLRLKAARKLGIGEAPVILCDEWTPAQVKAFRLLVNRSATWADWDEELLELELQELAGAECDLALTGFDPKELDDLLLNPDAEVQADAAPPLPENPASRPGDLWLCGQGDRAHRVLCADATNPQAVARLLGDRQPGLLVTDPPYGIALDAEWRDRAGLNQCGPAQASYLKQRTVGHTHTSISSDTRADWSEAFALAPGLQVAYVWHASVFTREVLDGLLRIGFLYPQQIIWNKGRTVLTRTHYWYQHEPCWYLRKKNAPWYGKAGENSTVWDSPSPKFIMGGSDEDKYDHPTQKPEALMRRPILNHTRRGELVYDPFLGSGTTLAAAQLTERICYGMELDPQYVDVVVGRWQALSGEQAYLDGDGRTFADVAEERHQQGKAEAA

Samples

Sample ID Description Type Environment
1 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 17.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265770_1000887 3300030878 Bacteria 4149
2 Ga0070683_100000005 3300005329 Bacteria 361724
3 Ga0070683_100000777 3300005329 Bacteria 23487
4 Ga0070666_10013381 3300005335 Bacteria 5203
5 Ga0070660_100015939 3300005339 Bacteria 5443
6 Ga0070667_100187900 3300005367 Bacteria 1829
7 Ga0070714_100010516 3300005435 Bacteria 7316
8 Ga0070714_100066409 3300005435 Bacteria 3109
9 Ga0070713_100020087 3300005436 Bacteria 5113
10 Ga0070705_100118677 3300005440 Bacteria 1704
11 Ga0070681_10006182 3300005458 Bacteria 11635
12 Ga0070681_10063102 3300005458 Bacteria 3678
13 Ga0070681_10167465 3300005458 Bacteria 2120
14 Ga0068867_100000016 3300005459 Bacteria 108420
15 Ga0068867_100160421 3300005459 Bacteria 1773
16 Ga0070707_100103016 3300005468 Bacteria 2766
17 Ga0070707_100128326 3300005468 Unclassified 2465
18 Ga0070699_100196672 3300005518 Bacteria 1792
19 Ga0070679_100098725 3300005530 Bacteria 2907
20 Ga0070684_100000020 3300005535 Bacteria 133471
21 Ga0070684_100000035 3300005535 Bacteria 100109
22 Ga0070696_100148855 3300005546 Viruses 1717
23 Ga0070665_100159124 3300005548 Unclassified 2260
24 Ga0070665_100312606 3300005548 Bacteria 1575
25 Ga0068855_100004636 3300005563 Bacteria 16778
26 Ga0068855_100020233 3300005563 Bacteria 7989
27 Ga0068855_100081160 3300005563 Bacteria 3759
28 Ga0068855_100206770 3300005563 Bacteria 2208
29 Ga0068855_100423998 3300005563 Unclassified 1455
30 Ga0068857_100007673 3300005577 Bacteria 9294
31 Ga0068857_100030383 3300005577 Bacteria 4771
32 Ga0068857_100112415 3300005577 Bacteria 2448
33 Ga0068856_100180809 3300005614 Unclassified 2122
34 Ga0068859_100061963 3300005617 Bacteria 3769
35 Ga0068863_100017714 3300005841 Bacteria 6819
36 Ga0068863_100153004 3300005841 Bacteria 2208
37 Ga0068860_100136728 3300005843 Unclassified 2353
38 Ga0070717_10063562 3300006028 Unclassified 3064
39 Ga0097621_100030301 3300006237 Bacteria 4282
40 Ga0068871_100022757 3300006358 Bacteria 4836
41 Ga0068871_100126670 3300006358 Bacteria 2162
42 Ga0068871_100202165 3300006358 Bacteria 1715
43 Ga0068865_100134913 3300006881 Bacteria 1853
44 Ga0075436_100002074 3300006914 Bacteria 13827
45 Ga0097620_100030553 3300006931 Bacteria 5407
46 Ga0097620_100061968 3300006931 Bacteria 3769
47 Ga0105240_10006783 3300009093 Bacteria 16748
48 Ga0105240_10017419 3300009093 Bacteria 9682
49 Ga0105240_10041627 3300009093 Bacteria 5861
50 Ga0105240_10113765 3300009093 Bacteria 3270
51 Ga0105240_10223251 3300009093 Bacteria 2194
52 Ga0105240_10274054 3300009093 Bacteria 1941
53 Ga0105245_10012499 3300009098 Bacteria 7388
54 Ga0105245_10017319 3300009098 Bacteria 6285
55 Ga0105245_10231408 3300009098 Bacteria 1788
56 Ga0105243_10000380 3300009148 Bacteria 47703
57 Ga0105242_10020663 3300009176 Bacteria 5164
58 Ga0105242_10043665 3300009176 Bacteria 3626
59 Ga0105242_10083253 3300009176 Bacteria 2679
60 Ga0105242_10172123 3300009176 Bacteria 1904
61 Ga0105248_10068998 3300009177 Bacteria 3969
62 Ga0105248_10088853 3300009177 Unclassified 3478
63 Ga0105237_10250833 3300009545 Bacteria 1772
64 Ga0105238_10001075 3300009551 Bacteria 27604
65 Ga0105238_10001452 3300009551 Bacteria 23791
66 Ga0105238_10006648 3300009551 Bacteria 11527
67 Ga0105238_10009504 3300009551 Bacteria 9731
68 Ga0105238_10018915 3300009551 Bacteria 7015
69 Ga0105238_10026352 3300009551 Bacteria 5926
70 Ga0105238_10031865 3300009551 Bacteria 5364
71 Ga0105238_10167915 3300009551 Bacteria 2170
72 Ga0105239_10131438 3300010375 Bacteria 2785
73 Ga0105246_10155778 3300011119 Unclassified 1735
74 Ga0157370_10001248 3300013104 Bacteria 31761
75 Ga0157370_10007554 3300013104 Bacteria 11810
76 Ga0157370_10044004 3300013104 Unclassified 4295
77 Ga0157369_10015965 3300013105 Bacteria 8449
78 Ga0157369_10026997 3300013105 Bacteria 6367
79 Ga0157374_10166581 3300013296 Unclassified 2148
80 Ga0157378_10005054 3300013297 Bacteria 11582
81 Ga0157378_10054765 3300013297 Bacteria 3552
82 Ga0157378_10054964 3300013297 Viruses 3546
83 Ga0157378_10106515 3300013297 Bacteria 2565
84 Ga0163162_10118799 3300013306 Bacteria 2746
85 Ga0157372_10218590 3300013307 Bacteria 2209
86 Ga0157375_10002906 3300013308 Bacteria 14854
87 Ga0157375_10054059 3300013308 Bacteria 3954
88 Ga0157375_10214023 3300013308 Unclassified 2085
89 Ga0163163_10000719 3300014325 Bacteria 28058
90 Ga0163163_10013322 3300014325 Bacteria 7524
91 Ga0163163_10088275 3300014325 Bacteria 3112
92 Ga0157377_10000006 3300014745 Bacteria 419853
93 Ga0157376_10082443 3300014969 Bacteria 2763
94 Ga0207705_10009731 3300025909 Bacteria 6993
95 Ga0207707_10002153 3300025912 Bacteria 17817
96 Ga0207695_10002327 3300025913 Bacteria 28332
97 Ga0207695_10002888 3300025913 Bacteria 24895
98 Ga0207695_10122628 3300025913 Bacteria 2565
99 Ga0207671_10081691 3300025914 Bacteria 2424
100 Ga0207646_10045999 3300025922 Bacteria 3916
101 Ga0207646_10093609 3300025922 Bacteria 2691
102 Ga0207694_10010537 3300025924 Bacteria 6973
103 Ga0207694_10018880 3300025924 Bacteria 5212
104 Ga0207694_10020018 3300025924 Bacteria 5062
105 Ga0207694_10059744 3300025924 Bacteria 2966
106 Ga0207694_10072273 3300025924 Unclassified 2697
107 Ga0207694_10143502 3300025924 Bacteria 1921
108 Ga0207687_10007431 3300025927 Bacteria 7213
109 Ga0207687_10055846 3300025927 Unclassified 2768
110 Ga0207687_10148052 3300025927 Bacteria 1788
111 Ga0207700_10014822 3300025928 Bacteria 5120
112 Ga0207664_10072733 3300025929 Viruses 2772
113 Ga0207644_10016380 3300025931 Bacteria 4987
114 Ga0207686_10016260 3300025934 Bacteria 4173
115 Ga0207686_10073332 3300025934 Bacteria 2208
116 Ga0207686_10075081 3300025934 Bacteria 2187
117 Ga0207686_10075167 3300025934 Bacteria 2186
118 Ga0207686_10123116 3300025934 Bacteria 1768
119 Ga0207709_10000347 3300025935 Bacteria 47598
120 Ga0207691_10185071 3300025940 Viruses 1819
121 Ga0207661_10000024 3300025944 Bacteria 197376
122 Ga0207661_10000494 3300025944 Bacteria 25351
123 Ga0207679_10218883 3300025945 Unclassified 1601
124 Ga0207667_10000786 3300025949 Bacteria 41214
125 Ga0207667_10000814 3300025949 Bacteria 40498
126 Ga0207667_10306668 3300025949 Bacteria 1622
127 Ga0207667_10337247 3300025949 Unclassified 1539
128 Ga0207712_10104856 3300025961 Bacteria 2109
129 Ga0207658_10274143 3300025986 Bacteria 1443
130 Ga0207703_10057444 3300026035 Bacteria 3173
131 Ga0207639_10112267 3300026041 Unclassified 2224
132 Ga0207702_10065412 3300026078 Unclassified 3114
133 Ga0207641_10041832 3300026088 Unclassified 3842
134 Ga0207641_10048826 3300026088 Unclassified 3574
135 Ga0207641_10114793 3300026088 Bacteria 2393
136 Ga0207641_10134699 3300026088 Unclassified 2222
137 Ga0207648_10000023 3300026089 Bacteria 134519
138 Ga0207648_10152180 3300026089 Bacteria 2041
139 Ga0207676_10037234 3300026095 Unclassified 3706
140 Ga0207674_10001392 3300026116 Bacteria 31157
141 Ga0207674_10014427 3300026116 Bacteria 8728
142 Ga0207675_100027408 3300026118 Bacteria 5306
143 Ga0268266_10048096 3300028379 Bacteria 3655
144 Ga0268264_10107063 3300028381 Bacteria 2442
145 Ga0265330_10000607 3300031235 Bacteria 23223
146 Ga0265316_10056237 3300031344 Bacteria 3074
147 Ga0265313_10002498 3300031595 Bacteria 15837
148 Ga0265313_10009991 3300031595 Bacteria 6077
149 Ga0373953_0050340 3300035117 Unclassified 1682
150 Ga0373927_0009030 3300035695 Bacteria 6694
151 Ga0373927_0104578 3300035695 Bacteria 1843
152 Ga0373927_0109429 3300035695 Bacteria 1800
153 Ga0373947_0025290 3300035725 Unclassified 3462
154 Ga0373947_0053437 3300035725 Unclassified 2436
155 Ga0373937_0009473 3300036401 Bacteria 8466
156 Ga0373925_0000809 3300037068 Bacteria 28846
157 Ga0373925_0109074 3300037068 Unclassified 2136
158 Ga0451802_1232938 3300041460 Bacteria 1756
159 Ga0451576_0176751 3300045051 Unclassified 2229
160 Ga0495592_0092497 3300046454 Bacteria 2167
161 Ga0495592_0139763 3300046454 Bacteria 1685
162 Ga0495592_0176944 3300046454 Unclassified 1456
163 Ga0495580_0003529 3300046472 Bacteria 13288
164 Ga0495580_0048345 3300046472 Unclassified 3013
165 Ga0495580_0115924 3300046472 Bacteria 1860
166 Ga0495628_0187594 3300046516 Unclassified 1562
167 Ga0495630_0138465 3300046517 Bacteria 1850
168 Ga0495652_0133590 3300046529 Bacteria 1961
169 Ga0495587_0012387 3300046536 Bacteria 5369
170 Ga0495587_0017592 3300046536 Bacteria 4440
171 Ga0495587_0020614 3300046536 Bacteria 4066
172 Ga0495587_0141388 3300046536 Unclassified 1374
173 Ga0495599_0046587 3300046678 Viruses 2719
174 Ga0495623_0036902 3300046679 Viruses 3131
175 Ga0495680_0150130 3300047322 Unclassified 1700
176 Ga0495684_0068566 3300047471 Bacteria 2697
177 Ga0495684_0121138 3300047471 Viruses 1970
178 Ga0495602_0012021 3300048088 Bacteria 8925
179 Ga0495602_0024058 3300048088 Bacteria 5915
180 Ga0495602_0048837 3300048088 Bacteria 3797
181 Ga0496115_0103370 3300048918 Bacteria 2337
182 Ga0496115_0147530 3300048918 Bacteria 1942
183 nmdc:mga0qj67_88103_c1 3300050509 Unclassified 2492
184 nmdc:mga08x19_549_c1 3300050514 Bacteria 24629
185 nmdc:mga08x19_9518_c1 3300050514 Bacteria 5818
186 Ga0265770_1000887
187 Ga0070683_100000005
188 Ga0070683_100000777
189 Ga0070666_10013381
190 Ga0070660_100015939
191 Ga0070667_100187900
192 Ga0070714_100010516
193 Ga0070714_100066409
194 Ga0070713_100020087
195 Ga0070705_100118677
196 Ga0070681_10006182
197 Ga0070681_10063102
198 Ga0070681_10167465
199 Ga0068867_100000016
200 Ga0068867_100160421
201 Ga0070707_100103016
202 Ga0070707_100128326
203 Ga0070699_100196672
204 Ga0070679_100098725
205 Ga0070684_100000020
206 Ga0070684_100000035
207 Ga0070696_100148855
208 Ga0070665_100159124
209 Ga0070665_100312606
210 Ga0068855_100004636
211 Ga0068855_100020233
212 Ga0068855_100081160
213 Ga0068855_100206770
214 Ga0068855_100423998
215 Ga0068857_100007673
216 Ga0068857_100030383
217 Ga0068857_100112415
218 Ga0068856_100180809
219 Ga0068859_100061963
220 Ga0068863_100017714
221 Ga0068863_100153004
222 Ga0068860_100136728
223 Ga0070717_10063562
224 Ga0097621_100030301
225 Ga0068871_100022757
226 Ga0068871_100126670
227 Ga0068871_100202165
228 Ga0068865_100134913
229 Ga0075436_100002074
230 Ga0097620_100030553
231 Ga0097620_100061968
232 Ga0105240_10006783
233 Ga0105240_10017419
234 Ga0105240_10041627
235 Ga0105240_10113765
236 Ga0105240_10223251
237 Ga0105240_10274054
238 Ga0105245_10012499
239 Ga0105245_10017319
240 Ga0105245_10231408
241 Ga0105243_10000380
242 Ga0105242_10020663
243 Ga0105242_10043665
244 Ga0105242_10083253
245 Ga0105242_10172123
246 Ga0105248_10068998
247 Ga0105248_10088853
248 Ga0105237_10250833
249 Ga0105238_10001075
250 Ga0105238_10001452
251 Ga0105238_10006648
252 Ga0105238_10009504
253 Ga0105238_10018915
254 Ga0105238_10026352
255 Ga0105238_10031865
256 Ga0105238_10167915
257 Ga0105239_10131438
258 Ga0105246_10155778
259 Ga0157370_10001248
260 Ga0157370_10007554
261 Ga0157370_10044004
262 Ga0157369_10015965
263 Ga0157369_10026997
264 Ga0157374_10166581
265 Ga0157378_10005054
266 Ga0157378_10054765
267 Ga0157378_10054964
268 Ga0157378_10106515
269 Ga0163162_10118799
270 Ga0157372_10218590
271 Ga0157375_10002906
272 Ga0157375_10054059
273 Ga0157375_10214023
274 Ga0163163_10000719
275 Ga0163163_10013322
276 Ga0163163_10088275
277 Ga0157377_10000006
278 Ga0157376_10082443
279 Ga0207705_10009731
280 Ga0207707_10002153
281 Ga0207695_10002327
282 Ga0207695_10002888
283 Ga0207695_10122628
284 Ga0207671_10081691
285 Ga0207646_10045999
286 Ga0207646_10093609
287 Ga0207694_10010537
288 Ga0207694_10018880
289 Ga0207694_10020018
290 Ga0207694_10059744
291 Ga0207694_10072273
292 Ga0207694_10143502
293 Ga0207687_10007431
294 Ga0207687_10055846
295 Ga0207687_10148052
296 Ga0207700_10014822
297 Ga0207664_10072733
298 Ga0207644_10016380
299 Ga0207686_10016260
300 Ga0207686_10073332
301 Ga0207686_10075081
302 Ga0207686_10075167
303 Ga0207686_10123116
304 Ga0207709_10000347
305 Ga0207691_10185071
306 Ga0207661_10000024
307 Ga0207661_10000494
308 Ga0207679_10218883
309 Ga0207667_10000786
310 Ga0207667_10000814
311 Ga0207667_10306668
312 Ga0207667_10337247
313 Ga0207712_10104856
314 Ga0207658_10274143
315 Ga0207703_10057444
316 Ga0207639_10112267
317 Ga0207702_10065412
318 Ga0207641_10041832
319 Ga0207641_10048826
320 Ga0207641_10114793
321 Ga0207641_10134699
322 Ga0207648_10000023
323 Ga0207648_10152180
324 Ga0207676_10037234
325 Ga0207674_10001392
326 Ga0207674_10014427
327 Ga0207675_100027408
328 Ga0268266_10048096
329 Ga0268264_10107063
330 Ga0265330_10000607
331 Ga0265316_10056237
332 Ga0265313_10002498
333 Ga0265313_10009991
334 Ga0373953_0050340
335 Ga0373927_0009030
336 Ga0373927_0104578
337 Ga0373927_0109429
338 Ga0373947_0025290
339 Ga0373947_0053437
340 Ga0373937_0009473
341 Ga0373925_0000809
342 Ga0373925_0109074
343 Ga0451802_1232938
344 Ga0451576_0176751
345 Ga0495592_0092497
346 Ga0495592_0139763
347 Ga0495592_0176944
348 Ga0495580_0003529
349 Ga0495580_0048345
350 Ga0495580_0115924
351 Ga0495628_0187594
352 Ga0495630_0138465
353 Ga0495652_0133590
354 Ga0495587_0012387
355 Ga0495587_0017592
356 Ga0495587_0020614
357 Ga0495587_0141388
358 Ga0495599_0046587
359 Ga0495623_0036902
360 Ga0495680_0150130
361 Ga0495684_0068566
362 Ga0495684_0121138
363 Ga0495602_0012021
364 Ga0495602_0024058
365 Ga0495602_0048837
366 Ga0496115_0103370
367 Ga0496115_0147530
368 nmdc:mga0qj67_88103_c1
369 nmdc:mga08x19_549_c1
370 nmdc:mga08x19_9518_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

70

153

0.91

PF01555

N6_N4_Mtase

DNA methylase

253

466

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8065 175 429
5hek-assembly3.cif.gz_B crystal structure of m1.hpyavi 0.7971 175 429
5hfj-assembly2.cif.gz_C crystal structure of m1.hpyavi-sam complex 0.7866 175 429
5hfj-assembly3.cif.gz_H crystal structure of m1.hpyavi-sam complex 0.7827 175 429
5hfj-assembly2.cif.gz_E crystal structure of m1.hpyavi-sam complex 0.7813 175 430
ID Description Score Start End Superfamily
af_P76068_1_87_3.90.1530.10 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain 0.9161 8 93 3.90.1530.10
af_Q58120_177_350_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.875 369 433 3.40.50.150
af_P76068_1_87_3.90.1530.10 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain 0.847 8 93 3.90.1530.10
af_P9WJZ3_50_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8185 375 433 3.40.50.150
af_Q10838_7_172_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8176 375 430 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E0SNN0-F1-model_v4 Chromosome partitioning protein ParB 0.9609 9 104 GO:0005694
GO:0007059
GO:0045881
AF-A0A2E0SNN0-F1-model_v4 Chromosome partitioning protein ParB 0.9408 9 104 GO:0005694
GO:0007059
GO:0045881
AF-A0A2Y9C979-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9302 294 459 GO:0003677
GO:0008170
GO:0032259
AF-A0A061JFM6-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9245 279 450 GO:0003677
GO:0008170
GO:0009007
GO:0032259
AF-A0A7Y5PX86-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9236 279 455 GO:0003677
GO:0008170
GO:0032259

Map