F283778

General Info

Members Datasets Scaffolds Average Seq Length
185 133 185 213

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100000023|Ga0070682_10000002378
Length 233
Sequence VNNPLVPADYRLGMVPTLDELVVADAPAAWRACGFEVEGDVCVVGDVRIRLAPSGGGKGLTGWSLRDIGTTELDGLVTARSERPSPSEHPVHPNGVTALDHVVAISSDLDRTVATLRAAGLDLRRIREEPTPVGAPRQAFFRLGEPILEVVQAPAEAIERTGGDRPAFFWGLAFVAPDLDATVATLGDRVSEARDAVQPGRRIATLRRAAGLSLPLALITPPLSPRPPLGAGP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
132 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
133 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 8.65
Rhizosphere 88.65
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100002137 3300005329 Bacteria 15618
2 Ga0070677_10000002 3300005333 Bacteria 87295
3 Ga0070680_100268945 3300005336 Bacteria 1443
4 Ga0070682_100000023 3300005337 Bacteria 206016
5 Ga0068868_100004195 3300005338 Bacteria 10077
6 Ga0068868_100190848 3300005338 Unclassified 1704
7 Ga0070689_100138241 3300005340 Bacteria 1957
8 Ga0070661_100000004 3300005344 Bacteria 243876
9 Ga0070692_10020097 3300005345 Bacteria 3233
10 Ga0070674_100000002 3300005356 Bacteria 271088
11 Ga0070674_100189828 3300005356 Bacteria 1580
12 Ga0070688_100000126 3300005365 Bacteria 40695
13 Ga0070688_100421101 3300005365 Unclassified 992
14 Ga0070659_100036564 3300005366 Bacteria 3828
15 Ga0070659_100449347 3300005366 Bacteria 1093
16 Ga0070713_100000005 3300005436 Bacteria 201526
17 Ga0070713_100146682 3300005436 Bacteria 2095
18 Ga0070710_10000012 3300005437 Bacteria 124056
19 Ga0070663_100435110 3300005455 Bacteria 1078
20 Ga0070663_100457518 3300005455 Bacteria 1053
21 Ga0070662_100000006 3300005457 Bacteria 169366
22 Ga0070681_10038914 3300005458 Bacteria 4768
23 Ga0070685_10000195 3300005466 Bacteria 40644
24 Ga0070685_10058798 3300005466 Bacteria 2242
25 Ga0070679_100002833 3300005530 Bacteria 15766
26 Ga0070684_100024445 3300005535 Bacteria 5069
27 Ga0070684_100081407 3300005535 Bacteria 2865
28 Ga0070684_100293425 3300005535 Bacteria 1491
29 Ga0068853_100000104 3300005539 Bacteria 56511
30 Ga0068853_100067929 3300005539 Bacteria 3098
31 Ga0070672_100000032 3300005543 Bacteria 62011
32 Ga0070686_100058500 3300005544 Bacteria 2480
33 Ga0070665_100450840 3300005548 Bacteria 1296
34 Ga0070664_100095832 3300005564 Bacteria 2574
35 Ga0068854_100002639 3300005578 Bacteria 11112
36 Ga0068852_100114028 3300005616 Bacteria 2462
37 Ga0068864_100000178 3300005618 Bacteria 58416
38 Ga0068866_10001711 3300005718 Bacteria 9226
39 Ga0068866_10118070 3300005718 Bacteria 1490
40 Ga0068861_100125394 3300005719 Unclassified 2077
41 Ga0068863_100001610 3300005841 Bacteria 22316
42 Ga0070712_100002154 3300006175 Bacteria 12116
43 Ga0075433_10016345 3300006852 Bacteria 6112
44 Ga0105240_10149703 3300009093 Bacteria 2781
45 Ga0105245_10000040 3300009098 Bacteria 144005
46 Ga0105245_10000587 3300009098 Bacteria 32974
47 Ga0105243_10045554 3300009148 Bacteria 3447
48 Ga0105241_10126502 3300009174 Bacteria 2064
49 Ga0105242_10053209 3300009176 Bacteria 3305
50 Ga0105249_10000150 3300009553 Bacteria 88154
51 Ga0105249_10464244 3300009553 Unclassified 1306
52 Ga0105246_10010366 3300011119 Bacteria 5765
53 Ga0157374_10000692 3300013296 Bacteria 29700
54 Ga0157374_10185252 3300013296 Bacteria 2035
55 Ga0157378_10005366 3300013297 Bacteria 11244
56 Ga0157375_10015246 3300013308 Bacteria 6877
57 Ga0157375_10256623 3300013308 Bacteria 1910
58 Ga0157380_10000007 3300014326 Bacteria 157634
59 Ga0157380_10000427 3300014326 Bacteria 25606
60 Ga0157380_10362733 3300014326 Bacteria 1360
61 Ga0157380_10674904 3300014326 Bacteria 1034
62 Ga0157379_10014189 3300014968 Bacteria 6987
63 Ga0207682_10000012 3300025893 Bacteria 84521
64 Ga0207692_10000012 3300025898 Bacteria 104402
65 Ga0207642_10000108 3300025899 Bacteria 22373
66 Ga0207642_10063871 3300025899 Bacteria 1723
67 Ga0207695_10230341 3300025913 Bacteria 1757
68 Ga0207693_10002209 3300025915 Bacteria 16974
69 Ga0207649_10000003 3300025920 Bacteria 388908
70 Ga0207652_10000080 3300025921 Bacteria 104739
71 Ga0207687_10000046 3300025927 Bacteria 99576
72 Ga0207687_10000075 3300025927 Bacteria 71856
73 Ga0207700_10000003 3300025928 Bacteria 500797
74 Ga0207700_10020832 3300025928 Bacteria 4463
75 Ga0207690_10023723 3300025932 Bacteria 3833
76 Ga0207706_10000017 3300025933 Bacteria 169589
77 Ga0207686_10000212 3300025934 Bacteria 44261
78 Ga0207686_10014317 3300025934 Bacteria 4412
79 Ga0207709_10024790 3300025935 Bacteria 3429
80 Ga0207670_10151180 3300025936 Unclassified 1723
81 Ga0207669_10000003 3300025937 Bacteria 252239
82 Ga0207691_10000002 3300025940 Bacteria 189785
83 Ga0207661_10000239 3300025944 Bacteria 36056
84 Ga0207679_10147697 3300025945 Bacteria 1909
85 Ga0207712_10000027 3300025961 Bacteria 263739
86 Ga0207712_10258863 3300025961 Unclassified 1410
87 Ga0207640_10001937 3300025981 Bacteria 11147
88 Ga0207677_10003228 3300026023 Bacteria 8608
89 Ga0207677_10018815 3300026023 Bacteria 4155
90 Ga0207639_10000644 3300026041 Bacteria 24030
91 Ga0207639_10064441 3300026041 Bacteria 2841
92 Ga0207702_10875015 3300026078 Bacteria 890
93 Ga0207641_10004106 3300026088 Bacteria 12687
94 Ga0207676_10000016 3300026095 Bacteria 311561
95 Ga0207675_100236543 3300026118 Unclassified 1764
96 Ga0307408_100172562 3300031548 Unclassified 1728
97 Ga0373953_0287501 3300035117 Bacteria 717
98 Ga0373937_0053052 3300036401 Bacteria 3719
99 Ga0451853_3957662 3300041512 Bacteria 9070
100 Ga0466963_0000011 3300044694 Bacteria 65918
101 Ga0466958_0015687 3300045836 Bacteria 4348
102 Ga0495592_0000024 3300046454 Bacteria 136661
103 Ga0495629_0001902 3300046459 Bacteria 16259
104 Ga0495629_0190073 3300046459 Bacteria 1421
105 Ga0495641_0000040 3300046461 Bacteria 82337
106 Ga0495641_0057775 3300046461 Bacteria 1757
107 Ga0495651_0026703 3300046462 Bacteria 4497
108 Ga0495651_0202662 3300046462 Bacteria 1387
109 Ga0495653_0143588 3300046463 Bacteria 1676
110 Ga0495662_0000010 3300046476 Bacteria 70156
111 Ga0495662_0002121 3300046476 Bacteria 9950
112 Ga0495594_0000034 3300046499 Bacteria 62318
113 Ga0495608_0000035 3300046511 Bacteria 133011
114 Ga0495618_0000026 3300046514 Bacteria 113266
115 Ga0495620_0000041 3300046515 Bacteria 112605
116 Ga0495628_0056755 3300046516 Bacteria 3081
117 Ga0495630_0034819 3300046517 Bacteria 3762
118 Ga0495630_0035614 3300046517 Unclassified 3719
119 Ga0495630_0048191 3300046517 Bacteria 3189
120 Ga0495640_0058488 3300046533 Bacteria 2629
121 Ga0495586_0019545 3300046535 Bacteria 3607
122 Ga0495587_0006510 3300046536 Bacteria 7611
123 Ga0495622_0001011 3300046557 Bacteria 15050
124 Ga0495634_0000908 3300046642 Bacteria 28256
125 Ga0495634_0010730 3300046642 Bacteria 6704
126 Ga0495634_0090852 3300046642 Bacteria 1983
127 Ga0495634_0206635 3300046642 Bacteria 1217
128 Ga0495657_0000026 3300046675 Bacteria 133011
129 Ga0495657_0001298 3300046675 Bacteria 21744
130 Ga0495647_0000004 3300046681 Bacteria 140700
131 Ga0495647_0016674 3300046681 Unclassified 2589
132 Ga0495613_0000021 3300046689 Bacteria 159188
133 Ga0495613_0000027 3300046689 Bacteria 146674
134 Ga0495624_0000007 3300046690 Bacteria 146202
135 Ga0495670_0002537 3300046691 Bacteria 9021
136 Ga0495649_0005608 3300046694 Bacteria 7939
137 Ga0495600_0002128 3300046809 Bacteria 11215
138 Ga0495600_0013656 3300046809 Bacteria 5110
139 Ga0495600_0054199 3300046809 Bacteria 2619
140 Ga0495604_0000058 3300047317 Bacteria 96955
141 Ga0495604_0009520 3300047317 Bacteria 7681
142 Ga0495604_0050372 3300047317 Bacteria 3234
143 Ga0495676_0001370 3300047321 Bacteria 20976
144 Ga0495680_0000007 3300047322 Bacteria 152053
145 Ga0495680_0000617 3300047322 Bacteria 40072
146 Ga0495680_0177086 3300047322 Bacteria 1541
147 Ga0495675_0000015 3300047444 Bacteria 133004
148 Ga0495679_012977 3300047446 Bacteria 3147
149 Ga0495685_018576 3300047447 Bacteria 2387
150 Ga0495602_0000393 3300048088 Bacteria 40803
151 Ga0496100_0228633 3300048903 Bacteria 1368
152 Ga0496102_0000075 3300048905 Bacteria 147013
153 Ga0496103_0000107 3300048906 Bacteria 91213
154 Ga0496104_0000008 3300048907 Bacteria 516976
155 Ga0496104_0126123 3300048907 Bacteria 2458
156 Ga0496105_0000003 3300048908 Bacteria 713251
157 Ga0496106_0000042 3300048909 Bacteria 106662
158 Ga0496108_0000005 3300048911 Bacteria 535059
159 Ga0496108_0000039 3300048911 Bacteria 149440
160 Ga0496108_0013306 3300048911 Bacteria 6708
161 Ga0496109_0000002 3300048912 Bacteria 443393
162 Ga0496109_0000038 3300048912 Bacteria 150745
163 Ga0496109_0000066 3300048912 Bacteria 112004
164 Ga0496113_0038189 3300048916 Bacteria 3530
165 Ga0496113_0092348 3300048916 Bacteria 2335
166 Ga0496114_0003225 3300048917 Bacteria 12508
167 Ga0496117_0226872 3300048920 Bacteria 1035
168 Ga0501039_0577959 3300049575 Bacteria 881
169 Ga0501042_0055016 3300049578 Bacteria 2839
170 Ga0501071_0109799 3300049587 Bacteria 2038
171 Ga0501072_0033334 3300049588 Bacteria 4036
172 Ga0501075_0000711 3300049591 Bacteria 20613
173 Ga0501076_0248693 3300049592 Bacteria 1455
174 nmdc:mga0a205_24_c1 3300050515 Bacteria 6155
175 Ga0495601_0000017 3300053077 Bacteria 204209
176 Ga0495601_0000022 3300053077 Bacteria 148418
177 Ga0495612_0024942 3300053078 Bacteria 2401
178 Ga0495655_0000005 3300053083 Bacteria 257472
179 Ga0495595_0000017 3300053084 Bacteria 133011
180 Ga0495595_0014336 3300053084 Bacteria 3361
181 Ga0495619_0000101 3300053085 Bacteria 64377
182 Ga0495619_0154911 3300053085 Bacteria 1581
183 Ga0500566_0003373 3300053094 Bacteria 9535
184 Ga0500614_000472 3300053123 Bacteria 10425
185 Ga0500628_000013 3300053129 Bacteria 106419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10149703 Ga0105240_101497032 181
2 3300013296 Ga0157374_10185252 Ga0157374_101852522 181
3 3300025913 Ga0207695_10230341 Ga0207695_102303412 181
4 3300011119 Ga0105246_10010366 Ga0105246_100103665 188
5 3300005437 Ga0070710_10000012 Ga0070710_1000001234 189
6 3300005841 Ga0068863_100001610 Ga0068863_10000161020 189
7 3300025898 Ga0207692_10000012 Ga0207692_10000012111 189
8 3300026088 Ga0207641_10004106 Ga0207641_100041064 189
9 3300005535 Ga0070684_100293425 Ga0070684_1002934253 190
10 3300005564 Ga0070664_100095832 Ga0070664_1000958322 190
11 3300048911 Ga0496108_0000005 Ga0496108_0000005_319249_319875 193
12 3300048912 Ga0496109_0000002 Ga0496109_0000002_215217_215843 193
13 3300014326 Ga0157380_10000007 Ga0157380_10000007123 195
14 3300046463 Ga0495653_0143588 Ga0495653_0143588_604_1230 197
15 3300013308 Ga0157375_10015246 Ga0157375_100152465 200
16 3300005543 Ga0070672_100000032 Ga0070672_10000003210 201
17 3300025940 Ga0207691_10000002 Ga0207691_1000000250 201
18 3300005356 Ga0070674_100189828 Ga0070674_1001898281 203
19 3300048909 Ga0496106_0000042 Ga0496106_0000042_24_635 203
20 3300046675 Ga0495657_0001298 Ga0495657_0001298_18373_18987 204
21 3300053085 Ga0495619_0154911 Ga0495619_0154911_473_1270 204
22 3300006852 Ga0075433_10016345 Ga0075433_100163454 205
23 3300014326 Ga0157380_10674904 Ga0157380_106749042 205
24 3300050515 nmdc:mga0a205_24_c1 nmdc:mga0a205_24_c1_3044_3685 205
25 3300005457 Ga0070662_100000006 Ga0070662_10000000615 207
26 3300025933 Ga0207706_10000017 Ga0207706_1000001715 207
27 3300049591 Ga0501075_0000711 Ga0501075_0000711_11482_12105 207
28 3300005338 Ga0068868_100004195 Ga0068868_1000041954 208
29 3300005345 Ga0070692_10020097 Ga0070692_100200973 208
30 3300005365 Ga0070688_100000126 Ga0070688_10000012632 208
31 3300005455 Ga0070663_100457518 Ga0070663_1004575182 208
32 3300005466 Ga0070685_10000195 Ga0070685_1000019532 208
33 3300005616 Ga0068852_100114028 Ga0068852_1001140282 208
34 3300026023 Ga0207677_10018815 Ga0207677_100188152 208
35 3300046476 Ga0495662_0002121 Ga0495662_0002121_4449_5075 208
36 3300046499 Ga0495594_0000034 Ga0495594_0000034_54913_55539 208
37 3300046557 Ga0495622_0001011 Ga0495622_0001011_11077_11703 208
38 3300048911 Ga0496108_0013306 Ga0496108_0013306_1812_2438 208
39 3300048912 Ga0496109_0000066 Ga0496109_0000066_75071_75697 208
40 3300048916 Ga0496113_0092348 Ga0496113_0092348_301_993 208
41 3300005338 Ga0068868_100190848 Ga0068868_1001908484 209
42 3300005455 Ga0070663_100435110 Ga0070663_1004351102 209
43 3300009148 Ga0105243_10045554 Ga0105243_100455543 209
44 3300009174 Ga0105241_10126502 Ga0105241_101265022 209
45 3300013297 Ga0157378_10005366 Ga0157378_100053666 209
46 3300014326 Ga0157380_10362733 Ga0157380_103627333 209
47 3300025935 Ga0207709_10024790 Ga0207709_100247903 209
48 3300026023 Ga0207677_10003228 Ga0207677_100032284 209
49 3300031548 Ga0307408_100172562 Ga0307408_1001725622 209
50 3300046459 Ga0495629_0190073 Ga0495629_0190073_738_1367 209
51 3300046461 Ga0495641_0057775 Ga0495641_0057775_1042_1671 209
52 3300046533 Ga0495640_0058488 Ga0495640_0058488_739_1368 209
53 3300046642 Ga0495634_0090852 Ga0495634_0090852_130_759 209
54 3300046642 Ga0495634_0206635 Ga0495634_0206635_501_1130 209
55 3300047317 Ga0495604_0050372 Ga0495604_0050372_1885_2514 209
56 3300047447 Ga0495685_018576 Ga0495685_018576_691_1320 209
57 3300005333 Ga0070677_10000002 Ga0070677_1000000244 210
58 3300005340 Ga0070689_100138241 Ga0070689_1001382413 210
59 3300005365 Ga0070688_100421101 Ga0070688_1004211011 210
60 3300005436 Ga0070713_100146682 Ga0070713_1001466821 210
61 3300005466 Ga0070685_10058798 Ga0070685_100587982 210
62 3300005535 Ga0070684_100024445 Ga0070684_1000244454 210
63 3300005544 Ga0070686_100058500 Ga0070686_1000585002 210
64 3300005578 Ga0068854_100002639 Ga0068854_1000026399 210
65 3300005718 Ga0068866_10118070 Ga0068866_101180702 210
66 3300006175 Ga0070712_100002154 Ga0070712_1000021548 210
67 3300009553 Ga0105249_10000150 Ga0105249_1000015038 210
68 3300014968 Ga0157379_10014189 Ga0157379_100141894 210
69 3300025893 Ga0207682_10000012 Ga0207682_1000001224 210
70 3300025915 Ga0207693_10002209 Ga0207693_100022098 210
71 3300025928 Ga0207700_10020832 Ga0207700_100208322 210
72 3300025936 Ga0207670_10151180 Ga0207670_101511802 210
73 3300025944 Ga0207661_10000239 Ga0207661_1000023935 210
74 3300025945 Ga0207679_10147697 Ga0207679_101476972 210
75 3300025961 Ga0207712_10000027 Ga0207712_1000002755 210
76 3300025981 Ga0207640_10001937 Ga0207640_100019373 210
77 3300045836 Ga0466958_0015687 Ga0466958_0015687_1405_2037 210
78 3300046511 Ga0495608_0000035 Ga0495608_0000035_132230_132862 210
79 3300046515 Ga0495620_0000041 Ga0495620_0000041_85005_85640 210
80 3300046675 Ga0495657_0000026 Ga0495657_0000026_150_782 210
81 3300046690 Ga0495624_0000007 Ga0495624_0000007_88344_88982 210
82 3300047444 Ga0495675_0000015 Ga0495675_0000015_143_775 210
83 3300048903 Ga0496100_0228633 Ga0496100_0228633_490_1122 210
84 3300048907 Ga0496104_0126123 Ga0496104_0126123_166_798 210
85 3300048911 Ga0496108_0000039 Ga0496108_0000039_49147_49815 210
86 3300048912 Ga0496109_0000038 Ga0496109_0000038_99855_100523 210
87 3300049578 Ga0501042_0055016 Ga0501042_0055016_129_761 210
88 3300053084 Ga0495595_0000017 Ga0495595_0000017_150_782 210
89 3300053085 Ga0495619_0000101 Ga0495619_0000101_150_782 210
90 3300005356 Ga0070674_100000002 Ga0070674_10000000289 211
91 3300005548 Ga0070665_100450840 Ga0070665_1004508402 211
92 3300005618 Ga0068864_100000178 Ga0068864_10000017855 211
93 3300005718 Ga0068866_10001711 Ga0068866_100017114 211
94 3300009176 Ga0105242_10053209 Ga0105242_100532093 211
95 3300025899 Ga0207642_10000108 Ga0207642_100001084 211
96 3300025934 Ga0207686_10014317 Ga0207686_100143173 211
97 3300025937 Ga0207669_10000003 Ga0207669_10000003205 211
98 3300026095 Ga0207676_10000016 Ga0207676_10000016216 211
99 3300046454 Ga0495592_0000024 Ga0495592_0000024_72129_72764 211
100 3300046462 Ga0495651_0026703 Ga0495651_0026703_15_650 211
101 3300046476 Ga0495662_0000010 Ga0495662_0000010_40621_41256 211
102 3300046514 Ga0495618_0000026 Ga0495618_0000026_79050_79685 211
103 3300046516 Ga0495628_0056755 Ga0495628_0056755_1290_1934 211
104 3300046517 Ga0495630_0034819 Ga0495630_0034819_1529_2164 211
105 3300046681 Ga0495647_0000004 Ga0495647_0000004_68357_68992 211
106 3300046681 Ga0495647_0016674 Ga0495647_0016674_1570_2217 211
107 3300046689 Ga0495613_0000021 Ga0495613_0000021_103610_104245 211
108 3300046689 Ga0495613_0000027 Ga0495613_0000027_22543_23178 211
109 3300046694 Ga0495649_0005608 Ga0495649_0005608_5254_5889 211
110 3300046809 Ga0495600_0002128 Ga0495600_0002128_10161_10796 211
111 3300047322 Ga0495680_0000007 Ga0495680_0000007_69105_69740 211
112 3300049587 Ga0501071_0109799 Ga0501071_0109799_712_1371 211
113 3300005344 Ga0070661_100000004 Ga0070661_100000004142 212
114 3300005366 Ga0070659_100449347 Ga0070659_1004493472 212
115 3300005436 Ga0070713_100000005 Ga0070713_100000005100 212
116 3300005539 Ga0068853_100000104 Ga0068853_1000001049 212
117 3300025920 Ga0207649_10000003 Ga0207649_10000003117 212
118 3300025928 Ga0207700_10000003 Ga0207700_10000003290 212
119 3300026041 Ga0207639_10000644 Ga0207639_100006444 212
120 3300026078 Ga0207702_10875015 Ga0207702_108750152 212
121 3300046536 Ga0495587_0006510 Ga0495587_0006510_1751_2389 212
122 3300046691 Ga0495670_0002537 Ga0495670_0002537_3600_4238 212
123 3300047317 Ga0495604_0000058 Ga0495604_0000058_23602_24240 212
124 3300053077 Ga0495601_0000017 Ga0495601_0000017_111458_112132 212
125 3300053094 Ga0500566_0003373 Ga0500566_0003373_2369_3016 212
126 3300005366 Ga0070659_100036564 Ga0070659_1000365643 213
127 3300013296 Ga0157374_10000692 Ga0157374_1000069232 213
128 3300025932 Ga0207690_10023723 Ga0207690_100237233 213
129 3300044694 Ga0466963_0000011 Ga0466963_0000011_25050_25691 213
130 3300046535 Ga0495586_0019545 Ga0495586_0019545_1588_2232 213
131 3300046642 Ga0495634_0010730 Ga0495634_0010730_3124_3774 213
132 3300047317 Ga0495604_0009520 Ga0495604_0009520_1814_2455 213
133 3300048088 Ga0495602_0000393 Ga0495602_0000393_12708_13349 213
134 3300049575 Ga0501039_0577959 Ga0501039_0577959_149_793 213
135 3300049588 Ga0501072_0033334 Ga0501072_0033334_2835_3479 213
136 3300049592 Ga0501076_0248693 Ga0501076_0248693_421_1065 213
137 3300053083 Ga0495655_0000005 Ga0495655_0000005_181970_182614 213
138 3300053084 Ga0495595_0014336 Ga0495595_0014336_2197_2838 213
139 3300053129 Ga0500628_000013 Ga0500628_000013_75034_75678 213
140 3300025899 Ga0207642_10063871 Ga0207642_100638712 214
141 3300046517 Ga0495630_0048191 Ga0495630_0048191_1142_1876 214
142 3300046642 Ga0495634_0000908 Ga0495634_0000908_12608_13261 214
143 3300046809 Ga0495600_0013656 Ga0495600_0013656_1434_2081 214
144 3300014326 Ga0157380_10000427 Ga0157380_1000042725 215
145 3300046462 Ga0495651_0202662 Ga0495651_0202662_121_777 215
146 3300009098 Ga0105245_10000040 Ga0105245_10000040130 217
147 3300013308 Ga0157375_10256623 Ga0157375_102566234 217
148 3300025927 Ga0207687_10000046 Ga0207687_10000046101 217
149 3300047322 Ga0495680_0177086 Ga0495680_0177086_282_938 217
150 3300048907 Ga0496104_0000008 Ga0496104_0000008_60322_60975 217
151 3300048908 Ga0496105_0000003 Ga0496105_0000003_60322_60975 217
152 3300005337 Ga0070682_100000023 Ga0070682_10000002378 219
153 3300005719 Ga0068861_100125394 Ga0068861_1001253943 219
154 3300026118 Ga0207675_100236543 Ga0207675_1002365432 219
155 3300048917 Ga0496114_0003225 Ga0496114_0003225_1501_2163 219
156 3300046459 Ga0495629_0001902 Ga0495629_0001902_4917_5594 220
157 3300005329 Ga0070683_100002137 Ga0070683_1000021378 221
158 3300005336 Ga0070680_100268945 Ga0070680_1002689451 221
159 3300005458 Ga0070681_10038914 Ga0070681_100389144 221
160 3300005530 Ga0070679_100002833 Ga0070679_10000283318 221
161 3300005535 Ga0070684_100081407 Ga0070684_1000814073 221
162 3300005539 Ga0068853_100067929 Ga0068853_1000679293 221
163 3300009098 Ga0105245_10000587 Ga0105245_1000058712 221
164 3300009553 Ga0105249_10464244 Ga0105249_104642442 221
165 3300025921 Ga0207652_10000080 Ga0207652_10000080111 221
166 3300025927 Ga0207687_10000075 Ga0207687_1000007553 221
167 3300025934 Ga0207686_10000212 Ga0207686_1000021244 221
168 3300025961 Ga0207712_10258863 Ga0207712_102588632 221
169 3300026041 Ga0207639_10064441 Ga0207639_100644413 221
170 3300035117 Ga0373953_0287501 Ga0373953_0287501_20_700 221
171 3300036401 Ga0373937_0053052 Ga0373937_0053052_1211_1891 221
172 3300041512 Ga0451853_3957662 Ga0451853_3957662_513_1181 221
173 3300046461 Ga0495641_0000040 Ga0495641_0000040_37740_38408 221
174 3300046517 Ga0495630_0035614 Ga0495630_0035614_2915_3583 221
175 3300046809 Ga0495600_0054199 Ga0495600_0054199_220_888 221
176 3300047321 Ga0495676_0001370 Ga0495676_0001370_9404_10072 221
177 3300047322 Ga0495680_0000617 Ga0495680_0000617_35414_36082 221
178 3300047446 Ga0495679_012977 Ga0495679_012977_541_1209 221
179 3300048905 Ga0496102_0000075 Ga0496102_0000075_91991_92683 221
180 3300048906 Ga0496103_0000107 Ga0496103_0000107_48773_49465 221
181 3300048916 Ga0496113_0038189 Ga0496113_0038189_471_1139 221
182 3300048920 Ga0496117_0226872 Ga0496117_0226872_332_1024 221
183 3300053077 Ga0495601_0000022 Ga0495601_0000022_57174_57842 221
184 3300053078 Ga0495612_0024942 Ga0495612_0024942_1211_1894 221
185 3300053123 Ga0500614_000472 Ga0500614_000472_6475_7143 221

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.7861 82 208
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7814 83 208
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7789 83 208
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7763 86 208
6qh4-assembly1.cif.gz_C crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7738 86 208
ID Description Score Start End Superfamily
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7763 86 208 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7689 73 210 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7504 86 209 3.10.180.10
af_A0A1D6H4U4_100_218_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7379 88 140 3.10.180.10
3p8aB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7372 85 205 2.60.40.4320
ID Description Score Start End GO Terms
AF-A0A838UYL7-F1-model_v4 Glyoxalase 0.9803 1 210
AF-A0A838UYL7-F1-model_v4 Glyoxalase 0.9757 1 210
AF-A0A7V9NTY5-F1-model_v4 Glyoxalase 0.9382 3 214
AF-A0A3N5L9F8-F1-model_v4 Glyoxalase 0.9372 1 210
AF-A0A2S9FLB7-F1-model_v4 Glyoxalase 0.9304 1 108

Feature Viewer

pLDDT pTM Quality
91.66 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map