F283778
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 133 | 185 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100000023|Ga0070682_10000002378 |
| Length | 233 |
| Sequence | VNNPLVPADYRLGMVPTLDELVVADAPAAWRACGFEVEGDVCVVGDVRIRLAPSGGGKGLTGWSLRDIGTTELDGLVTARSERPSPSEHPVHPNGVTALDHVVAISSDLDRTVATLRAAGLDLRRIREEPTPVGAPRQAFFRLGEPILEVVQAPAEAIERTGGDRPAFFWGLAFVAPDLDATVATLGDRVSEARDAVQPGRRIATLRRAAGLSLPLALITPPLSPRPPLGAGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 72 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 73 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 74 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 75 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 76 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 77 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 109 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 110 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 111 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 112 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 113 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 114 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 116 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 117 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 118 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 119 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 132 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 133 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.62 |
| Nodule | 0 |
| Rhizoplane | 8.65 |
| Rhizosphere | 88.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100002137 | 3300005329 | Bacteria | 15618 |
| 2 | Ga0070677_10000002 | 3300005333 | Bacteria | 87295 |
| 3 | Ga0070680_100268945 | 3300005336 | Bacteria | 1443 |
| 4 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 5 | Ga0068868_100004195 | 3300005338 | Bacteria | 10077 |
| 6 | Ga0068868_100190848 | 3300005338 | Unclassified | 1704 |
| 7 | Ga0070689_100138241 | 3300005340 | Bacteria | 1957 |
| 8 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 9 | Ga0070692_10020097 | 3300005345 | Bacteria | 3233 |
| 10 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 11 | Ga0070674_100189828 | 3300005356 | Bacteria | 1580 |
| 12 | Ga0070688_100000126 | 3300005365 | Bacteria | 40695 |
| 13 | Ga0070688_100421101 | 3300005365 | Unclassified | 992 |
| 14 | Ga0070659_100036564 | 3300005366 | Bacteria | 3828 |
| 15 | Ga0070659_100449347 | 3300005366 | Bacteria | 1093 |
| 16 | Ga0070713_100000005 | 3300005436 | Bacteria | 201526 |
| 17 | Ga0070713_100146682 | 3300005436 | Bacteria | 2095 |
| 18 | Ga0070710_10000012 | 3300005437 | Bacteria | 124056 |
| 19 | Ga0070663_100435110 | 3300005455 | Bacteria | 1078 |
| 20 | Ga0070663_100457518 | 3300005455 | Bacteria | 1053 |
| 21 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 22 | Ga0070681_10038914 | 3300005458 | Bacteria | 4768 |
| 23 | Ga0070685_10000195 | 3300005466 | Bacteria | 40644 |
| 24 | Ga0070685_10058798 | 3300005466 | Bacteria | 2242 |
| 25 | Ga0070679_100002833 | 3300005530 | Bacteria | 15766 |
| 26 | Ga0070684_100024445 | 3300005535 | Bacteria | 5069 |
| 27 | Ga0070684_100081407 | 3300005535 | Bacteria | 2865 |
| 28 | Ga0070684_100293425 | 3300005535 | Bacteria | 1491 |
| 29 | Ga0068853_100000104 | 3300005539 | Bacteria | 56511 |
| 30 | Ga0068853_100067929 | 3300005539 | Bacteria | 3098 |
| 31 | Ga0070672_100000032 | 3300005543 | Bacteria | 62011 |
| 32 | Ga0070686_100058500 | 3300005544 | Bacteria | 2480 |
| 33 | Ga0070665_100450840 | 3300005548 | Bacteria | 1296 |
| 34 | Ga0070664_100095832 | 3300005564 | Bacteria | 2574 |
| 35 | Ga0068854_100002639 | 3300005578 | Bacteria | 11112 |
| 36 | Ga0068852_100114028 | 3300005616 | Bacteria | 2462 |
| 37 | Ga0068864_100000178 | 3300005618 | Bacteria | 58416 |
| 38 | Ga0068866_10001711 | 3300005718 | Bacteria | 9226 |
| 39 | Ga0068866_10118070 | 3300005718 | Bacteria | 1490 |
| 40 | Ga0068861_100125394 | 3300005719 | Unclassified | 2077 |
| 41 | Ga0068863_100001610 | 3300005841 | Bacteria | 22316 |
| 42 | Ga0070712_100002154 | 3300006175 | Bacteria | 12116 |
| 43 | Ga0075433_10016345 | 3300006852 | Bacteria | 6112 |
| 44 | Ga0105240_10149703 | 3300009093 | Bacteria | 2781 |
| 45 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 46 | Ga0105245_10000587 | 3300009098 | Bacteria | 32974 |
| 47 | Ga0105243_10045554 | 3300009148 | Bacteria | 3447 |
| 48 | Ga0105241_10126502 | 3300009174 | Bacteria | 2064 |
| 49 | Ga0105242_10053209 | 3300009176 | Bacteria | 3305 |
| 50 | Ga0105249_10000150 | 3300009553 | Bacteria | 88154 |
| 51 | Ga0105249_10464244 | 3300009553 | Unclassified | 1306 |
| 52 | Ga0105246_10010366 | 3300011119 | Bacteria | 5765 |
| 53 | Ga0157374_10000692 | 3300013296 | Bacteria | 29700 |
| 54 | Ga0157374_10185252 | 3300013296 | Bacteria | 2035 |
| 55 | Ga0157378_10005366 | 3300013297 | Bacteria | 11244 |
| 56 | Ga0157375_10015246 | 3300013308 | Bacteria | 6877 |
| 57 | Ga0157375_10256623 | 3300013308 | Bacteria | 1910 |
| 58 | Ga0157380_10000007 | 3300014326 | Bacteria | 157634 |
| 59 | Ga0157380_10000427 | 3300014326 | Bacteria | 25606 |
| 60 | Ga0157380_10362733 | 3300014326 | Bacteria | 1360 |
| 61 | Ga0157380_10674904 | 3300014326 | Bacteria | 1034 |
| 62 | Ga0157379_10014189 | 3300014968 | Bacteria | 6987 |
| 63 | Ga0207682_10000012 | 3300025893 | Bacteria | 84521 |
| 64 | Ga0207692_10000012 | 3300025898 | Bacteria | 104402 |
| 65 | Ga0207642_10000108 | 3300025899 | Bacteria | 22373 |
| 66 | Ga0207642_10063871 | 3300025899 | Bacteria | 1723 |
| 67 | Ga0207695_10230341 | 3300025913 | Bacteria | 1757 |
| 68 | Ga0207693_10002209 | 3300025915 | Bacteria | 16974 |
| 69 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 70 | Ga0207652_10000080 | 3300025921 | Bacteria | 104739 |
| 71 | Ga0207687_10000046 | 3300025927 | Bacteria | 99576 |
| 72 | Ga0207687_10000075 | 3300025927 | Bacteria | 71856 |
| 73 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 74 | Ga0207700_10020832 | 3300025928 | Bacteria | 4463 |
| 75 | Ga0207690_10023723 | 3300025932 | Bacteria | 3833 |
| 76 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 77 | Ga0207686_10000212 | 3300025934 | Bacteria | 44261 |
| 78 | Ga0207686_10014317 | 3300025934 | Bacteria | 4412 |
| 79 | Ga0207709_10024790 | 3300025935 | Bacteria | 3429 |
| 80 | Ga0207670_10151180 | 3300025936 | Unclassified | 1723 |
| 81 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 82 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 83 | Ga0207661_10000239 | 3300025944 | Bacteria | 36056 |
| 84 | Ga0207679_10147697 | 3300025945 | Bacteria | 1909 |
| 85 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 86 | Ga0207712_10258863 | 3300025961 | Unclassified | 1410 |
| 87 | Ga0207640_10001937 | 3300025981 | Bacteria | 11147 |
| 88 | Ga0207677_10003228 | 3300026023 | Bacteria | 8608 |
| 89 | Ga0207677_10018815 | 3300026023 | Bacteria | 4155 |
| 90 | Ga0207639_10000644 | 3300026041 | Bacteria | 24030 |
| 91 | Ga0207639_10064441 | 3300026041 | Bacteria | 2841 |
| 92 | Ga0207702_10875015 | 3300026078 | Bacteria | 890 |
| 93 | Ga0207641_10004106 | 3300026088 | Bacteria | 12687 |
| 94 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 95 | Ga0207675_100236543 | 3300026118 | Unclassified | 1764 |
| 96 | Ga0307408_100172562 | 3300031548 | Unclassified | 1728 |
| 97 | Ga0373953_0287501 | 3300035117 | Bacteria | 717 |
| 98 | Ga0373937_0053052 | 3300036401 | Bacteria | 3719 |
| 99 | Ga0451853_3957662 | 3300041512 | Bacteria | 9070 |
| 100 | Ga0466963_0000011 | 3300044694 | Bacteria | 65918 |
| 101 | Ga0466958_0015687 | 3300045836 | Bacteria | 4348 |
| 102 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 103 | Ga0495629_0001902 | 3300046459 | Bacteria | 16259 |
| 104 | Ga0495629_0190073 | 3300046459 | Bacteria | 1421 |
| 105 | Ga0495641_0000040 | 3300046461 | Bacteria | 82337 |
| 106 | Ga0495641_0057775 | 3300046461 | Bacteria | 1757 |
| 107 | Ga0495651_0026703 | 3300046462 | Bacteria | 4497 |
| 108 | Ga0495651_0202662 | 3300046462 | Bacteria | 1387 |
| 109 | Ga0495653_0143588 | 3300046463 | Bacteria | 1676 |
| 110 | Ga0495662_0000010 | 3300046476 | Bacteria | 70156 |
| 111 | Ga0495662_0002121 | 3300046476 | Bacteria | 9950 |
| 112 | Ga0495594_0000034 | 3300046499 | Bacteria | 62318 |
| 113 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 114 | Ga0495618_0000026 | 3300046514 | Bacteria | 113266 |
| 115 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 116 | Ga0495628_0056755 | 3300046516 | Bacteria | 3081 |
| 117 | Ga0495630_0034819 | 3300046517 | Bacteria | 3762 |
| 118 | Ga0495630_0035614 | 3300046517 | Unclassified | 3719 |
| 119 | Ga0495630_0048191 | 3300046517 | Bacteria | 3189 |
| 120 | Ga0495640_0058488 | 3300046533 | Bacteria | 2629 |
| 121 | Ga0495586_0019545 | 3300046535 | Bacteria | 3607 |
| 122 | Ga0495587_0006510 | 3300046536 | Bacteria | 7611 |
| 123 | Ga0495622_0001011 | 3300046557 | Bacteria | 15050 |
| 124 | Ga0495634_0000908 | 3300046642 | Bacteria | 28256 |
| 125 | Ga0495634_0010730 | 3300046642 | Bacteria | 6704 |
| 126 | Ga0495634_0090852 | 3300046642 | Bacteria | 1983 |
| 127 | Ga0495634_0206635 | 3300046642 | Bacteria | 1217 |
| 128 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 129 | Ga0495657_0001298 | 3300046675 | Bacteria | 21744 |
| 130 | Ga0495647_0000004 | 3300046681 | Bacteria | 140700 |
| 131 | Ga0495647_0016674 | 3300046681 | Unclassified | 2589 |
| 132 | Ga0495613_0000021 | 3300046689 | Bacteria | 159188 |
| 133 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 134 | Ga0495624_0000007 | 3300046690 | Bacteria | 146202 |
| 135 | Ga0495670_0002537 | 3300046691 | Bacteria | 9021 |
| 136 | Ga0495649_0005608 | 3300046694 | Bacteria | 7939 |
| 137 | Ga0495600_0002128 | 3300046809 | Bacteria | 11215 |
| 138 | Ga0495600_0013656 | 3300046809 | Bacteria | 5110 |
| 139 | Ga0495600_0054199 | 3300046809 | Bacteria | 2619 |
| 140 | Ga0495604_0000058 | 3300047317 | Bacteria | 96955 |
| 141 | Ga0495604_0009520 | 3300047317 | Bacteria | 7681 |
| 142 | Ga0495604_0050372 | 3300047317 | Bacteria | 3234 |
| 143 | Ga0495676_0001370 | 3300047321 | Bacteria | 20976 |
| 144 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 145 | Ga0495680_0000617 | 3300047322 | Bacteria | 40072 |
| 146 | Ga0495680_0177086 | 3300047322 | Bacteria | 1541 |
| 147 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 148 | Ga0495679_012977 | 3300047446 | Bacteria | 3147 |
| 149 | Ga0495685_018576 | 3300047447 | Bacteria | 2387 |
| 150 | Ga0495602_0000393 | 3300048088 | Bacteria | 40803 |
| 151 | Ga0496100_0228633 | 3300048903 | Bacteria | 1368 |
| 152 | Ga0496102_0000075 | 3300048905 | Bacteria | 147013 |
| 153 | Ga0496103_0000107 | 3300048906 | Bacteria | 91213 |
| 154 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 155 | Ga0496104_0126123 | 3300048907 | Bacteria | 2458 |
| 156 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 157 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 158 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 159 | Ga0496108_0000039 | 3300048911 | Bacteria | 149440 |
| 160 | Ga0496108_0013306 | 3300048911 | Bacteria | 6708 |
| 161 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 162 | Ga0496109_0000038 | 3300048912 | Bacteria | 150745 |
| 163 | Ga0496109_0000066 | 3300048912 | Bacteria | 112004 |
| 164 | Ga0496113_0038189 | 3300048916 | Bacteria | 3530 |
| 165 | Ga0496113_0092348 | 3300048916 | Bacteria | 2335 |
| 166 | Ga0496114_0003225 | 3300048917 | Bacteria | 12508 |
| 167 | Ga0496117_0226872 | 3300048920 | Bacteria | 1035 |
| 168 | Ga0501039_0577959 | 3300049575 | Bacteria | 881 |
| 169 | Ga0501042_0055016 | 3300049578 | Bacteria | 2839 |
| 170 | Ga0501071_0109799 | 3300049587 | Bacteria | 2038 |
| 171 | Ga0501072_0033334 | 3300049588 | Bacteria | 4036 |
| 172 | Ga0501075_0000711 | 3300049591 | Bacteria | 20613 |
| 173 | Ga0501076_0248693 | 3300049592 | Bacteria | 1455 |
| 174 | nmdc:mga0a205_24_c1 | 3300050515 | Bacteria | 6155 |
| 175 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 176 | Ga0495601_0000022 | 3300053077 | Bacteria | 148418 |
| 177 | Ga0495612_0024942 | 3300053078 | Bacteria | 2401 |
| 178 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 179 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 180 | Ga0495595_0014336 | 3300053084 | Bacteria | 3361 |
| 181 | Ga0495619_0000101 | 3300053085 | Bacteria | 64377 |
| 182 | Ga0495619_0154911 | 3300053085 | Bacteria | 1581 |
| 183 | Ga0500566_0003373 | 3300053094 | Bacteria | 9535 |
| 184 | Ga0500614_000472 | 3300053123 | Bacteria | 10425 |
| 185 | Ga0500628_000013 | 3300053129 | Bacteria | 106419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10149703 | Ga0105240_101497032 | 181 |
| 2 | 3300013296 | Ga0157374_10185252 | Ga0157374_101852522 | 181 |
| 3 | 3300025913 | Ga0207695_10230341 | Ga0207695_102303412 | 181 |
| 4 | 3300011119 | Ga0105246_10010366 | Ga0105246_100103665 | 188 |
| 5 | 3300005437 | Ga0070710_10000012 | Ga0070710_1000001234 | 189 |
| 6 | 3300005841 | Ga0068863_100001610 | Ga0068863_10000161020 | 189 |
| 7 | 3300025898 | Ga0207692_10000012 | Ga0207692_10000012111 | 189 |
| 8 | 3300026088 | Ga0207641_10004106 | Ga0207641_100041064 | 189 |
| 9 | 3300005535 | Ga0070684_100293425 | Ga0070684_1002934253 | 190 |
| 10 | 3300005564 | Ga0070664_100095832 | Ga0070664_1000958322 | 190 |
| 11 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_319249_319875 | 193 |
| 12 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_215217_215843 | 193 |
| 13 | 3300014326 | Ga0157380_10000007 | Ga0157380_10000007123 | 195 |
| 14 | 3300046463 | Ga0495653_0143588 | Ga0495653_0143588_604_1230 | 197 |
| 15 | 3300013308 | Ga0157375_10015246 | Ga0157375_100152465 | 200 |
| 16 | 3300005543 | Ga0070672_100000032 | Ga0070672_10000003210 | 201 |
| 17 | 3300025940 | Ga0207691_10000002 | Ga0207691_1000000250 | 201 |
| 18 | 3300005356 | Ga0070674_100189828 | Ga0070674_1001898281 | 203 |
| 19 | 3300048909 | Ga0496106_0000042 | Ga0496106_0000042_24_635 | 203 |
| 20 | 3300046675 | Ga0495657_0001298 | Ga0495657_0001298_18373_18987 | 204 |
| 21 | 3300053085 | Ga0495619_0154911 | Ga0495619_0154911_473_1270 | 204 |
| 22 | 3300006852 | Ga0075433_10016345 | Ga0075433_100163454 | 205 |
| 23 | 3300014326 | Ga0157380_10674904 | Ga0157380_106749042 | 205 |
| 24 | 3300050515 | nmdc:mga0a205_24_c1 | nmdc:mga0a205_24_c1_3044_3685 | 205 |
| 25 | 3300005457 | Ga0070662_100000006 | Ga0070662_10000000615 | 207 |
| 26 | 3300025933 | Ga0207706_10000017 | Ga0207706_1000001715 | 207 |
| 27 | 3300049591 | Ga0501075_0000711 | Ga0501075_0000711_11482_12105 | 207 |
| 28 | 3300005338 | Ga0068868_100004195 | Ga0068868_1000041954 | 208 |
| 29 | 3300005345 | Ga0070692_10020097 | Ga0070692_100200973 | 208 |
| 30 | 3300005365 | Ga0070688_100000126 | Ga0070688_10000012632 | 208 |
| 31 | 3300005455 | Ga0070663_100457518 | Ga0070663_1004575182 | 208 |
| 32 | 3300005466 | Ga0070685_10000195 | Ga0070685_1000019532 | 208 |
| 33 | 3300005616 | Ga0068852_100114028 | Ga0068852_1001140282 | 208 |
| 34 | 3300026023 | Ga0207677_10018815 | Ga0207677_100188152 | 208 |
| 35 | 3300046476 | Ga0495662_0002121 | Ga0495662_0002121_4449_5075 | 208 |
| 36 | 3300046499 | Ga0495594_0000034 | Ga0495594_0000034_54913_55539 | 208 |
| 37 | 3300046557 | Ga0495622_0001011 | Ga0495622_0001011_11077_11703 | 208 |
| 38 | 3300048911 | Ga0496108_0013306 | Ga0496108_0013306_1812_2438 | 208 |
| 39 | 3300048912 | Ga0496109_0000066 | Ga0496109_0000066_75071_75697 | 208 |
| 40 | 3300048916 | Ga0496113_0092348 | Ga0496113_0092348_301_993 | 208 |
| 41 | 3300005338 | Ga0068868_100190848 | Ga0068868_1001908484 | 209 |
| 42 | 3300005455 | Ga0070663_100435110 | Ga0070663_1004351102 | 209 |
| 43 | 3300009148 | Ga0105243_10045554 | Ga0105243_100455543 | 209 |
| 44 | 3300009174 | Ga0105241_10126502 | Ga0105241_101265022 | 209 |
| 45 | 3300013297 | Ga0157378_10005366 | Ga0157378_100053666 | 209 |
| 46 | 3300014326 | Ga0157380_10362733 | Ga0157380_103627333 | 209 |
| 47 | 3300025935 | Ga0207709_10024790 | Ga0207709_100247903 | 209 |
| 48 | 3300026023 | Ga0207677_10003228 | Ga0207677_100032284 | 209 |
| 49 | 3300031548 | Ga0307408_100172562 | Ga0307408_1001725622 | 209 |
| 50 | 3300046459 | Ga0495629_0190073 | Ga0495629_0190073_738_1367 | 209 |
| 51 | 3300046461 | Ga0495641_0057775 | Ga0495641_0057775_1042_1671 | 209 |
| 52 | 3300046533 | Ga0495640_0058488 | Ga0495640_0058488_739_1368 | 209 |
| 53 | 3300046642 | Ga0495634_0090852 | Ga0495634_0090852_130_759 | 209 |
| 54 | 3300046642 | Ga0495634_0206635 | Ga0495634_0206635_501_1130 | 209 |
| 55 | 3300047317 | Ga0495604_0050372 | Ga0495604_0050372_1885_2514 | 209 |
| 56 | 3300047447 | Ga0495685_018576 | Ga0495685_018576_691_1320 | 209 |
| 57 | 3300005333 | Ga0070677_10000002 | Ga0070677_1000000244 | 210 |
| 58 | 3300005340 | Ga0070689_100138241 | Ga0070689_1001382413 | 210 |
| 59 | 3300005365 | Ga0070688_100421101 | Ga0070688_1004211011 | 210 |
| 60 | 3300005436 | Ga0070713_100146682 | Ga0070713_1001466821 | 210 |
| 61 | 3300005466 | Ga0070685_10058798 | Ga0070685_100587982 | 210 |
| 62 | 3300005535 | Ga0070684_100024445 | Ga0070684_1000244454 | 210 |
| 63 | 3300005544 | Ga0070686_100058500 | Ga0070686_1000585002 | 210 |
| 64 | 3300005578 | Ga0068854_100002639 | Ga0068854_1000026399 | 210 |
| 65 | 3300005718 | Ga0068866_10118070 | Ga0068866_101180702 | 210 |
| 66 | 3300006175 | Ga0070712_100002154 | Ga0070712_1000021548 | 210 |
| 67 | 3300009553 | Ga0105249_10000150 | Ga0105249_1000015038 | 210 |
| 68 | 3300014968 | Ga0157379_10014189 | Ga0157379_100141894 | 210 |
| 69 | 3300025893 | Ga0207682_10000012 | Ga0207682_1000001224 | 210 |
| 70 | 3300025915 | Ga0207693_10002209 | Ga0207693_100022098 | 210 |
| 71 | 3300025928 | Ga0207700_10020832 | Ga0207700_100208322 | 210 |
| 72 | 3300025936 | Ga0207670_10151180 | Ga0207670_101511802 | 210 |
| 73 | 3300025944 | Ga0207661_10000239 | Ga0207661_1000023935 | 210 |
| 74 | 3300025945 | Ga0207679_10147697 | Ga0207679_101476972 | 210 |
| 75 | 3300025961 | Ga0207712_10000027 | Ga0207712_1000002755 | 210 |
| 76 | 3300025981 | Ga0207640_10001937 | Ga0207640_100019373 | 210 |
| 77 | 3300045836 | Ga0466958_0015687 | Ga0466958_0015687_1405_2037 | 210 |
| 78 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_132230_132862 | 210 |
| 79 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_85005_85640 | 210 |
| 80 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_150_782 | 210 |
| 81 | 3300046690 | Ga0495624_0000007 | Ga0495624_0000007_88344_88982 | 210 |
| 82 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_143_775 | 210 |
| 83 | 3300048903 | Ga0496100_0228633 | Ga0496100_0228633_490_1122 | 210 |
| 84 | 3300048907 | Ga0496104_0126123 | Ga0496104_0126123_166_798 | 210 |
| 85 | 3300048911 | Ga0496108_0000039 | Ga0496108_0000039_49147_49815 | 210 |
| 86 | 3300048912 | Ga0496109_0000038 | Ga0496109_0000038_99855_100523 | 210 |
| 87 | 3300049578 | Ga0501042_0055016 | Ga0501042_0055016_129_761 | 210 |
| 88 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_150_782 | 210 |
| 89 | 3300053085 | Ga0495619_0000101 | Ga0495619_0000101_150_782 | 210 |
| 90 | 3300005356 | Ga0070674_100000002 | Ga0070674_10000000289 | 211 |
| 91 | 3300005548 | Ga0070665_100450840 | Ga0070665_1004508402 | 211 |
| 92 | 3300005618 | Ga0068864_100000178 | Ga0068864_10000017855 | 211 |
| 93 | 3300005718 | Ga0068866_10001711 | Ga0068866_100017114 | 211 |
| 94 | 3300009176 | Ga0105242_10053209 | Ga0105242_100532093 | 211 |
| 95 | 3300025899 | Ga0207642_10000108 | Ga0207642_100001084 | 211 |
| 96 | 3300025934 | Ga0207686_10014317 | Ga0207686_100143173 | 211 |
| 97 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003205 | 211 |
| 98 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016216 | 211 |
| 99 | 3300046454 | Ga0495592_0000024 | Ga0495592_0000024_72129_72764 | 211 |
| 100 | 3300046462 | Ga0495651_0026703 | Ga0495651_0026703_15_650 | 211 |
| 101 | 3300046476 | Ga0495662_0000010 | Ga0495662_0000010_40621_41256 | 211 |
| 102 | 3300046514 | Ga0495618_0000026 | Ga0495618_0000026_79050_79685 | 211 |
| 103 | 3300046516 | Ga0495628_0056755 | Ga0495628_0056755_1290_1934 | 211 |
| 104 | 3300046517 | Ga0495630_0034819 | Ga0495630_0034819_1529_2164 | 211 |
| 105 | 3300046681 | Ga0495647_0000004 | Ga0495647_0000004_68357_68992 | 211 |
| 106 | 3300046681 | Ga0495647_0016674 | Ga0495647_0016674_1570_2217 | 211 |
| 107 | 3300046689 | Ga0495613_0000021 | Ga0495613_0000021_103610_104245 | 211 |
| 108 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_22543_23178 | 211 |
| 109 | 3300046694 | Ga0495649_0005608 | Ga0495649_0005608_5254_5889 | 211 |
| 110 | 3300046809 | Ga0495600_0002128 | Ga0495600_0002128_10161_10796 | 211 |
| 111 | 3300047322 | Ga0495680_0000007 | Ga0495680_0000007_69105_69740 | 211 |
| 112 | 3300049587 | Ga0501071_0109799 | Ga0501071_0109799_712_1371 | 211 |
| 113 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004142 | 212 |
| 114 | 3300005366 | Ga0070659_100449347 | Ga0070659_1004493472 | 212 |
| 115 | 3300005436 | Ga0070713_100000005 | Ga0070713_100000005100 | 212 |
| 116 | 3300005539 | Ga0068853_100000104 | Ga0068853_1000001049 | 212 |
| 117 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003117 | 212 |
| 118 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003290 | 212 |
| 119 | 3300026041 | Ga0207639_10000644 | Ga0207639_100006444 | 212 |
| 120 | 3300026078 | Ga0207702_10875015 | Ga0207702_108750152 | 212 |
| 121 | 3300046536 | Ga0495587_0006510 | Ga0495587_0006510_1751_2389 | 212 |
| 122 | 3300046691 | Ga0495670_0002537 | Ga0495670_0002537_3600_4238 | 212 |
| 123 | 3300047317 | Ga0495604_0000058 | Ga0495604_0000058_23602_24240 | 212 |
| 124 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_111458_112132 | 212 |
| 125 | 3300053094 | Ga0500566_0003373 | Ga0500566_0003373_2369_3016 | 212 |
| 126 | 3300005366 | Ga0070659_100036564 | Ga0070659_1000365643 | 213 |
| 127 | 3300013296 | Ga0157374_10000692 | Ga0157374_1000069232 | 213 |
| 128 | 3300025932 | Ga0207690_10023723 | Ga0207690_100237233 | 213 |
| 129 | 3300044694 | Ga0466963_0000011 | Ga0466963_0000011_25050_25691 | 213 |
| 130 | 3300046535 | Ga0495586_0019545 | Ga0495586_0019545_1588_2232 | 213 |
| 131 | 3300046642 | Ga0495634_0010730 | Ga0495634_0010730_3124_3774 | 213 |
| 132 | 3300047317 | Ga0495604_0009520 | Ga0495604_0009520_1814_2455 | 213 |
| 133 | 3300048088 | Ga0495602_0000393 | Ga0495602_0000393_12708_13349 | 213 |
| 134 | 3300049575 | Ga0501039_0577959 | Ga0501039_0577959_149_793 | 213 |
| 135 | 3300049588 | Ga0501072_0033334 | Ga0501072_0033334_2835_3479 | 213 |
| 136 | 3300049592 | Ga0501076_0248693 | Ga0501076_0248693_421_1065 | 213 |
| 137 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_181970_182614 | 213 |
| 138 | 3300053084 | Ga0495595_0014336 | Ga0495595_0014336_2197_2838 | 213 |
| 139 | 3300053129 | Ga0500628_000013 | Ga0500628_000013_75034_75678 | 213 |
| 140 | 3300025899 | Ga0207642_10063871 | Ga0207642_100638712 | 214 |
| 141 | 3300046517 | Ga0495630_0048191 | Ga0495630_0048191_1142_1876 | 214 |
| 142 | 3300046642 | Ga0495634_0000908 | Ga0495634_0000908_12608_13261 | 214 |
| 143 | 3300046809 | Ga0495600_0013656 | Ga0495600_0013656_1434_2081 | 214 |
| 144 | 3300014326 | Ga0157380_10000427 | Ga0157380_1000042725 | 215 |
| 145 | 3300046462 | Ga0495651_0202662 | Ga0495651_0202662_121_777 | 215 |
| 146 | 3300009098 | Ga0105245_10000040 | Ga0105245_10000040130 | 217 |
| 147 | 3300013308 | Ga0157375_10256623 | Ga0157375_102566234 | 217 |
| 148 | 3300025927 | Ga0207687_10000046 | Ga0207687_10000046101 | 217 |
| 149 | 3300047322 | Ga0495680_0177086 | Ga0495680_0177086_282_938 | 217 |
| 150 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_60322_60975 | 217 |
| 151 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_60322_60975 | 217 |
| 152 | 3300005337 | Ga0070682_100000023 | Ga0070682_10000002378 | 219 |
| 153 | 3300005719 | Ga0068861_100125394 | Ga0068861_1001253943 | 219 |
| 154 | 3300026118 | Ga0207675_100236543 | Ga0207675_1002365432 | 219 |
| 155 | 3300048917 | Ga0496114_0003225 | Ga0496114_0003225_1501_2163 | 219 |
| 156 | 3300046459 | Ga0495629_0001902 | Ga0495629_0001902_4917_5594 | 220 |
| 157 | 3300005329 | Ga0070683_100002137 | Ga0070683_1000021378 | 221 |
| 158 | 3300005336 | Ga0070680_100268945 | Ga0070680_1002689451 | 221 |
| 159 | 3300005458 | Ga0070681_10038914 | Ga0070681_100389144 | 221 |
| 160 | 3300005530 | Ga0070679_100002833 | Ga0070679_10000283318 | 221 |
| 161 | 3300005535 | Ga0070684_100081407 | Ga0070684_1000814073 | 221 |
| 162 | 3300005539 | Ga0068853_100067929 | Ga0068853_1000679293 | 221 |
| 163 | 3300009098 | Ga0105245_10000587 | Ga0105245_1000058712 | 221 |
| 164 | 3300009553 | Ga0105249_10464244 | Ga0105249_104642442 | 221 |
| 165 | 3300025921 | Ga0207652_10000080 | Ga0207652_10000080111 | 221 |
| 166 | 3300025927 | Ga0207687_10000075 | Ga0207687_1000007553 | 221 |
| 167 | 3300025934 | Ga0207686_10000212 | Ga0207686_1000021244 | 221 |
| 168 | 3300025961 | Ga0207712_10258863 | Ga0207712_102588632 | 221 |
| 169 | 3300026041 | Ga0207639_10064441 | Ga0207639_100644413 | 221 |
| 170 | 3300035117 | Ga0373953_0287501 | Ga0373953_0287501_20_700 | 221 |
| 171 | 3300036401 | Ga0373937_0053052 | Ga0373937_0053052_1211_1891 | 221 |
| 172 | 3300041512 | Ga0451853_3957662 | Ga0451853_3957662_513_1181 | 221 |
| 173 | 3300046461 | Ga0495641_0000040 | Ga0495641_0000040_37740_38408 | 221 |
| 174 | 3300046517 | Ga0495630_0035614 | Ga0495630_0035614_2915_3583 | 221 |
| 175 | 3300046809 | Ga0495600_0054199 | Ga0495600_0054199_220_888 | 221 |
| 176 | 3300047321 | Ga0495676_0001370 | Ga0495676_0001370_9404_10072 | 221 |
| 177 | 3300047322 | Ga0495680_0000617 | Ga0495680_0000617_35414_36082 | 221 |
| 178 | 3300047446 | Ga0495679_012977 | Ga0495679_012977_541_1209 | 221 |
| 179 | 3300048905 | Ga0496102_0000075 | Ga0496102_0000075_91991_92683 | 221 |
| 180 | 3300048906 | Ga0496103_0000107 | Ga0496103_0000107_48773_49465 | 221 |
| 181 | 3300048916 | Ga0496113_0038189 | Ga0496113_0038189_471_1139 | 221 |
| 182 | 3300048920 | Ga0496117_0226872 | Ga0496117_0226872_332_1024 | 221 |
| 183 | 3300053077 | Ga0495601_0000022 | Ga0495601_0000022_57174_57842 | 221 |
| 184 | 3300053078 | Ga0495612_0024942 | Ga0495612_0024942_1211_1894 | 221 |
| 185 | 3300053123 | Ga0500614_000472 | Ga0500614_000472_6475_7143 | 221 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rmu-assembly2.cif.gz_D | crystal structure of human methylmalonyl-coa epimerase, mcee | 0.7861 | 82 | 208 |
| 6qh4-assembly2.cif.gz_B | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7814 | 83 | 208 |
| 6qh4-assembly2.cif.gz_D-2 | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7789 | 83 | 208 |
| 6qh4-assembly1.cif.gz_A | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7763 | 86 | 208 |
| 6qh4-assembly1.cif.gz_C | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7738 | 86 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6qh4A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7763 | 86 | 208 | 3.10.180.10 |
| af_L7N6B1_8_152_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7689 | 73 | 210 | 3.10.180.10 |
| 3oa4A01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7504 | 86 | 209 | 3.10.180.10 |
| af_A0A1D6H4U4_100_218_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7379 | 88 | 140 | 3.10.180.10 |
| 3p8aB02 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7372 | 85 | 205 | 2.60.40.4320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838UYL7-F1-model_v4 | Glyoxalase | 0.9803 | 1 | 210 |
|
| AF-A0A838UYL7-F1-model_v4 | Glyoxalase | 0.9757 | 1 | 210 |
|
| AF-A0A7V9NTY5-F1-model_v4 | Glyoxalase | 0.9382 | 3 | 214 |
|
| AF-A0A3N5L9F8-F1-model_v4 | Glyoxalase | 0.9372 | 1 | 210 |
|
| AF-A0A2S9FLB7-F1-model_v4 | Glyoxalase | 0.9304 | 1 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar