F280852

General Info

Members Datasets Scaffolds Average Seq Length
183 127 366 198

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10655355|Ga0157370_106553551
Length 198
Sequence VIAVFDYGAGNLRSVENTLSEVGCDFEIVRDAAGLGRGSKIILPGVGHFGQMMRSLTDEVRYAFKERIAAGVPFLGICLGMQALFEASEEAPEVEGLGLFDGVVKRFPAHARCPHMGWNELEVREGSRLLPVGSRPYVYFAHSYYVPEVPEASAVCNYSEIDYTAALEAGNVYGVQFHPEKSGAVGIEMVRRFVEMAC

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10655355 3300013104 Bacteria 959
2 Ga0070683_100000019 3300005329 Bacteria 192076
3 Ga0070683_100506681 3300005329 Bacteria 1153
4 Ga0070670_100961380 3300005331 Unclassified 776
5 Ga0070682_100684999 3300005337 Bacteria 820
6 Ga0070689_100103768 3300005340 Bacteria 2254
7 Ga0070675_101090099 3300005354 Bacteria 734
8 Ga0070714_100035658 3300005435 Bacteria 4169
9 Ga0070713_100002523 3300005436 Bacteria 11963
10 Ga0070713_100011179 3300005436 Bacteria 6527
11 Ga0070713_100015164 3300005436 Bacteria 5747
12 Ga0070711_100144608 3300005439 Bacteria 1787
13 Ga0070705_100542024 3300005440 Bacteria 890
14 Ga0070678_100175346 3300005456 Bacteria 1750
15 Ga0068867_100393454 3300005459 Bacteria 1167
16 Ga0070699_100012616 3300005518 Bacteria 7288
17 Ga0070679_100569505 3300005530 Bacteria 1076
18 Ga0070684_100000003 3300005535 Bacteria 248527
19 Ga0070684_100279931 3300005535 Bacteria 1528
20 Ga0070697_100417863 3300005536 Bacteria 1165
21 Ga0070696_100001772 3300005546 Bacteria 14152
22 Ga0070665_100084437 3300005548 Bacteria 3181
23 Ga0068855_100355088 3300005563 Bacteria 1614
24 Ga0070664_100466209 3300005564 Bacteria 1161
25 Ga0068856_100744491 3300005614 Bacteria 1000
26 Ga0068852_100652035 3300005616 Bacteria 1060
27 Ga0068859_100075384 3300005617 Bacteria 3414
28 Ga0068864_100306161 3300005618 Bacteria 1489
29 Ga0068863_100121900 3300005841 Bacteria 2487
30 Ga0068863_100293990 3300005841 Bacteria 1575
31 Ga0068858_100220378 3300005842 Bacteria 1796
32 Ga0068858_100799491 3300005842 Bacteria 920
33 Ga0070717_10002297 3300006028 Bacteria 13414
34 Ga0097621_100202261 3300006237 Bacteria 1725
35 Ga0075431_100009713 3300006847 Bacteria 9663
36 Ga0068865_100577534 3300006881 Bacteria 947
37 Ga0097620_100075381 3300006931 Bacteria 3414
38 Ga0105240_10006267 3300009093 Bacteria 17501
39 Ga0105240_10466118 3300009093 Bacteria 1411
40 Ga0105240_10671665 3300009093 Bacteria 1134
41 Ga0105245_10092800 3300009098 Bacteria 2781
42 Ga0114129_10489668 3300009147 Bacteria 1608
43 Ga0114129_10809972 3300009147 Bacteria 1194
44 Ga0105243_10075382 3300009148 Bacteria 2738
45 Ga0105242_10037404 3300009176 Bacteria 3898
46 Ga0105242_10074164 3300009176 Bacteria 2831
47 Ga0105248_10021914 3300009177 Bacteria 7080
48 Ga0105248_10124733 3300009177 Bacteria 2905
49 Ga0105248_10141839 3300009177 Bacteria 2711
50 Ga0105248_10538175 3300009177 Bacteria 1317
51 Ga0105237_10015643 3300009545 Bacteria 7886
52 Ga0105238_10115494 3300009551 Bacteria 2664
53 Ga0105249_10166133 3300009553 Bacteria 2136
54 Ga0105239_10061846 3300010375 Bacteria 4110
55 Ga0105246_10087056 3300011119 Bacteria 2241
56 Ga0105246_10148180 3300011119 Bacteria 1773
57 Ga0105246_10681633 3300011119 Unclassified 898
58 Ga0157370_11018564 3300013104 Bacteria 749
59 Ga0157369_10042841 3300013105 Bacteria 4937
60 Ga0157369_10796787 3300013105 Bacteria 971
61 Ga0157374_10183595 3300013296 Bacteria 2044
62 Ga0157378_11539272 3300013297 Bacteria 710
63 Ga0163162_10175391 3300013306 Bacteria 2269
64 Ga0163162_10412334 3300013306 Bacteria 1483
65 Ga0163162_12076562 3300013306 Unclassified 652
66 Ga0157372_10050147 3300013307 Bacteria 4644
67 Ga0157375_11792218 3300013308 Bacteria 728
68 Ga0163163_10177942 3300014325 Bacteria 2174
69 Ga0157376_10419770 3300014969 Bacteria 1298
70 Ga0157376_10429785 3300014969 Bacteria 1283
71 Ga0157376_10567052 3300014969 Bacteria 1126
72 Ga0157376_10604864 3300014969 Bacteria 1091
73 Ga0213873_10012869 3300021358 Bacteria 1823
74 Ga0213875_10006476 3300021388 Bacteria 6139
75 Ga0213875_10028055 3300021388 Bacteria 2677
76 Ga0213875_10048204 3300021388 Bacteria 1999
77 Ga0213875_10221966 3300021388 Unclassified 890
78 Ga0207642_10155307 3300025899 Unclassified 1223
79 Ga0207699_10025855 3300025906 Bacteria 3229
80 Ga0207707_10201192 3300025912 Bacteria 1737
81 Ga0207695_10012024 3300025913 Bacteria 10411
82 Ga0207695_10720556 3300025913 Bacteria 878
83 Ga0207671_10579361 3300025914 Bacteria 895
84 Ga0207663_10179836 3300025916 Bacteria 1509
85 Ga0207649_10290630 3300025920 Bacteria 1192
86 Ga0207694_10011929 3300025924 Bacteria 6553
87 Ga0207650_10704949 3300025925 Bacteria 853
88 Ga0207659_11051916 3300025926 Bacteria 700
89 Ga0207700_10039457 3300025928 Bacteria 3438
90 Ga0207700_10041486 3300025928 Bacteria 3367
91 Ga0207664_10027284 3300025929 Bacteria 4327
92 Ga0207686_10055571 3300025934 Bacteria 2484
93 Ga0207709_10078860 3300025935 Bacteria 2115
94 Ga0207669_10543789 3300025937 Bacteria 936
95 Ga0207704_10503851 3300025938 Bacteria 976
96 Ga0207711_10058775 3300025941 Bacteria 3310
97 Ga0207711_10062940 3300025941 Bacteria 3202
98 Ga0207711_10227893 3300025941 Bacteria 1706
99 Ga0207711_11202005 3300025941 Bacteria 700
100 Ga0207661_10000019 3300025944 Bacteria 235900
101 Ga0207667_10271073 3300025949 Bacteria 1735
102 Ga0207712_10029296 3300025961 Bacteria 3691
103 Ga0207703_10162311 3300026035 Bacteria 1958
104 Ga0207703_10815182 3300026035 Bacteria 891
105 Ga0207641_10096702 3300026088 Bacteria 2594
106 Ga0207641_10416838 3300026088 Bacteria 1292
107 Ga0207676_10549851 3300026095 Bacteria 1103
108 Ga0207698_10529948 3300026142 Bacteria 1151
109 Ga0268266_10061402 3300028379 Bacteria 3242
110 Ga0265325_10003125 3300031241 Bacteria 10924
111 Ga0265316_10001368 3300031344 Bacteria 26263
112 Ga0265316_10015592 3300031344 Bacteria 6636
113 Ga0265316_10118693 3300031344 Bacteria 1998
114 Ga0373954_0278584 3300035118 Bacteria 824
115 Ga0373955_0058678 3300035172 Bacteria 2118
116 Ga0373935_0116314 3300035692 Bacteria 1781
117 Ga0373935_0837437 3300035692 Bacteria 680
118 Ga0373927_0042674 3300035695 Bacteria 2939
119 Ga0373927_0719984 3300035695 Bacteria 659
120 Ga0373933_0109752 3300035724 Bacteria 1720
121 Ga0373933_0401548 3300035724 Bacteria 894
122 Ga0373933_0648177 3300035724 Bacteria 694
123 Ga0373937_0610381 3300036401 Bacteria 1035
124 Ga0373925_0412837 3300037068 Bacteria 1102
125 Ga0436364_0148095 3300037853 Bacteria 6786
126 Ga0436364_0349717 3300037853 Bacteria 2676
127 Ga0436364_0633516 3300037853 Bacteria 25573
128 Ga0436364_0818237 3300037853 Bacteria 6615
129 Ga0436364_1208285 3300037853 Unclassified 1076
130 Ga0436365_0650674 3300039437 Bacteria 3958
131 Ga0436365_0810573 3300039437 Bacteria 6562
132 Ga0453683_0374809 3300044673 Bacteria 916
133 Ga0451576_0065958 3300045051 Bacteria 3769
134 Ga0451576_0212024 3300045051 Bacteria 2022
135 Ga0451576_0229180 3300045051 Bacteria 1940
136 Ga0466967_0351559 3300045976 Bacteria 1427
137 Ga0495603_0233267 3300046455 Bacteria 1061
138 Ga0495651_0002965 3300046462 Bacteria 13114
139 Ga0495580_0014096 3300046472 Bacteria 6077
140 Ga0495580_0073588 3300046472 Bacteria 2386
141 Ga0495582_0377025 3300046473 Bacteria 817
142 Ga0495664_0294764 3300046477 Bacteria 979
143 Ga0495594_0267209 3300046499 Bacteria 974
144 Ga0495608_0209218 3300046511 Bacteria 1227
145 Ga0495628_0127437 3300046516 Bacteria 1949
146 Ga0495652_0116086 3300046529 Bacteria 2144
147 Ga0495587_0175528 3300046536 Bacteria 1216
148 Ga0495587_0297040 3300046536 Bacteria 904
149 Ga0495645_0019007 3300046543 Bacteria 4945
150 Ga0495645_0209763 3300046543 Bacteria 1316
151 Ga0495667_0203291 3300046559 Bacteria 1267
152 Ga0495635_0047094 3300046663 Bacteria 2975
153 Ga0495635_0160477 3300046663 Bacteria 1530
154 Ga0495635_0184010 3300046663 Bacteria 1420
155 Ga0495599_0063543 3300046678 Bacteria 2307
156 Ga0495623_0009599 3300046679 Bacteria 6282
157 Ga0495646_0293961 3300046680 Bacteria 860
158 Ga0495658_0293164 3300046683 Bacteria 1028
159 Ga0495613_0090515 3300046689 Bacteria 2216
160 Ga0495624_0154909 3300046690 Bacteria 1401
161 Ga0495581_0448213 3300047315 Bacteria 752
162 Ga0495604_0207830 3300047317 Bacteria 1354
163 Ga0495636_0156249 3300047318 Bacteria 1026
164 Ga0495674_0077054 3300047319 Bacteria 2867
165 Ga0495674_0083109 3300047319 Bacteria 2745
166 Ga0495674_0119449 3300047319 Bacteria 2228
167 Ga0495674_0140175 3300047319 Bacteria 2033
168 Ga0495674_0804632 3300047319 Bacteria 731
169 Ga0495684_0005866 3300047471 Bacteria 9545
170 Ga0495684_0104527 3300047471 Bacteria 2140
171 Ga0495684_0112073 3300047471 Bacteria 2058
172 Ga0495602_0043456 3300048088 Bacteria 4085
173 Ga0501034_0556958 3300049571 Bacteria 1055
174 Ga0501038_0278530 3300049574 Bacteria 1317
175 Ga0501047_0098218 3300049581 Bacteria 2807
176 Ga0501070_0018049 3300049586 Bacteria 5921
177 Ga0501073_0167321 3300049589 Bacteria 1522
178 Ga0501035_0455911 3300049822 Bacteria 1057
179 Ga0501044_0001257 3300049823 Bacteria 29993
180 nmdc:mga0qj67_139682_c1 3300050509 Bacteria 1964
181 nmdc:mga06r32_95271_c1 3300050510 Bacteria 2913
182 Ga0495601_0457651 3300053077 Bacteria 825
183 Ga0501082_0000199 3300060353 Bacteria 52195
184 Ga0157370_10655355
185 Ga0070683_100000019
186 Ga0070683_100506681
187 Ga0070670_100961380
188 Ga0070682_100684999
189 Ga0070689_100103768
190 Ga0070675_101090099
191 Ga0070714_100035658
192 Ga0070713_100002523
193 Ga0070713_100011179
194 Ga0070713_100015164
195 Ga0070711_100144608
196 Ga0070705_100542024
197 Ga0070678_100175346
198 Ga0068867_100393454
199 Ga0070699_100012616
200 Ga0070679_100569505
201 Ga0070684_100000003
202 Ga0070684_100279931
203 Ga0070697_100417863
204 Ga0070696_100001772
205 Ga0070665_100084437
206 Ga0068855_100355088
207 Ga0070664_100466209
208 Ga0068856_100744491
209 Ga0068852_100652035
210 Ga0068859_100075384
211 Ga0068864_100306161
212 Ga0068863_100121900
213 Ga0068863_100293990
214 Ga0068858_100220378
215 Ga0068858_100799491
216 Ga0070717_10002297
217 Ga0097621_100202261
218 Ga0075431_100009713
219 Ga0068865_100577534
220 Ga0097620_100075381
221 Ga0105240_10006267
222 Ga0105240_10466118
223 Ga0105240_10671665
224 Ga0105245_10092800
225 Ga0114129_10489668
226 Ga0114129_10809972
227 Ga0105243_10075382
228 Ga0105242_10037404
229 Ga0105242_10074164
230 Ga0105248_10021914
231 Ga0105248_10124733
232 Ga0105248_10141839
233 Ga0105248_10538175
234 Ga0105237_10015643
235 Ga0105238_10115494
236 Ga0105249_10166133
237 Ga0105239_10061846
238 Ga0105246_10087056
239 Ga0105246_10148180
240 Ga0105246_10681633
241 Ga0157370_11018564
242 Ga0157369_10042841
243 Ga0157369_10796787
244 Ga0157374_10183595
245 Ga0157378_11539272
246 Ga0163162_10175391
247 Ga0163162_10412334
248 Ga0163162_12076562
249 Ga0157372_10050147
250 Ga0157375_11792218
251 Ga0163163_10177942
252 Ga0157376_10419770
253 Ga0157376_10429785
254 Ga0157376_10567052
255 Ga0157376_10604864
256 Ga0213873_10012869
257 Ga0213875_10006476
258 Ga0213875_10028055
259 Ga0213875_10048204
260 Ga0213875_10221966
261 Ga0207642_10155307
262 Ga0207699_10025855
263 Ga0207707_10201192
264 Ga0207695_10012024
265 Ga0207695_10720556
266 Ga0207671_10579361
267 Ga0207663_10179836
268 Ga0207649_10290630
269 Ga0207694_10011929
270 Ga0207650_10704949
271 Ga0207659_11051916
272 Ga0207700_10039457
273 Ga0207700_10041486
274 Ga0207664_10027284
275 Ga0207686_10055571
276 Ga0207709_10078860
277 Ga0207669_10543789
278 Ga0207704_10503851
279 Ga0207711_10058775
280 Ga0207711_10062940
281 Ga0207711_10227893
282 Ga0207711_11202005
283 Ga0207661_10000019
284 Ga0207667_10271073
285 Ga0207712_10029296
286 Ga0207703_10162311
287 Ga0207703_10815182
288 Ga0207641_10096702
289 Ga0207641_10416838
290 Ga0207676_10549851
291 Ga0207698_10529948
292 Ga0268266_10061402
293 Ga0265325_10003125
294 Ga0265316_10001368
295 Ga0265316_10015592
296 Ga0265316_10118693
297 Ga0373954_0278584
298 Ga0373955_0058678
299 Ga0373935_0116314
300 Ga0373935_0837437
301 Ga0373927_0042674
302 Ga0373927_0719984
303 Ga0373933_0109752
304 Ga0373933_0401548
305 Ga0373933_0648177
306 Ga0373937_0610381
307 Ga0373925_0412837
308 Ga0436364_0148095
309 Ga0436364_0349717
310 Ga0436364_0633516
311 Ga0436364_0818237
312 Ga0436364_1208285
313 Ga0436365_0650674
314 Ga0436365_0810573
315 Ga0453683_0374809
316 Ga0451576_0065958
317 Ga0451576_0212024
318 Ga0451576_0229180
319 Ga0466967_0351559
320 Ga0495603_0233267
321 Ga0495651_0002965
322 Ga0495580_0014096
323 Ga0495580_0073588
324 Ga0495582_0377025
325 Ga0495664_0294764
326 Ga0495594_0267209
327 Ga0495608_0209218
328 Ga0495628_0127437
329 Ga0495652_0116086
330 Ga0495587_0175528
331 Ga0495587_0297040
332 Ga0495645_0019007
333 Ga0495645_0209763
334 Ga0495667_0203291
335 Ga0495635_0047094
336 Ga0495635_0160477
337 Ga0495635_0184010
338 Ga0495599_0063543
339 Ga0495623_0009599
340 Ga0495646_0293961
341 Ga0495658_0293164
342 Ga0495613_0090515
343 Ga0495624_0154909
344 Ga0495581_0448213
345 Ga0495604_0207830
346 Ga0495636_0156249
347 Ga0495674_0077054
348 Ga0495674_0083109
349 Ga0495674_0119449
350 Ga0495674_0140175
351 Ga0495674_0804632
352 Ga0495684_0005866
353 Ga0495684_0104527
354 Ga0495684_0112073
355 Ga0495602_0043456
356 Ga0501034_0556958
357 Ga0501038_0278530
358 Ga0501047_0098218
359 Ga0501070_0018049
360 Ga0501073_0167321
361 Ga0501035_0455911
362 Ga0501044_0001257
363 nmdc:mga0qj67_139682_c1
364 nmdc:mga06r32_95271_c1
365 Ga0495601_0457651
366 Ga0501082_0000199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

52

180

0.8

PF00117

GATase

Glutamine amidotransferase class-I

3

197

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9228 2 193
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9134 2 194
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9103 2 195
1ox6-assembly2.cif.gz_B towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.9096 1 194
1ox4-assembly1.cif.gz_A towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.9069 2 192
ID Description Score Start End Superfamily
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9324 1 192 3.40.50.880
af_A0A1D6L7F2_93_266_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9315 20 182 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9314 2 195 3.40.50.880
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9294 2 197 3.40.50.880
af_A0A1D6H537_1_181_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9281 61 195 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0R2Q129-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9715 1 197 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A7W1QN78-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9712 1 195 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829
AF-A0A0R2Q129-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9667 1 197 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A7W1QN78-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9663 1 195 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829
AF-A0A522RDP7-F1-model_v4 Multifunctional fusion protein [Includes: Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) (EC 3.5.1.2); Imidazole glycerol phosphate synthase subunit HisF (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF)] 0.9662 1 197 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Map