F279225

General Info

Members Datasets Scaffolds Average Seq Length
182 74 182 135

Family's Representative Sequence

Representative Sequence 3300025728|Ga0207655_1003452|Ga0207655_10034527
Length 165
Sequence MQSFRPSADGISLHGGGYRCQLHLNRFREIHMVTLEEISQLLYGAGKEAPGWQSTQDELIALAAKTFPGKAFCVVRQWILIDLTVNPVEKEKLTGLGLLPAALYAHEVILDSRSRFQAAMWVRSNFGISYTENCLFETKSTVYLLLGSGLRKNASIGTAFSMKAD

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
3 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
4 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
5 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
6 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
7 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
8 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
9 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
10 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
14 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
15 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
16 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
17 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
18 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
19 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
20 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
21 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
22 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
23 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
24 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
25 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
26 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
27 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
28 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
29 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
30 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
31 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
32 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
33 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
34 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
35 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
36 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
37 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
38 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
39 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
40 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
41 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
42 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
43 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
44 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
45 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
46 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
47 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
48 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
49 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
50 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
51 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
52 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
53 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
54 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
55 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
56 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
57 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
58 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
59 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
60 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
61 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
62 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
63 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
64 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
65 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
66 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
67 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
68 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
69 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
70 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
71 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
72 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
73 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
74 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10005877 3300005288 Bacteria 5702
2 Ga0065714_10066658 3300005288 Bacteria 6503
3 Ga0065714_10069565 3300005288 Bacteria 4172
4 Ga0065714_10091780 3300005288 Bacteria 1899
5 Ga0065714_10285648 3300005288 Bacteria 715
6 Ga0075432_10000158 3300006058 Bacteria 16454
7 Ga0075432_10013397 3300006058 Bacteria 2785
8 Ga0075432_10037809 3300006058 Bacteria 1681
9 Ga0075432_10098590 3300006058 Bacteria 1078
10 Ga0075432_10140979 3300006058 Bacteria 920
11 Ga0105244_10003322 3300009036 Bacteria 11581
12 Ga0105250_10001967 3300009092 Bacteria 10633
13 Ga0157370_10004227 3300013104 Bacteria 16615
14 Ga0157375_10028526 3300013308 Bacteria 5233
15 Ga0182006_1000217 3300015261 Bacteria 55940
16 Ga0182005_1000539 3300015265 Bacteria 19086
17 Ga0182005_1023651 3300015265 Bacteria 1678
18 Ga0163161_10026679 3300017792 Bacteria 4093
19 Ga0163161_10224918 3300017792 Bacteria 1454
20 Ga0207696_1004859 3300025711 Bacteria 5694
21 Ga0207696_1009847 3300025711 Bacteria 3540
22 Ga0207655_1003452 3300025728 Bacteria 11753
23 Ga0207713_1000647 3300025735 Bacteria 33352
24 Ga0207428_10002679 3300027907 Bacteria 17745
25 Ga0207428_10013812 3300027907 Bacteria 7038
26 Ga0207428_10114108 3300027907 Bacteria 2076
27 Ga0207428_10351961 3300027907 Bacteria 1083
28 Ga0207428_10851200 3300027907 Bacteria 646
29 Ga0439438_000027 3300041405 Bacteria 90232
30 Ga0439438_000230 3300041405 Bacteria 25388
31 Ga0439438_018929 3300041405 Bacteria 1954
32 Ga0439438_025288 3300041405 Bacteria 1619
33 Ga0439438_032680 3300041405 Bacteria 1378
34 Ga0439447_000013 3300041407 Bacteria 72615
35 Ga0439447_000146 3300041407 Bacteria 24195
36 Ga0439447_000220 3300041407 Bacteria 20214
37 Ga0439447_010969 3300041407 Bacteria 2667
38 Ga0439466_0004215 3300041411 Bacteria 5552
39 Ga0439432_009334 3300042006 Bacteria 3424
40 Ga0439451_000142 3300042009 Bacteria 13309
41 Ga0439452_000505 3300042010 Bacteria 21212
42 Ga0439452_009318 3300042010 Bacteria 2897
43 Ga0450911_029129 3300042115 Bacteria 716
44 Ga0450920_004516 3300042122 Bacteria 2448
45 Ga0450922_007623 3300042124 Bacteria 1018
46 Ga0450923_169066 3300042125 Bacteria 535
47 Ga0450907_000027 3300042146 Bacteria 69478
48 Ga0450907_000108 3300042146 Bacteria 31205
49 Ga0450910_000003 3300042147 Bacteria 81243
50 Ga0450908_011278 3300042184 Bacteria 1637
51 Ga0495617_002012 3300046452 Bacteria 8463
52 Ga0495617_011267 3300046452 Bacteria 3052
53 Ga0495617_014252 3300046452 Bacteria 2702
54 Ga0495627_186236 3300046453 Bacteria 574
55 Ga0495590_0000652 3300046457 Bacteria 16077
56 Ga0495591_001188 3300046458 Bacteria 17014
57 Ga0495591_002181 3300046458 Bacteria 11193
58 Ga0495638_0000243 3300046460 Bacteria 74582
59 Ga0495638_0004678 3300046460 Bacteria 10343
60 Ga0495638_0011891 3300046460 Bacteria 5983
61 Ga0495638_0013802 3300046460 Bacteria 5485
62 Ga0495638_0033108 3300046460 Bacteria 3306
63 Ga0495638_0040348 3300046460 Bacteria 2958
64 Ga0495638_0063051 3300046460 Bacteria 2286
65 Ga0495638_0279743 3300046460 Bacteria 907
66 Ga0495650_0000315 3300046471 Bacteria 86840
67 Ga0495650_0000624 3300046471 Bacteria 47668
68 Ga0495650_0018810 3300046471 Bacteria 3423
69 Ga0495650_0033486 3300046471 Bacteria 2286
70 Ga0495605_0004229 3300046474 Bacteria 8453
71 Ga0495605_0068608 3300046474 Bacteria 1680
72 Ga0495584_0000114 3300046491 Bacteria 55300
73 Ga0495584_0014547 3300046491 Bacteria 4010
74 Ga0495584_0053847 3300046491 Bacteria 2025
75 Ga0495584_0113932 3300046491 Bacteria 1368
76 Ga0495585_0009791 3300046492 Bacteria 5733
77 Ga0495585_0174072 3300046492 Bacteria 1110
78 Ga0495585_0562460 3300046492 Bacteria 538
79 Ga0495596_0000004 3300046500 Bacteria 163832
80 Ga0495596_0000035 3300046500 Bacteria 99331
81 Ga0495596_0000569 3300046500 Bacteria 23057
82 Ga0495607_0000371 3300046501 Bacteria 46279
83 Ga0495607_0028061 3300046501 Bacteria 3476
84 Ga0495607_0112423 3300046501 Bacteria 1442
85 Ga0495606_0000726 3300046507 Bacteria 50933
86 Ga0495606_0007974 3300046507 Bacteria 9318
87 Ga0495610_0001396 3300046512 Bacteria 21437
88 Ga0495610_0005930 3300046512 Bacteria 8559
89 Ga0495610_0070576 3300046512 Bacteria 1631
90 Ga0495610_0279593 3300046512 Bacteria 651
91 Ga0495616_0007595 3300046513 Bacteria 6488
92 Ga0495616_0027379 3300046513 Bacteria 3025
93 Ga0495616_0031394 3300046513 Bacteria 2782
94 Ga0495616_0196324 3300046513 Bacteria 889
95 Ga0495620_0068574 3300046515 Bacteria 1456
96 Ga0495630_0029270 3300046517 Bacteria 4094
97 Ga0495631_0000175 3300046518 Bacteria 43711
98 Ga0495632_0001160 3300046519 Bacteria 22448
99 Ga0495632_0019375 3300046519 Bacteria 3708
100 Ga0495632_0040828 3300046519 Bacteria 2334
101 Ga0495632_0146801 3300046519 Bacteria 1092
102 Ga0495637_0006656 3300046520 Bacteria 5785
103 Ga0495637_0007739 3300046520 Bacteria 5313
104 Ga0495637_0008917 3300046520 Bacteria 4908
105 Ga0495637_0026784 3300046520 Bacteria 2584
106 Ga0495637_0027982 3300046520 Bacteria 2519
107 Ga0495637_0084144 3300046520 Bacteria 1264
108 Ga0495643_0376922 3300046522 Bacteria 630
109 Ga0495644_0000068 3300046523 Bacteria 51396
110 Ga0495644_0293577 3300046523 Bacteria 635
111 Ga0495644_0400474 3300046523 Bacteria 543
112 Ga0495648_0004212 3300046524 Bacteria 12351
113 Ga0495648_0007087 3300046524 Bacteria 9024
114 Ga0495648_0011169 3300046524 Bacteria 6784
115 Ga0495648_0016263 3300046524 Bacteria 5367
116 Ga0495648_0040215 3300046524 Bacteria 2967
117 Ga0495648_0124466 3300046524 Bacteria 1380
118 Ga0495654_0001072 3300046530 Bacteria 19939
119 Ga0495654_0001151 3300046530 Bacteria 18961
120 Ga0495654_0001788 3300046530 Bacteria 14326
121 Ga0495654_0002160 3300046530 Bacteria 12815
122 Ga0495654_0003613 3300046530 Bacteria 9410
123 Ga0495654_0004939 3300046530 Bacteria 7844
124 Ga0495654_0016281 3300046530 Bacteria 3935
125 Ga0495654_0088470 3300046530 Bacteria 1440
126 Ga0495654_0112754 3300046530 Bacteria 1239
127 Ga0495654_0114859 3300046530 Bacteria 1225
128 Ga0495597_0000961 3300046542 Bacteria 22264
129 Ga0495597_0099996 3300046542 Bacteria 1224
130 Ga0495597_0371828 3300046542 Bacteria 546
131 Ga0495622_0077437 3300046557 Bacteria 1532
132 Ga0495668_0000159 3300046616 Bacteria 102319
133 Ga0495668_0000442 3300046616 Bacteria 53094
134 Ga0495668_0002547 3300046616 Bacteria 14837
135 Ga0495661_0000231 3300046665 Bacteria 64275
136 Ga0495661_0025488 3300046665 Bacteria 3818
137 Ga0495588_0004606 3300046674 Bacteria 6090
138 Ga0495670_0107286 3300046691 Bacteria 1443
139 Ga0495671_0000114 3300046692 Bacteria 72267
140 Ga0495671_0046239 3300046692 Bacteria 2176
141 Ga0495671_0054843 3300046692 Bacteria 1975
142 Ga0495671_0227558 3300046692 Bacteria 902
143 Ga0495671_0304249 3300046692 Bacteria 767
144 Ga0495649_0000924 3300046694 Bacteria 23282
145 Ga0495649_0001945 3300046694 Bacteria 15023
146 Ga0495660_0002094 3300046810 Bacteria 12927
147 Ga0495660_0021789 3300046810 Bacteria 3665
148 Ga0495660_0414872 3300046810 Bacteria 587
149 Ga0495636_0000214 3300047318 Bacteria 22668
150 Ga0495672_0000080 3300047320 Bacteria 160361
151 Ga0495672_0021932 3300047320 Bacteria 4159
152 Ga0495672_0149068 3300047320 Bacteria 1215
153 Ga0495683_0000132 3300047323 Bacteria 74780
154 Ga0495683_0000794 3300047323 Bacteria 22449
155 Ga0495683_0001561 3300047323 Bacteria 14828
156 Ga0495683_0019935 3300047323 Bacteria 3460
157 Ga0495683_0024280 3300047323 Bacteria 3112
158 Ga0495687_000050 3300047443 Bacteria 200856
159 Ga0495675_0003994 3300047444 Bacteria 8939
160 Ga0495679_091010 3300047446 Bacteria 856
161 Ga0495673_0002643 3300047469 Bacteria 12392
162 Ga0495673_0042076 3300047469 Bacteria 2053
163 Ga0495681_0003623 3300047470 Bacteria 10744
164 Ga0495681_0004020 3300047470 Bacteria 10124
165 Ga0495681_0030979 3300047470 Bacteria 2715
166 Ga0495681_0174652 3300047470 Bacteria 886
167 Ga0495681_0184594 3300047470 Bacteria 855
168 Ga0495593_0000027 3300047673 Bacteria 61044
169 Ga0495593_0019376 3300047673 Bacteria 3815
170 Ga0495626_0002759 3300048091 Bacteria 11801
171 Ga0495626_0002791 3300048091 Bacteria 11717
172 Ga0495626_0002845 3300048091 Bacteria 11566
173 Ga0495626_0019506 3300048091 Bacteria 3392
174 Ga0495626_0115592 3300048091 Bacteria 1158
175 Ga0496124_0000942 3300048927 Bacteria 46610
176 Ga0496125_0010077 3300048928 Bacteria 9588
177 Ga0495678_001699 3300049459 Bacteria 16611
178 Ga0495682_0003699 3300049460 Bacteria 6739
179 Ga0495682_0035375 3300049460 Bacteria 1840
180 Ga0495682_0129634 3300049460 Bacteria 902
181 nmdc:mga00v17_414164_c1 3300050491 Bacteria 535
182 nmdc:mga08x19_82363_c1 3300050514 Bacteria 2114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10285648 Ga0065714_102856481 133
2 3300006058 Ga0075432_10140979 Ga0075432_101409792 133
3 3300015265 Ga0182005_1000539 Ga0182005_100053911 133
4 3300042009 Ga0439451_000142 Ga0439451_000142_8173_8574 133
5 3300046452 Ga0495617_011267 Ga0495617_011267_2580_2981 133
6 3300046458 Ga0495591_002181 Ga0495591_002181_7941_8342 133
7 3300046460 Ga0495638_0004678 Ga0495638_0004678_1341_1742 133
8 3300046491 Ga0495584_0113932 Ga0495584_0113932_189_590 133
9 3300046500 Ga0495596_0000004 Ga0495596_0000004_23617_24018 133
10 3300046507 Ga0495606_0000726 Ga0495606_0000726_40322_40723 133
11 3300046512 Ga0495610_0070576 Ga0495610_0070576_180_617 133
12 3300046512 Ga0495610_0279593 Ga0495610_0279593_39_440 133
13 3300046513 Ga0495616_0027379 Ga0495616_0027379_1730_2131 133
14 3300046513 Ga0495616_0031394 Ga0495616_0031394_178_579 133
15 3300046518 Ga0495631_0000175 Ga0495631_0000175_3272_3673 133
16 3300046520 Ga0495637_0006656 Ga0495637_0006656_3313_3750 133
17 3300046520 Ga0495637_0026784 Ga0495637_0026784_1114_1515 133
18 3300046524 Ga0495648_0004212 Ga0495648_0004212_6163_6600 133
19 3300046524 Ga0495648_0007087 Ga0495648_0007087_506_907 133
20 3300046530 Ga0495654_0001788 Ga0495654_0001788_4772_5173 133
21 3300046530 Ga0495654_0016281 Ga0495654_0016281_2440_2841 133
22 3300046542 Ga0495597_0099996 Ga0495597_0099996_620_1021 133
23 3300046557 Ga0495622_0077437 Ga0495622_0077437_223_624 133
24 3300046616 Ga0495668_0000159 Ga0495668_0000159_16152_16553 133
25 3300046665 Ga0495661_0000231 Ga0495661_0000231_15343_15744 133
26 3300046692 Ga0495671_0046239 Ga0495671_0046239_1719_2120 133
27 3300046692 Ga0495671_0304249 Ga0495671_0304249_316_717 133
28 3300046810 Ga0495660_0414872 Ga0495660_0414872_29_430 133
29 3300047318 Ga0495636_0000214 Ga0495636_0000214_10793_11194 133
30 3300047469 Ga0495673_0002643 Ga0495673_0002643_10874_11275 133
31 3300047470 Ga0495681_0030979 Ga0495681_0030979_962_1363 133
32 3300047470 Ga0495681_0174652 Ga0495681_0174652_316_717 133
33 3300047673 Ga0495593_0000027 Ga0495593_0000027_2826_3227 133
34 3300048091 Ga0495626_0019506 Ga0495626_0019506_2742_3143 133
35 3300049460 Ga0495682_0035375 Ga0495682_0035375_156_557 133
36 3300005288 Ga0065714_10005877 Ga0065714_100058775 134
37 3300005288 Ga0065714_10066658 Ga0065714_100666586 134
38 3300005288 Ga0065714_10069565 Ga0065714_100695654 134
39 3300005288 Ga0065714_10091780 Ga0065714_100917802 134
40 3300006058 Ga0075432_10000158 Ga0075432_100001581 134
41 3300006058 Ga0075432_10013397 Ga0075432_100133972 134
42 3300006058 Ga0075432_10037809 Ga0075432_100378094 134
43 3300006058 Ga0075432_10098590 Ga0075432_100985902 134
44 3300009036 Ga0105244_10003322 Ga0105244_1000332210 134
45 3300009092 Ga0105250_10001967 Ga0105250_1000196711 134
46 3300013104 Ga0157370_10004227 Ga0157370_1000422711 134
47 3300013308 Ga0157375_10028526 Ga0157375_100285265 134
48 3300015261 Ga0182006_1000217 Ga0182006_100021743 134
49 3300015265 Ga0182005_1023651 Ga0182005_10236513 134
50 3300017792 Ga0163161_10026679 Ga0163161_100266793 134
51 3300017792 Ga0163161_10224918 Ga0163161_102249182 134
52 3300025711 Ga0207696_1004859 Ga0207696_10048594 134
53 3300025711 Ga0207696_1009847 Ga0207696_10098476 134
54 3300025728 Ga0207655_1003452 Ga0207655_10034527 134
55 3300025735 Ga0207713_1000647 Ga0207713_100064718 134
56 3300027907 Ga0207428_10002679 Ga0207428_1000267910 134
57 3300027907 Ga0207428_10013812 Ga0207428_100138125 134
58 3300027907 Ga0207428_10114108 Ga0207428_101141081 134
59 3300027907 Ga0207428_10351961 Ga0207428_103519612 134
60 3300027907 Ga0207428_10851200 Ga0207428_108512002 134
61 3300041405 Ga0439438_000027 Ga0439438_000027_26878_27282 134
62 3300041405 Ga0439438_000230 Ga0439438_000230_15152_15556 134
63 3300041405 Ga0439438_018929 Ga0439438_018929_1213_1617 134
64 3300041405 Ga0439438_025288 Ga0439438_025288_386_790 134
65 3300041405 Ga0439438_032680 Ga0439438_032680_813_1217 134
66 3300041407 Ga0439447_000013 Ga0439447_000013_58270_58674 134
67 3300041407 Ga0439447_000146 Ga0439447_000146_13854_14258 134
68 3300041407 Ga0439447_000220 Ga0439447_000220_11940_12344 134
69 3300041407 Ga0439447_010969 Ga0439447_010969_681_1085 134
70 3300041411 Ga0439466_0004215 Ga0439466_0004215_2658_3062 134
71 3300042006 Ga0439432_009334 Ga0439432_009334_2695_3099 134
72 3300042010 Ga0439452_000505 Ga0439452_000505_48_452 134
73 3300042010 Ga0439452_009318 Ga0439452_009318_1600_2004 134
74 3300042115 Ga0450911_029129 Ga0450911_029129_81_485 134
75 3300042122 Ga0450920_004516 Ga0450920_004516_1546_1950 134
76 3300042124 Ga0450922_007623 Ga0450922_007623_250_654 134
77 3300042125 Ga0450923_169066 Ga0450923_169066_68_472 134
78 3300042146 Ga0450907_000027 Ga0450907_000027_62436_62840 134
79 3300042146 Ga0450907_000108 Ga0450907_000108_15714_16118 134
80 3300042147 Ga0450910_000003 Ga0450910_000003_9772_10176 134
81 3300042184 Ga0450908_011278 Ga0450908_011278_99_503 134
82 3300046452 Ga0495617_002012 Ga0495617_002012_3395_3799 134
83 3300046452 Ga0495617_014252 Ga0495617_014252_2224_2628 134
84 3300046453 Ga0495627_186236 Ga0495627_186236_19_423 134
85 3300046457 Ga0495590_0000652 Ga0495590_0000652_7292_7696 134
86 3300046458 Ga0495591_001188 Ga0495591_001188_1589_1993 134
87 3300046460 Ga0495638_0000243 Ga0495638_0000243_50126_50530 134
88 3300046460 Ga0495638_0011891 Ga0495638_0011891_5554_5958 134
89 3300046460 Ga0495638_0013802 Ga0495638_0013802_841_1245 134
90 3300046460 Ga0495638_0033108 Ga0495638_0033108_541_945 134
91 3300046460 Ga0495638_0040348 Ga0495638_0040348_2070_2474 134
92 3300046460 Ga0495638_0063051 Ga0495638_0063051_811_1215 134
93 3300046460 Ga0495638_0279743 Ga0495638_0279743_44_448 134
94 3300046471 Ga0495650_0000315 Ga0495650_0000315_77923_78327 134
95 3300046471 Ga0495650_0000624 Ga0495650_0000624_10878_11282 134
96 3300046471 Ga0495650_0018810 Ga0495650_0018810_1826_2230 134
97 3300046471 Ga0495650_0033486 Ga0495650_0033486_55_459 134
98 3300046474 Ga0495605_0004229 Ga0495605_0004229_3456_3860 134
99 3300046474 Ga0495605_0068608 Ga0495605_0068608_143_547 134
100 3300046491 Ga0495584_0000114 Ga0495584_0000114_11333_11737 134
101 3300046491 Ga0495584_0014547 Ga0495584_0014547_1349_1753 134
102 3300046491 Ga0495584_0053847 Ga0495584_0053847_1424_1861 134
103 3300046492 Ga0495585_0009791 Ga0495585_0009791_3195_3599 134
104 3300046492 Ga0495585_0174072 Ga0495585_0174072_109_513 134
105 3300046492 Ga0495585_0562460 Ga0495585_0562460_56_460 134
106 3300046500 Ga0495596_0000035 Ga0495596_0000035_55618_56022 134
107 3300046500 Ga0495596_0000569 Ga0495596_0000569_8797_9201 134
108 3300046501 Ga0495607_0000371 Ga0495607_0000371_32601_33005 134
109 3300046501 Ga0495607_0028061 Ga0495607_0028061_1090_1494 134
110 3300046501 Ga0495607_0112423 Ga0495607_0112423_82_486 134
111 3300046507 Ga0495606_0007974 Ga0495606_0007974_5089_5493 134
112 3300046512 Ga0495610_0001396 Ga0495610_0001396_944_1348 134
113 3300046512 Ga0495610_0005930 Ga0495610_0005930_3327_3731 134
114 3300046513 Ga0495616_0007595 Ga0495616_0007595_3569_3973 134
115 3300046513 Ga0495616_0196324 Ga0495616_0196324_326_730 134
116 3300046515 Ga0495620_0068574 Ga0495620_0068574_741_1211 134
117 3300046517 Ga0495630_0029270 Ga0495630_0029270_1392_1796 134
118 3300046519 Ga0495632_0001160 Ga0495632_0001160_14160_14564 134
119 3300046519 Ga0495632_0019375 Ga0495632_0019375_2996_3400 134
120 3300046519 Ga0495632_0040828 Ga0495632_0040828_1890_2294 134
121 3300046519 Ga0495632_0146801 Ga0495632_0146801_677_1081 134
122 3300046520 Ga0495637_0007739 Ga0495637_0007739_4377_4781 134
123 3300046520 Ga0495637_0008917 Ga0495637_0008917_1831_2235 134
124 3300046520 Ga0495637_0027982 Ga0495637_0027982_1657_2061 134
125 3300046520 Ga0495637_0084144 Ga0495637_0084144_699_1103 134
126 3300046522 Ga0495643_0376922 Ga0495643_0376922_80_484 134
127 3300046523 Ga0495644_0000068 Ga0495644_0000068_27793_28197 134
128 3300046523 Ga0495644_0293577 Ga0495644_0293577_179_583 134
129 3300046523 Ga0495644_0400474 Ga0495644_0400474_129_533 134
130 3300046524 Ga0495648_0011169 Ga0495648_0011169_834_1238 134
131 3300046524 Ga0495648_0016263 Ga0495648_0016263_2177_2581 134
132 3300046524 Ga0495648_0040215 Ga0495648_0040215_502_906 134
133 3300046524 Ga0495648_0124466 Ga0495648_0124466_201_605 134
134 3300046530 Ga0495654_0001072 Ga0495654_0001072_5632_6036 134
135 3300046530 Ga0495654_0001151 Ga0495654_0001151_14442_14912 134
136 3300046530 Ga0495654_0002160 Ga0495654_0002160_4344_4748 134
137 3300046530 Ga0495654_0003613 Ga0495654_0003613_7958_8362 134
138 3300046530 Ga0495654_0004939 Ga0495654_0004939_1094_1498 134
139 3300046530 Ga0495654_0088470 Ga0495654_0088470_457_861 134
140 3300046530 Ga0495654_0112754 Ga0495654_0112754_177_581 134
141 3300046530 Ga0495654_0114859 Ga0495654_0114859_92_496 134
142 3300046542 Ga0495597_0000961 Ga0495597_0000961_8058_8462 134
143 3300046542 Ga0495597_0371828 Ga0495597_0371828_101_505 134
144 3300046616 Ga0495668_0000442 Ga0495668_0000442_41538_41942 134
145 3300046616 Ga0495668_0002547 Ga0495668_0002547_10716_11120 134
146 3300046665 Ga0495661_0025488 Ga0495661_0025488_907_1311 134
147 3300046674 Ga0495588_0004606 Ga0495588_0004606_2365_2769 134
148 3300046691 Ga0495670_0107286 Ga0495670_0107286_677_1081 134
149 3300046692 Ga0495671_0000114 Ga0495671_0000114_25863_26267 134
150 3300046692 Ga0495671_0054843 Ga0495671_0054843_258_662 134
151 3300046692 Ga0495671_0227558 Ga0495671_0227558_83_487 134
152 3300046694 Ga0495649_0000924 Ga0495649_0000924_8446_8850 134
153 3300046694 Ga0495649_0001945 Ga0495649_0001945_14372_14809 134
154 3300046810 Ga0495660_0002094 Ga0495660_0002094_3304_3708 134
155 3300046810 Ga0495660_0021789 Ga0495660_0021789_935_1339 134
156 3300047320 Ga0495672_0000080 Ga0495672_0000080_24135_24539 134
157 3300047320 Ga0495672_0021932 Ga0495672_0021932_2811_3215 134
158 3300047320 Ga0495672_0149068 Ga0495672_0149068_480_884 134
159 3300047323 Ga0495683_0000132 Ga0495683_0000132_65791_66195 134
160 3300047323 Ga0495683_0000794 Ga0495683_0000794_20355_20759 134
161 3300047323 Ga0495683_0001561 Ga0495683_0001561_3601_4041 134
162 3300047323 Ga0495683_0019935 Ga0495683_0019935_636_1040 134
163 3300047323 Ga0495683_0024280 Ga0495683_0024280_201_605 134
164 3300047443 Ga0495687_000050 Ga0495687_000050_66142_66546 134
165 3300047444 Ga0495675_0003994 Ga0495675_0003994_11_415 134
166 3300047446 Ga0495679_091010 Ga0495679_091010_92_496 134
167 3300047469 Ga0495673_0042076 Ga0495673_0042076_963_1388 134
168 3300047470 Ga0495681_0003623 Ga0495681_0003623_5852_6256 134
169 3300047470 Ga0495681_0004020 Ga0495681_0004020_1562_1966 134
170 3300047470 Ga0495681_0184594 Ga0495681_0184594_192_596 134
171 3300047673 Ga0495593_0019376 Ga0495593_0019376_126_530 134
172 3300048091 Ga0495626_0002759 Ga0495626_0002759_8524_8928 134
173 3300048091 Ga0495626_0002791 Ga0495626_0002791_7371_7775 134
174 3300048091 Ga0495626_0002845 Ga0495626_0002845_10239_10643 134
175 3300048091 Ga0495626_0115592 Ga0495626_0115592_391_795 134
176 3300048927 Ga0496124_0000942 Ga0496124_0000942_12113_12517 134
177 3300048928 Ga0496125_0010077 Ga0496125_0010077_5612_6016 134
178 3300049459 Ga0495678_001699 Ga0495678_001699_7248_7652 134
179 3300049460 Ga0495682_0003699 Ga0495682_0003699_455_859 134
180 3300049460 Ga0495682_0129634 Ga0495682_0129634_326_730 134
181 3300050491 nmdc:mga00v17_414164_c1 nmdc:mga00v17_414164_c1_43_447 134
182 3300050514 nmdc:mga08x19_82363_c1 nmdc:mga08x19_82363_c1_781_1221 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22275

DUF6957

Domain of unknown function (DUF6957)

50

161

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly1.cif.gz_G crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.6578 69 93
4b7x-assembly2.cif.gz_D crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.6352 66 93
4b7c-assembly2.cif.gz_D crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.6336 66 93
4b7c-assembly6.cif.gz_L crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.6323 66 93
4b7x-assembly3.cif.gz_L crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.6299 66 93
ID Description Score Start End Superfamily
af_I1JMF7_5_110_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.7144 72 92 3.90.180.10
af_Q54LY2_2_116_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.7036 72 93 3.90.180.10
af_F4IBH8_8_113_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.6619 72 92 3.90.180.10
af_K7VVX9_4_132_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.6259 67 93 3.90.180.10
af_P39346_4_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.6049 67 97 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A2D7N4M1-F1-model_v4 deleted 0.7218 38 131
AF-A0A2G2ESC2-F1-model_v4 deleted 0.714 40 131
AF-A0A7W2RKC1-F1-model_v4 Uncharacterized protein 0.704 41 129
AF-A0A0A7EMX1-F1-model_v4 Uncharacterized protein 0.7035 39 129
AF-A0A2S0UZR4-F1-model_v4 deleted 0.6995 40 131

Feature Viewer

pLDDT pTM Quality
59.06 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map