F277611

General Info

Members Datasets Scaffolds Average Seq Length
181 115 362 242

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10030451|Ga0265316_100304512
Length 259
Sequence MSGPPAEGTAPPGAAGEEEAARWVRGMFGRVARRYDFLNHLLSFNLDRTWRARTVRELRLALERPGARVLDLCCGTGDLLLALGRPLADARGSVQASALGIDFCHPMLVVARGKVERRRVNAALVEADALALPLADRSLDVVATAFGFRNLANYERGLREIERVLKPGGMAAILEFSQPPSRFFAALYRFYSRRILPAIGAAVSGERGAYEYLPESVRRFPGAGQLAEMMRQAGFVEVGFERLTGGIVALHVGRAKSAV

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
110 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
111 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
112 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10030451 3300031344 Bacteria 4423
2 Ga0070658_10085431 3300005327 Bacteria 2595
3 Ga0070683_100743095 3300005329 Unclassified 940
4 Ga0068869_100430392 3300005334 Bacteria 1090
5 Ga0070689_100187238 3300005340 Bacteria 1684
6 Ga0070671_100095066 3300005355 Bacteria 2498
7 Ga0070673_100085415 3300005364 Bacteria 2569
8 Ga0070673_100810611 3300005364 Bacteria 865
9 Ga0070688_100221972 3300005365 Bacteria 1332
10 Ga0070714_100001297 3300005435 Bacteria 18079
11 Ga0070713_100028387 3300005436 Bacteria 4418
12 Ga0070711_100002780 3300005439 Bacteria 10033
13 Ga0070700_100441345 3300005441 Bacteria 988
14 Ga0070678_100668335 3300005456 Bacteria 933
15 Ga0068867_100388639 3300005459 Bacteria 1174
16 Ga0068853_100439084 3300005539 Unclassified 1226
17 Ga0070695_100411954 3300005545 Bacteria 1027
18 Ga0070665_100049169 3300005548 Bacteria 4231
19 Ga0070665_100584628 3300005548 Bacteria 1129
20 Ga0068855_100045470 3300005563 Bacteria 5193
21 Ga0068855_100261102 3300005563 Bacteria 1929
22 Ga0070664_100727778 3300005564 Unclassified 925
23 Ga0068864_100519053 3300005618 Bacteria 1148
24 Ga0068864_100745159 3300005618 Bacteria 960
25 Ga0068863_100147496 3300005841 Bacteria 2250
26 Ga0070717_10028560 3300006028 Bacteria 4466
27 Ga0070717_10135055 3300006028 Bacteria 2124
28 Ga0070715_10135686 3300006163 Bacteria 1189
29 Ga0097621_100274300 3300006237 Bacteria 1483
30 Ga0075430_100117266 3300006846 Unclassified 2219
31 Ga0075431_100004798 3300006847 Bacteria 13306
32 Ga0075431_100035025 3300006847 Bacteria 5171
33 Ga0114129_10194240 3300009147 Bacteria 2754
34 Ga0114129_11275285 3300009147 Unclassified 912
35 Ga0105242_10699771 3300009176 Bacteria 991
36 Ga0105248_10173842 3300009177 Bacteria 2428
37 Ga0105237_10095862 3300009545 Bacteria 2957
38 Ga0105238_10180519 3300009551 Unclassified 2088
39 Ga0105239_10521269 3300010375 Bacteria 1352
40 Ga0157374_10425388 3300013296 Unclassified 1327
41 Ga0157372_10309989 3300013307 Bacteria 1837
42 Ga0163163_10038073 3300014325 Unclassified 4683
43 Ga0163163_10360786 3300014325 Unclassified 1510
44 Ga0163163_10365984 3300014325 Bacteria 1499
45 Ga0163163_10663253 3300014325 Bacteria 1107
46 Ga0157379_10389994 3300014968 Bacteria 1279
47 Ga0157379_10640868 3300014968 Bacteria 994
48 Ga0157376_10325989 3300014969 Bacteria 1462
49 Ga0157376_10951526 3300014969 Bacteria 879
50 Ga0213873_10071982 3300021358 Bacteria 954
51 Ga0213876_10176731 3300021384 Bacteria 1136
52 Ga0213875_10115232 3300021388 Bacteria 1256
53 Ga0207699_10093251 3300025906 Bacteria 1895
54 Ga0207705_10091789 3300025909 Bacteria 2224
55 Ga0207671_10170716 3300025914 Bacteria 1689
56 Ga0207700_10021280 3300025928 Bacteria 4425
57 Ga0207700_10075571 3300025928 Bacteria 2611
58 Ga0207664_10001436 3300025929 Bacteria 15663
59 Ga0207711_10326309 3300025941 Bacteria 1419
60 Ga0207667_10050121 3300025949 Bacteria 4406
61 Ga0207667_10377325 3300025949 Bacteria 1445
62 Ga0207712_10295763 3300025961 Viruses 1327
63 Ga0207708_10816174 3300026075 Unclassified 804
64 Ga0207641_10568103 3300026088 Unclassified 1108
65 Ga0207676_10704238 3300026095 Bacteria 979
66 Ga0268266_10504093 3300028379 Bacteria 1156
67 Ga0265318_10091307 3300028577 Bacteria 1122
68 Ga0265338_10013257 3300028800 Bacteria 9325
69 Ga0265338_10127178 3300028800 Bacteria 2020
70 Ga0265324_10011402 3300029957 Bacteria 3386
71 Ga0265330_10024954 3300031235 Bacteria 2711
72 Ga0265332_10045082 3300031238 Bacteria 1901
73 Ga0265320_10012456 3300031240 Bacteria 4946
74 Ga0265329_10008811 3300031242 Bacteria 3803
75 Ga0265340_10002848 3300031247 Bacteria 9842
76 Ga0265331_10002478 3300031250 Bacteria 12478
77 Ga0265331_10052475 3300031250 Unclassified 1948
78 Ga0265331_10190583 3300031250 Unclassified 925
79 Ga0265316_10002992 3300031344 Bacteria 17280
80 Ga0265316_10003112 3300031344 Bacteria 16913
81 Ga0265316_10011020 3300031344 Bacteria 8199
82 Ga0265316_10015023 3300031344 Bacteria 6787
83 Ga0265316_10145389 3300031344 Bacteria 1778
84 Ga0265316_10291587 3300031344 Bacteria 1190
85 Ga0265316_10387538 3300031344 Unclassified 1008
86 Ga0265314_10009280 3300031711 Bacteria 8332
87 Ga0265314_10015652 3300031711 Bacteria 6013
88 Ga0265314_10029113 3300031711 Bacteria 4109
89 Ga0265342_10021036 3300031712 Bacteria 4173
90 Ga0265342_10049465 3300031712 Bacteria 2515
91 Ga0265342_10095342 3300031712 Bacteria 1701
92 Ga0373923_0043204 3300035111 Bacteria 1865
93 Ga0373923_0091147 3300035111 Bacteria 1334
94 Ga0373932_0049122 3300035112 Bacteria 1246
95 Ga0373954_0012681 3300035118 Bacteria 3750
96 Ga0373954_0051628 3300035118 Bacteria 1932
97 Ga0373954_0232502 3300035118 Bacteria 907
98 Ga0373943_0347791 3300035170 Bacteria 849
99 Ga0373935_0082049 3300035692 Bacteria 2097
100 Ga0373927_0001645 3300035695 Bacteria 16750
101 Ga0373927_0008069 3300035695 Bacteria 7108
102 Ga0373927_0155833 3300035695 Bacteria 1496
103 Ga0373927_0366598 3300035695 Bacteria 950
104 Ga0373927_0402703 3300035695 Bacteria 903
105 Ga0373933_0070949 3300035724 Bacteria 2120
106 Ga0373947_0003312 3300035725 Bacteria 9545
107 Ga0373947_0049705 3300035725 Bacteria 2519
108 Ga0373947_0159358 3300035725 Bacteria 1459
109 Ga0373937_0317038 3300036401 Bacteria 1475
110 Ga0373925_0000240 3300037068 Bacteria 57904
111 Ga0373925_0047425 3300037068 Bacteria 3198
112 Ga0373925_0088052 3300037068 Bacteria 2371
113 Ga0373925_0181754 3300037068 Bacteria 1665
114 Ga0373925_0501702 3300037068 Unclassified 996
115 Ga0436364_0689097 3300037853 Bacteria 1876
116 Ga0436364_0905920 3300037853 Bacteria 8089
117 Ga0436365_0533164 3300039437 Bacteria 1305
118 Ga0436365_1068482 3300039437 Bacteria 2037
119 Ga0436365_1394924 3300039437 Bacteria 1081
120 Ga0436362_1123049 3300039453 Bacteria 1685
121 Ga0451576_0068501 3300045051 Bacteria 3693
122 Ga0451576_0339769 3300045051 Bacteria 1572
123 Ga0495651_0005457 3300046462 Bacteria 9702
124 Ga0495651_0134087 3300046462 Bacteria 1804
125 Ga0495651_0298177 3300046462 Bacteria 1082
126 Ga0495653_0300147 3300046463 Bacteria 1048
127 Ga0495580_0004479 3300046472 Bacteria 11736
128 Ga0495580_0007131 3300046472 Bacteria 9002
129 Ga0495580_0007165 3300046472 Bacteria 8979
130 Ga0495580_0033699 3300046472 Bacteria 3689
131 Ga0495580_0245451 3300046472 Bacteria 1227
132 Ga0495582_0183725 3300046473 Bacteria 1192
133 Ga0495639_0062462 3300046475 Bacteria 1709
134 Ga0495664_0261331 3300046477 Bacteria 1046
135 Ga0495628_0091020 3300046516 Bacteria 2361
136 Ga0495630_0505059 3300046517 Unclassified 927
137 Ga0495652_0100645 3300046529 Bacteria 2344
138 Ga0495652_0140391 3300046529 Bacteria 1900
139 Ga0495665_0031514 3300046531 Bacteria 2838
140 Ga0495640_0056247 3300046533 Bacteria 2688
141 Ga0495640_0071187 3300046533 Bacteria 2334
142 Ga0495586_0256812 3300046535 Bacteria 998
143 Ga0495587_0092704 3300046536 Bacteria 1744
144 Ga0495645_0013377 3300046543 Bacteria 5799
145 Ga0495667_0008611 3300046559 Bacteria 6925
146 Ga0495667_0070404 3300046559 Bacteria 2282
147 Ga0495667_0144187 3300046559 Bacteria 1534
148 Ga0495667_0596931 3300046559 Unclassified 688
149 Ga0495634_0022727 3300046642 Bacteria 4418
150 Ga0495635_0305739 3300046663 Bacteria 1066
151 Ga0495657_0288307 3300046675 Bacteria 981
152 Ga0495599_0016268 3300046678 Bacteria 4618
153 Ga0495623_0157670 3300046679 Bacteria 1336
154 Ga0495646_0236075 3300046680 Bacteria 984
155 Ga0495658_0119195 3300046683 Bacteria 1594
156 Ga0495613_0047716 3300046689 Bacteria 3163
157 Ga0495604_0055498 3300047317 Bacteria 3053
158 Ga0495604_0297732 3300047317 Bacteria 1084
159 Ga0495636_0032080 3300047318 Bacteria 2154
160 Ga0495674_0013848 3300047319 Bacteria 7570
161 Ga0495674_0021171 3300047319 Bacteria 6015
162 Ga0495674_0242053 3300047319 Bacteria 1486
163 Ga0495680_0034333 3300047322 Bacteria 4097
164 Ga0495680_0080987 3300047322 Bacteria 2452
165 Ga0495675_0012366 3300047444 Bacteria 5373
166 Ga0495684_0000754 3300047471 Bacteria 26092
167 Ga0495684_0027106 3300047471 Bacteria 4400
168 Ga0495684_0227376 3300047471 Bacteria 1365
169 Ga0495684_0231133 3300047471 Bacteria 1352
170 Ga0495684_0530394 3300047471 Unclassified 805
171 Ga0495602_0382231 3300048088 Bacteria 1008
172 Ga0496115_0136967 3300048918 Bacteria 2019
173 Ga0501247_007722 3300049677 Unclassified 1242
174 Ga0501249_006064 3300049679 Bacteria 2482
175 Ga0501250_026393 3300049680 Unclassified 783
176 Ga0501268_006583 3300049765 Unclassified 1712
177 nmdc:mga05p37_722154_c1 3300050507 Unclassified 1103
178 nmdc:mga0qj67_32194_c1 3300050509 Bacteria 4088
179 nmdc:mga06r32_20485_c1 3300050510 Bacteria 6090
180 nmdc:mga06r32_21314_c1 3300050510 Bacteria 5982
181 nmdc:mga06r32_934685_c1 3300050510 Unclassified 822
182 Ga0265316_10030451
183 Ga0070658_10085431
184 Ga0070683_100743095
185 Ga0068869_100430392
186 Ga0070689_100187238
187 Ga0070671_100095066
188 Ga0070673_100085415
189 Ga0070673_100810611
190 Ga0070688_100221972
191 Ga0070714_100001297
192 Ga0070713_100028387
193 Ga0070711_100002780
194 Ga0070700_100441345
195 Ga0070678_100668335
196 Ga0068867_100388639
197 Ga0068853_100439084
198 Ga0070695_100411954
199 Ga0070665_100049169
200 Ga0070665_100584628
201 Ga0068855_100045470
202 Ga0068855_100261102
203 Ga0070664_100727778
204 Ga0068864_100519053
205 Ga0068864_100745159
206 Ga0068863_100147496
207 Ga0070717_10028560
208 Ga0070717_10135055
209 Ga0070715_10135686
210 Ga0097621_100274300
211 Ga0075430_100117266
212 Ga0075431_100004798
213 Ga0075431_100035025
214 Ga0114129_10194240
215 Ga0114129_11275285
216 Ga0105242_10699771
217 Ga0105248_10173842
218 Ga0105237_10095862
219 Ga0105238_10180519
220 Ga0105239_10521269
221 Ga0157374_10425388
222 Ga0157372_10309989
223 Ga0163163_10038073
224 Ga0163163_10360786
225 Ga0163163_10365984
226 Ga0163163_10663253
227 Ga0157379_10389994
228 Ga0157379_10640868
229 Ga0157376_10325989
230 Ga0157376_10951526
231 Ga0213873_10071982
232 Ga0213876_10176731
233 Ga0213875_10115232
234 Ga0207699_10093251
235 Ga0207705_10091789
236 Ga0207671_10170716
237 Ga0207700_10021280
238 Ga0207700_10075571
239 Ga0207664_10001436
240 Ga0207711_10326309
241 Ga0207667_10050121
242 Ga0207667_10377325
243 Ga0207712_10295763
244 Ga0207708_10816174
245 Ga0207641_10568103
246 Ga0207676_10704238
247 Ga0268266_10504093
248 Ga0265318_10091307
249 Ga0265338_10013257
250 Ga0265338_10127178
251 Ga0265324_10011402
252 Ga0265330_10024954
253 Ga0265332_10045082
254 Ga0265320_10012456
255 Ga0265329_10008811
256 Ga0265340_10002848
257 Ga0265331_10002478
258 Ga0265331_10052475
259 Ga0265331_10190583
260 Ga0265316_10002992
261 Ga0265316_10003112
262 Ga0265316_10011020
263 Ga0265316_10015023
264 Ga0265316_10145389
265 Ga0265316_10291587
266 Ga0265316_10387538
267 Ga0265314_10009280
268 Ga0265314_10015652
269 Ga0265314_10029113
270 Ga0265342_10021036
271 Ga0265342_10049465
272 Ga0265342_10095342
273 Ga0373923_0043204
274 Ga0373923_0091147
275 Ga0373932_0049122
276 Ga0373954_0012681
277 Ga0373954_0051628
278 Ga0373954_0232502
279 Ga0373943_0347791
280 Ga0373935_0082049
281 Ga0373927_0001645
282 Ga0373927_0008069
283 Ga0373927_0155833
284 Ga0373927_0366598
285 Ga0373927_0402703
286 Ga0373933_0070949
287 Ga0373947_0003312
288 Ga0373947_0049705
289 Ga0373947_0159358
290 Ga0373937_0317038
291 Ga0373925_0000240
292 Ga0373925_0047425
293 Ga0373925_0088052
294 Ga0373925_0181754
295 Ga0373925_0501702
296 Ga0436364_0689097
297 Ga0436364_0905920
298 Ga0436365_0533164
299 Ga0436365_1068482
300 Ga0436365_1394924
301 Ga0436362_1123049
302 Ga0451576_0068501
303 Ga0451576_0339769
304 Ga0495651_0005457
305 Ga0495651_0134087
306 Ga0495651_0298177
307 Ga0495653_0300147
308 Ga0495580_0004479
309 Ga0495580_0007131
310 Ga0495580_0007165
311 Ga0495580_0033699
312 Ga0495580_0245451
313 Ga0495582_0183725
314 Ga0495639_0062462
315 Ga0495664_0261331
316 Ga0495628_0091020
317 Ga0495630_0505059
318 Ga0495652_0100645
319 Ga0495652_0140391
320 Ga0495665_0031514
321 Ga0495640_0056247
322 Ga0495640_0071187
323 Ga0495586_0256812
324 Ga0495587_0092704
325 Ga0495645_0013377
326 Ga0495667_0008611
327 Ga0495667_0070404
328 Ga0495667_0144187
329 Ga0495667_0596931
330 Ga0495634_0022727
331 Ga0495635_0305739
332 Ga0495657_0288307
333 Ga0495599_0016268
334 Ga0495623_0157670
335 Ga0495646_0236075
336 Ga0495658_0119195
337 Ga0495613_0047716
338 Ga0495604_0055498
339 Ga0495604_0297732
340 Ga0495636_0032080
341 Ga0495674_0013848
342 Ga0495674_0021171
343 Ga0495674_0242053
344 Ga0495680_0034333
345 Ga0495680_0080987
346 Ga0495675_0012366
347 Ga0495684_0000754
348 Ga0495684_0027106
349 Ga0495684_0227376
350 Ga0495684_0231133
351 Ga0495684_0530394
352 Ga0495602_0382231
353 Ga0496115_0136967
354 Ga0501247_007722
355 Ga0501249_006064
356 Ga0501250_026393
357 Ga0501268_006583
358 nmdc:mga05p37_722154_c1
359 nmdc:mga0qj67_32194_c1
360 nmdc:mga06r32_20485_c1
361 nmdc:mga06r32_21314_c1
362 nmdc:mga06r32_934685_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

70

173

0.93

PF08242

Methyltransf_12

Methyltransferase domain

70

171

0.93

PF13649

Methyltransf_25

Methyltransferase domain

69

169

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

15

255

0.91

PF13847

Methyltransf_31

Methyltransferase domain

63

234

0.9

PF13489

Methyltransf_23

Methyltransferase domain

45

238

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9058 5 221
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8826 5 221
2zbr-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine 0.8479 28 222
4pne-assembly3.cif.gz_A crystal structure of the [4+2]-cyclase spnf 0.8477 25 214
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.8468 28 222
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9486 6 221 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9358 5 221 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 6 221 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9244 5 222 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9219 5 221 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7S2RGM1-F1-model_v4 Uncharacterized protein 0.9665 92 202 GO:0008425
GO:0032259
AF-A0A1V0DTS3-F1-model_v4 deleted 0.9542 2 221
AF-S0F305-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9469 2 221 GO:0008425
GO:0031314
GO:0032259
AF-R5W8M8-F1-model_v4 deleted 0.9455 74 221
AF-F2IVM9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9445 2 221 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Map