F275142

General Info

Members Datasets Scaffolds Average Seq Length
180 124 180 95

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100210836|Ga0070713_1002108363
Length 105
Sequence MRVRWLRAALAELDAEAEYIARDNPRAAAKMVGSIATAVARLTRHPAMGRPGRVAGTRELVVPGTPYIIPYRVRGDFVEILRVFHAARKWPRSFDDPEVATREKP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0
Rhizoplane 1.67
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10044486 3300003323 Bacteria 2190
2 Ga0070692_11104423 3300005345 Bacteria 560
3 Ga0070669_100267213 3300005353 Bacteria 1366
4 Ga0070675_101834612 3300005354 Unclassified 559
5 Ga0070709_10323395 3300005434 Bacteria 1133
6 Ga0070709_10805580 3300005434 Bacteria 737
7 Ga0070713_100003919 3300005436 Bacteria 9876
8 Ga0070713_100210836 3300005436 Unclassified 1759
9 Ga0070711_100044226 3300005439 Bacteria 3022
10 Ga0070711_100319251 3300005439 Unclassified 1240
11 Ga0070711_101819064 3300005439 Unclassified 534
12 Ga0070708_100201422 3300005445 Bacteria 1864
13 Ga0070681_10900208 3300005458 Bacteria 803
14 Ga0070681_10988151 3300005458 Unclassified 761
15 Ga0068867_101217013 3300005459 Bacteria 692
16 Ga0070706_100132519 3300005467 Unclassified 2326
17 Ga0070707_100777780 3300005468 Archaea 921
18 Ga0070707_101054715 3300005468 Unclassified 778
19 Ga0070698_100136269 3300005471 Bacteria 2409
20 Ga0070698_100334305 3300005471 Bacteria 1446
21 Ga0070698_100461199 3300005471 Bacteria 1206
22 Ga0070697_100279872 3300005536 Archaea 1431
23 Ga0070697_100667237 3300005536 Bacteria 916
24 Ga0070697_101036013 3300005536 Unclassified 730
25 Ga0070686_100440566 3300005544 Bacteria 999
26 Ga0070665_100000171 3300005548 Bacteria 115314
27 Ga0070665_100111884 3300005548 Bacteria 2733
28 Ga0068855_100000602 3300005563 Bacteria 44034
29 Ga0070664_101832731 3300005564 Unclassified 575
30 Ga0068866_10134434 3300005718 Bacteria 1411
31 Ga0070717_10016979 3300006028 Bacteria 5654
32 Ga0070717_10848150 3300006028 Bacteria 831
33 Ga0070717_11965561 3300006028 Unclassified 527
34 Ga0070716_100524460 3300006173 Bacteria 878
35 Ga0075367_10057189 3300006178 Bacteria 2319
36 Ga0075428_100452001 3300006844 Unclassified 1376
37 Ga0075431_100290994 3300006847 Bacteria 1652
38 Ga0075431_101007982 3300006847 Bacteria 799
39 Ga0075433_10178631 3300006852 Bacteria 1889
40 Ga0075434_100388988 3300006871 Unclassified 1416
41 Ga0075436_100095930 3300006914 Bacteria 2063
42 Ga0075435_100091531 3300007076 Bacteria 2510
43 Ga0105240_11286072 3300009093 Bacteria 772
44 Ga0105240_11479083 3300009093 Unclassified 713
45 Ga0111539_11322714 3300009094 Unclassified 836
46 Ga0105245_10907293 3300009098 Unclassified 923
47 Ga0114129_12134916 3300009147 Unclassified 675
48 Ga0105242_10569528 3300009176 Bacteria 1089
49 Ga0105238_11190112 3300009551 Bacteria 786
50 Ga0105238_11699885 3300009551 Bacteria 662
51 Ga0105239_10900151 3300010375 Bacteria 1016
52 Ga0105239_10966448 3300010375 Unclassified 979
53 Ga0157373_11039984 3300013100 Bacteria 612
54 Ga0157374_10427692 3300013296 Unclassified 1323
55 Ga0157374_10452549 3300013296 Unclassified 1285
56 Ga0157374_10975959 3300013296 Unclassified 866
57 Ga0157372_10145597 3300013307 Bacteria 2732
58 Ga0157372_10865573 3300013307 Bacteria 1049
59 Ga0163163_10746359 3300014325 Bacteria 1042
60 Ga0157376_10124748 3300014969 Bacteria 2288
61 Ga0224572_1039935 3300024225 Unclassified 886
62 Ga0207692_10397623 3300025898 Unclassified 858
63 Ga0207642_10572492 3300025899 Unclassified 700
64 Ga0207685_10463998 3300025905 Unclassified 661
65 Ga0207699_10435086 3300025906 Bacteria 939
66 Ga0207699_10509822 3300025906 Bacteria 869
67 Ga0207684_10148459 3300025910 Bacteria 2017
68 Ga0207707_10914035 3300025912 Unclassified 725
69 Ga0207695_10000002 3300025913 Bacteria 2188391
70 Ga0207695_10167194 3300025913 Bacteria 2126
71 Ga0207695_11173566 3300025913 Unclassified 648
72 Ga0207693_10797219 3300025915 Unclassified 728
73 Ga0207693_11345816 3300025915 Bacteria 532
74 Ga0207663_10016864 3300025916 Bacteria 4062
75 Ga0207663_10169858 3300025916 Unclassified 1548
76 Ga0207646_10063176 3300025922 Bacteria 3306
77 Ga0207646_11005874 3300025922 Unclassified 736
78 Ga0207694_10339322 3300025924 Bacteria 1242
79 Ga0207694_10540378 3300025924 Unclassified 978
80 Ga0207659_11709841 3300025926 Unclassified 536
81 Ga0207700_10006811 3300025928 Bacteria 6945
82 Ga0207700_10524072 3300025928 Bacteria 1050
83 Ga0207664_10007593 3300025929 Bacteria 7523
84 Ga0207664_10336275 3300025929 Bacteria 1334
85 Ga0207664_11632583 3300025929 Bacteria 567
86 Ga0207706_11339952 3300025933 Unclassified 590
87 Ga0207665_10362006 3300025939 Unclassified 1097
88 Ga0207665_10562834 3300025939 Bacteria 887
89 Ga0207667_10005408 3300025949 Bacteria 15573
90 Ga0207639_10021475 3300026041 Bacteria 4638
91 Ga0209813_10161708 3300027866 Bacteria 808
92 Ga0265760_10112703 3300031090 Unclassified 867
93 Ga0265332_10058820 3300031238 Bacteria 1645
94 Ga0265332_10233915 3300031238 Bacteria 761
95 Ga0265332_10390230 3300031238 Bacteria 575
96 Ga0265325_10017113 3300031241 Bacteria 4034
97 Ga0265340_10011908 3300031247 Bacteria 4606
98 Ga0265340_10036522 3300031247 Bacteria 2434
99 Ga0265340_10475438 3300031247 Unclassified 550
100 Ga0265339_10045319 3300031249 Bacteria 2421
101 Ga0265339_10222046 3300031249 Bacteria 924
102 Ga0265339_10273629 3300031249 Unclassified 811
103 Ga0265331_10058910 3300031250 Bacteria 1817
104 Ga0265316_10007390 3300031344 Bacteria 10354
105 Ga0265316_10029113 3300031344 Bacteria 4546
106 Ga0265316_10049887 3300031344 Bacteria 3295
107 Ga0265313_10023650 3300031595 Bacteria 3305
108 Ga0265313_10037886 3300031595 Bacteria 2406
109 Ga0265314_10131859 3300031711 Bacteria 1558
110 Ga0265342_10010946 3300031712 Bacteria 6238
111 Ga0265342_10044481 3300031712 Bacteria 2676
112 Ga0265342_10107915 3300031712 Unclassified 1579
113 Ga0265342_10261795 3300031712 Bacteria 920
114 Ga0265342_10618846 3300031712 Bacteria 545
115 Ga0316576_10214470 3300031727 Unclassified 1448
116 Ga0316578_10264426 3300031728 Plasmid 1031
117 Ga0316577_10588426 3300031733 Bacteria 633
118 Ga0373944_0030094 3300035089 Bacteria 1627
119 Ga0373954_0139428 3300035118 Unclassified 1183
120 Ga0373927_0164058 3300035695 Bacteria 1456
121 Ga0373933_0111880 3300035724 Bacteria 1704
122 Ga0373947_0001950 3300035725 Bacteria 12629
123 Ga0373947_0027751 3300035725 Bacteria 3315
124 Ga0373947_0410736 3300035725 Unclassified 914
125 Ga0373947_0808062 3300035725 Unclassified 640
126 Ga0373947_0893579 3300035725 Bacteria 606
127 Ga0373937_0012881 3300036401 Bacteria 7366
128 Ga0373937_0464075 3300036401 Bacteria 1203
129 Ga0373937_0743721 3300036401 Bacteria 928
130 Ga0400484_06057 3300038725 Bacteria 2725
131 Ga0400490_51141 3300038726 Bacteria 1371
132 Ga0400483_034752 3300039062 Bacteria 1450
133 Ga0451797_0441547 3300041453 Unclassified 1009
134 Ga0451795_0594939 3300041456 Unclassified 566
135 Ga0495651_0640873 3300046462 Unclassified 667
136 Ga0495580_0030681 3300046472 Bacteria 3890
137 Ga0495628_0043475 3300046516 Bacteria 3579
138 Ga0495630_0468360 3300046517 Unclassified 966
139 Ga0495652_0598092 3300046529 Bacteria 753
140 Ga0495586_0752286 3300046535 Unclassified 562
141 Ga0495587_0089610 3300046536 Unclassified 1778
142 Ga0495667_0514400 3300046559 Unclassified 749
143 Ga0495667_0517543 3300046559 Bacteria 747
144 Ga0495667_0576700 3300046559 Unclassified 702
145 Ga0495635_0752029 3300046663 Bacteria 630
146 Ga0495658_0396303 3300046683 Bacteria 880
147 Ga0495624_0804709 3300046690 Unclassified 555
148 Ga0495636_0133950 3300047318 Bacteria 1103
149 Ga0495675_0755679 3300047444 Bacteria 541
150 Ga0495602_0025220 3300048088 Bacteria 5755
151 Ga0496104_0660863 3300048907 Bacteria 954
152 Ga0501036_1110972 3300049572 Unclassified 646
153 Ga0501039_1071725 3300049575 Unclassified 625
154 Ga0501040_0837196 3300049576 Bacteria 666
155 Ga0501041_0621780 3300049577 Bacteria 690
156 Ga0501071_0299099 3300049587 Bacteria 1220
157 Ga0501072_0469527 3300049588 Bacteria 996
158 Ga0501075_0248491 3300049591 Bacteria 1356
159 Ga0501076_0240798 3300049592 Bacteria 1480
160 Ga0501077_0223854 3300049593 Bacteria 1196
161 Ga0501079_0536779 3300049741 Bacteria 920
162 Ga0501083_0317446 3300049744 Unclassified 1013
163 Ga0501045_1124961 3300049824 Bacteria 574
164 nmdc:mga00v17_654783_c1 3300050491 Bacteria 675
165 nmdc:mga0yw44_606674_c1 3300050492 Bacteria 744
166 nmdc:mga0k408_522817_c1 3300050493 Unclassified 702
167 nmdc:mga06z11_259617_c1 3300050494 Bacteria 1025
168 nmdc:mga04h51_377991_c1 3300050495 Bacteria 590
169 nmdc:mga04h51_68829_c1 3300050495 Bacteria 1231
170 nmdc:mga06r32_1898263_c1 3300050510 Bacteria 530
171 nmdc:mga08y16_894853_c1 3300050511 Bacteria 874
172 nmdc:mga0n895_1296186_c1 3300050512 Bacteria 699
173 nmdc:mga0n895_72006_c1 3300050512 Bacteria 3428
174 nmdc:mga0n895_7830_c1 3300050512 Bacteria 9209
175 nmdc:mga0rr50_3236_c1 3300050513 Bacteria 9330
176 nmdc:mga0a205_1213778_c1 3300050515 Unclassified 602
177 Ga0495612_0603021 3300053078 Unclassified 507
178 Ga0500651_0540202 3300053093 Unclassified 639
179 Ga0530510_0070189 3300061734 Bacteria 2543
180 Ga0530510_0082747 3300061734 Bacteria 2337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10124748 Ga0157376_101247482 78
2 3300048907 Ga0496104_0660863 Ga0496104_0660863_451_687 78
3 3300025915 Ga0207693_10797219 Ga0207693_107972192 85
4 3300025929 Ga0207664_11632583 Ga0207664_116325831 85
5 3300036401 Ga0373937_0743721 Ga0373937_0743721_628_897 85
6 3300046516 Ga0495628_0043475 Ga0495628_0043475_792_1061 85
7 3300005471 Ga0070698_100461199 Ga0070698_1004611991 89
8 3300009094 Ga0111539_11322714 Ga0111539_113227142 91
9 3300031090 Ga0265760_10112703 Ga0265760_101127032 91
10 3300031727 Ga0316576_10214470 Ga0316576_102144702 91
11 3300031728 Ga0316578_10264426 Ga0316578_102644262 91
12 3300031733 Ga0316577_10588426 Ga0316577_105884261 91
13 3300006178 Ga0075367_10057189 Ga0075367_100571892 92
14 3300009551 Ga0105238_11699885 Ga0105238_116998851 92
15 3300025933 Ga0207706_11339952 Ga0207706_113399522 92
16 3300027866 Ga0209813_10161708 Ga0209813_101617082 92
17 3300050491 nmdc:mga00v17_654783_c1 nmdc:mga00v17_654783_c1_264_548 92
18 3300050492 nmdc:mga0yw44_606674_c1 nmdc:mga0yw44_606674_c1_75_359 92
19 3300050493 nmdc:mga0k408_522817_c1 nmdc:mga0k408_522817_c1_100_384 92
20 3300050494 nmdc:mga06z11_259617_c1 nmdc:mga06z11_259617_c1_339_623 92
21 3300050495 nmdc:mga04h51_68829_c1 nmdc:mga04h51_68829_c1_189_473 92
22 3300050511 nmdc:mga08y16_894853_c1 nmdc:mga08y16_894853_c1_365_649 92
23 3300005564 Ga0070664_101832731 Ga0070664_1018327312 93
24 3300025924 Ga0207694_10339322 Ga0207694_103393222 93
25 3300026041 Ga0207639_10021475 Ga0207639_100214755 93
26 3300005354 Ga0070675_101834612 Ga0070675_1018346122 94
27 3300005434 Ga0070709_10323395 Ga0070709_103233951 94
28 3300005434 Ga0070709_10805580 Ga0070709_108055802 94
29 3300005436 Ga0070713_100003919 Ga0070713_1000039193 94
30 3300005436 Ga0070713_100210836 Ga0070713_1002108363 94
31 3300005439 Ga0070711_100044226 Ga0070711_1000442263 94
32 3300005439 Ga0070711_100319251 Ga0070711_1003192512 94
33 3300005439 Ga0070711_101819064 Ga0070711_1018190641 94
34 3300005445 Ga0070708_100201422 Ga0070708_1002014222 94
35 3300005458 Ga0070681_10900208 Ga0070681_109002082 94
36 3300005458 Ga0070681_10988151 Ga0070681_109881512 94
37 3300005459 Ga0068867_101217013 Ga0068867_1012170132 94
38 3300005467 Ga0070706_100132519 Ga0070706_1001325193 94
39 3300005468 Ga0070707_100777780 Ga0070707_1007777802 94
40 3300005468 Ga0070707_101054715 Ga0070707_1010547152 94
41 3300005471 Ga0070698_100136269 Ga0070698_1001362693 94
42 3300005471 Ga0070698_100334305 Ga0070698_1003343054 94
43 3300005536 Ga0070697_100279872 Ga0070697_1002798723 94
44 3300005536 Ga0070697_100667237 Ga0070697_1006672372 94
45 3300005536 Ga0070697_101036013 Ga0070697_1010360132 94
46 3300005544 Ga0070686_100440566 Ga0070686_1004405661 94
47 3300005548 Ga0070665_100000171 Ga0070665_10000017182 94
48 3300005548 Ga0070665_100111884 Ga0070665_1001118843 94
49 3300005563 Ga0068855_100000602 Ga0068855_1000006025 94
50 3300005718 Ga0068866_10134434 Ga0068866_101344342 94
51 3300006028 Ga0070717_10016979 Ga0070717_100169793 94
52 3300006028 Ga0070717_10848150 Ga0070717_108481501 94
53 3300006028 Ga0070717_11965561 Ga0070717_119655612 94
54 3300006173 Ga0070716_100524460 Ga0070716_1005244601 94
55 3300006844 Ga0075428_100452001 Ga0075428_1004520013 94
56 3300006847 Ga0075431_100290994 Ga0075431_1002909943 94
57 3300006847 Ga0075431_101007982 Ga0075431_1010079822 94
58 3300006852 Ga0075433_10178631 Ga0075433_101786312 94
59 3300006871 Ga0075434_100388988 Ga0075434_1003889881 94
60 3300006914 Ga0075436_100095930 Ga0075436_1000959303 94
61 3300007076 Ga0075435_100091531 Ga0075435_1000915313 94
62 3300009093 Ga0105240_11286072 Ga0105240_112860721 94
63 3300009093 Ga0105240_11479083 Ga0105240_114790832 94
64 3300009098 Ga0105245_10907293 Ga0105245_109072931 94
65 3300009147 Ga0114129_12134916 Ga0114129_121349161 94
66 3300009176 Ga0105242_10569528 Ga0105242_105695283 94
67 3300009551 Ga0105238_11190112 Ga0105238_111901122 94
68 3300010375 Ga0105239_10900151 Ga0105239_109001513 94
69 3300010375 Ga0105239_10966448 Ga0105239_109664482 94
70 3300013100 Ga0157373_11039984 Ga0157373_110399841 94
71 3300013296 Ga0157374_10427692 Ga0157374_104276922 94
72 3300013296 Ga0157374_10452549 Ga0157374_104525492 94
73 3300013296 Ga0157374_10975959 Ga0157374_109759592 94
74 3300013307 Ga0157372_10145597 Ga0157372_101455972 94
75 3300013307 Ga0157372_10865573 Ga0157372_108655733 94
76 3300014325 Ga0163163_10746359 Ga0163163_107463592 94
77 3300024225 Ga0224572_1039935 Ga0224572_10399352 94
78 3300025898 Ga0207692_10397623 Ga0207692_103976231 94
79 3300025899 Ga0207642_10572492 Ga0207642_105724921 94
80 3300025905 Ga0207685_10463998 Ga0207685_104639981 94
81 3300025906 Ga0207699_10435086 Ga0207699_104350862 94
82 3300025906 Ga0207699_10509822 Ga0207699_105098221 94
83 3300025910 Ga0207684_10148459 Ga0207684_101484593 94
84 3300025912 Ga0207707_10914035 Ga0207707_109140352 94
85 3300025913 Ga0207695_10000002 Ga0207695_100000021606 94
86 3300025913 Ga0207695_10167194 Ga0207695_101671944 94
87 3300025913 Ga0207695_11173566 Ga0207695_111735662 94
88 3300025915 Ga0207693_11345816 Ga0207693_113458161 94
89 3300025916 Ga0207663_10016864 Ga0207663_100168643 94
90 3300025916 Ga0207663_10169858 Ga0207663_101698582 94
91 3300025922 Ga0207646_10063176 Ga0207646_100631762 94
92 3300025922 Ga0207646_11005874 Ga0207646_110058742 94
93 3300025924 Ga0207694_10540378 Ga0207694_105403782 94
94 3300025926 Ga0207659_11709841 Ga0207659_117098412 94
95 3300025928 Ga0207700_10006811 Ga0207700_100068116 94
96 3300025928 Ga0207700_10524072 Ga0207700_105240721 94
97 3300025929 Ga0207664_10007593 Ga0207664_100075933 94
98 3300025929 Ga0207664_10336275 Ga0207664_103362752 94
99 3300025939 Ga0207665_10362006 Ga0207665_103620061 94
100 3300025939 Ga0207665_10562834 Ga0207665_105628341 94
101 3300025949 Ga0207667_10005408 Ga0207667_100054084 94
102 3300031238 Ga0265332_10058820 Ga0265332_100588203 94
103 3300031238 Ga0265332_10233915 Ga0265332_102339152 94
104 3300031241 Ga0265325_10017113 Ga0265325_100171133 94
105 3300031247 Ga0265340_10475438 Ga0265340_104754381 94
106 3300031249 Ga0265339_10045319 Ga0265339_100453193 94
107 3300031249 Ga0265339_10222046 Ga0265339_102220462 94
108 3300031250 Ga0265331_10058910 Ga0265331_100589103 94
109 3300031344 Ga0265316_10007390 Ga0265316_100073905 94
110 3300031344 Ga0265316_10029113 Ga0265316_100291134 94
111 3300031344 Ga0265316_10049887 Ga0265316_100498873 94
112 3300031595 Ga0265313_10037886 Ga0265313_100378863 94
113 3300031711 Ga0265314_10131859 Ga0265314_101318593 94
114 3300031712 Ga0265342_10010946 Ga0265342_100109462 94
115 3300031712 Ga0265342_10107915 Ga0265342_101079153 94
116 3300031712 Ga0265342_10261795 Ga0265342_102617951 94
117 3300035089 Ga0373944_0030094 Ga0373944_0030094_854_1138 94
118 3300035118 Ga0373954_0139428 Ga0373954_0139428_311_595 94
119 3300035695 Ga0373927_0164058 Ga0373927_0164058_421_705 94
120 3300035724 Ga0373933_0111880 Ga0373933_0111880_1108_1392 94
121 3300035725 Ga0373947_0001950 Ga0373947_0001950_1484_1768 94
122 3300035725 Ga0373947_0027751 Ga0373947_0027751_2935_3219 94
123 3300035725 Ga0373947_0410736 Ga0373947_0410736_417_701 94
124 3300035725 Ga0373947_0808062 Ga0373947_0808062_22_306 94
125 3300035725 Ga0373947_0893579 Ga0373947_0893579_179_463 94
126 3300036401 Ga0373937_0012881 Ga0373937_0012881_2977_3261 94
127 3300036401 Ga0373937_0464075 Ga0373937_0464075_217_501 94
128 3300038725 Ga0400484_06057 Ga0400484_06057_428_712 94
129 3300038726 Ga0400490_51141 Ga0400490_51141_561_845 94
130 3300039062 Ga0400483_034752 Ga0400483_034752_481_876 94
131 3300041453 Ga0451797_0441547 Ga0451797_0441547_547_831 94
132 3300041456 Ga0451795_0594939 Ga0451795_0594939_77_361 94
133 3300046462 Ga0495651_0640873 Ga0495651_0640873_117_401 94
134 3300046472 Ga0495580_0030681 Ga0495580_0030681_3527_3811 94
135 3300046517 Ga0495630_0468360 Ga0495630_0468360_34_318 94
136 3300046529 Ga0495652_0598092 Ga0495652_0598092_394_678 94
137 3300046535 Ga0495586_0752286 Ga0495586_0752286_204_488 94
138 3300046536 Ga0495587_0089610 Ga0495587_0089610_1429_1713 94
139 3300046559 Ga0495667_0514400 Ga0495667_0514400_109_393 94
140 3300046559 Ga0495667_0517543 Ga0495667_0517543_345_629 94
141 3300046559 Ga0495667_0576700 Ga0495667_0576700_18_302 94
142 3300046663 Ga0495635_0752029 Ga0495635_0752029_218_502 94
143 3300046683 Ga0495658_0396303 Ga0495658_0396303_193_477 94
144 3300046690 Ga0495624_0804709 Ga0495624_0804709_55_339 94
145 3300047318 Ga0495636_0133950 Ga0495636_0133950_797_1081 94
146 3300047444 Ga0495675_0755679 Ga0495675_0755679_19_303 94
147 3300048088 Ga0495602_0025220 Ga0495602_0025220_3578_3862 94
148 3300049576 Ga0501040_0837196 Ga0501040_0837196_247_531 94
149 3300049577 Ga0501041_0621780 Ga0501041_0621780_175_459 94
150 3300049587 Ga0501071_0299099 Ga0501071_0299099_750_1043 94
151 3300049588 Ga0501072_0469527 Ga0501072_0469527_335_628 94
152 3300049591 Ga0501075_0248491 Ga0501075_0248491_476_769 94
153 3300049592 Ga0501076_0240798 Ga0501076_0240798_210_503 94
154 3300049593 Ga0501077_0223854 Ga0501077_0223854_417_704 94
155 3300049741 Ga0501079_0536779 Ga0501079_0536779_560_847 94
156 3300049744 Ga0501083_0317446 Ga0501083_0317446_662_949 94
157 3300049824 Ga0501045_1124961 Ga0501045_1124961_40_324 94
158 3300050510 nmdc:mga06r32_1898263_c1 nmdc:mga06r32_1898263_c1_204_488 94
159 3300050512 nmdc:mga0n895_1296186_c1 nmdc:mga0n895_1296186_c1_203_487 94
160 3300050512 nmdc:mga0n895_72006_c1 nmdc:mga0n895_72006_c1_2351_2635 94
161 3300050512 nmdc:mga0n895_7830_c1 nmdc:mga0n895_7830_c1_2159_2443 94
162 3300050513 nmdc:mga0rr50_3236_c1 nmdc:mga0rr50_3236_c1_4014_4298 94
163 3300050515 nmdc:mga0a205_1213778_c1 nmdc:mga0a205_1213778_c1_89_373 94
164 3300053078 Ga0495612_0603021 Ga0495612_0603021_66_350 94
165 3300053093 Ga0500651_0540202 Ga0500651_0540202_102_386 94
166 3300061734 Ga0530510_0082747 Ga0530510_0082747_1980_2273 94
167 3300003323 rootH1_10044486 rootH1_100444862 95
168 3300005345 Ga0070692_11104423 Ga0070692_111044231 95
169 3300005353 Ga0070669_100267213 Ga0070669_1002672131 95
170 3300031238 Ga0265332_10390230 Ga0265332_103902302 95
171 3300031247 Ga0265340_10011908 Ga0265340_100119084 95
172 3300031247 Ga0265340_10036522 Ga0265340_100365222 95
173 3300031249 Ga0265339_10273629 Ga0265339_102736293 95
174 3300031595 Ga0265313_10023650 Ga0265313_100236504 95
175 3300031712 Ga0265342_10044481 Ga0265342_100444812 95
176 3300031712 Ga0265342_10618846 Ga0265342_106188462 95
177 3300049572 Ga0501036_1110972 Ga0501036_1110972_333_620 95
178 3300049575 Ga0501039_1071725 Ga0501039_1071725_58_345 95
179 3300050495 nmdc:mga04h51_377991_c1 nmdc:mga04h51_377991_c1_275_562 95
180 3300061734 Ga0530510_0070189 Ga0530510_0070189_1767_2054 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

3

90

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xrw-assembly2.cif.gz_C chromosomal parde ta system from p. aeruginosa 0.9018 1 86
8c26-assembly1.cif.gz_A parde2 toxin-antitoxin complex from mycobacterium tuberculosis (rv2142a-rv2142c) 0.8998 2 86
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8986 1 92
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.8811 3 90
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8717 1 92
ID Description Score Start End Superfamily
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9134 3 90 3.30.2310.20
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8895 3 90 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8853 3 90 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8772 1 90 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8579 1 95 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A2S4EHS1-F1-model_v4 deleted 0.995 1 94
AF-A0A2V9T161-F1-model_v4 Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family 0.9918 1 92
AF-A0A560GP87-F1-model_v4 Addiction module RelE/StbE family toxin 0.9915 1 92
AF-A0A1E7IPJ8-F1-model_v4 Toxin Y4kP 0.9913 1 95
AF-A0A1F6Q457-F1-model_v4 Toxin Y4kP 0.9906 2 95

Feature Viewer

pLDDT pTM Quality
95 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map