F274614

General Info

Members Datasets Scaffolds Average Seq Length
179 139 179 157

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0000428|Ga0495619_0000428_18998_19480
Length 154
Sequence MEAALLVALIAIALLAGELLLSTGGVLAAIGAIGLMLSSDSGAADVVGPALIALGLLSIVGFWFVTRKVIEAHRAEPVRTGTEELLGSIAEVRSTLDPEGQVWAGGTVWGARLGAGGDGPVRLGDRVRIEAIDGLTLVVRPEPHPADGAEEGAG

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 10.61
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001539 3300003659 Bacteria 4090
2 Ga0070658_11080561 3300005327 Bacteria 698
3 Ga0070683_100002810 3300005329 Bacteria 13924
4 Ga0070683_100018205 3300005329 Bacteria 6218
5 Ga0070683_100545486 3300005329 Bacteria 1109
6 Ga0070670_100044871 3300005331 Bacteria 3800
7 Ga0070666_10007866 3300005335 Bacteria 6584
8 Ga0070682_100000216 3300005337 Bacteria 42444
9 Ga0068868_100004377 3300005338 Bacteria 9901
10 Ga0070660_100196663 3300005339 Bacteria 1635
11 Ga0070689_100111216 3300005340 Bacteria 2179
12 Ga0070691_10000024 3300005341 Bacteria 41375
13 Ga0070661_100000161 3300005344 Bacteria 55183
14 Ga0070692_10043241 3300005345 Bacteria 2316
15 Ga0070668_100192332 3300005347 Bacteria 1671
16 Ga0070675_100000153 3300005354 Bacteria 41558
17 Ga0070688_100000853 3300005365 Bacteria 15130
18 Ga0070688_100009361 3300005365 Bacteria 5354
19 Ga0070688_100178329 3300005365 Bacteria 1472
20 Ga0070659_100091253 3300005366 Bacteria 2442
21 Ga0070667_100274065 3300005367 Bacteria 1513
22 Ga0070714_100595866 3300005435 Bacteria 1061
23 Ga0070713_100000076 3300005436 Bacteria 61668
24 Ga0070713_100032741 3300005436 Bacteria 4156
25 Ga0070711_100480974 3300005439 Bacteria 1021
26 Ga0068867_100000247 3300005459 Bacteria 35692
27 Ga0070685_10000203 3300005466 Bacteria 39835
28 Ga0070685_10001711 3300005466 Bacteria 11510
29 Ga0070685_10129068 3300005466 Bacteria 1579
30 Ga0070684_100005535 3300005535 Bacteria 9692
31 Ga0070684_100010577 3300005535 Bacteria 7315
32 Ga0070684_100142899 3300005535 Bacteria 2165
33 Ga0068853_100204049 3300005539 Bacteria 1800
34 Ga0068853_100336001 3300005539 Bacteria 1403
35 Ga0070672_100000262 3300005543 Bacteria 29769
36 Ga0070695_100161958 3300005545 Bacteria 1571
37 Ga0070665_100093706 3300005548 Bacteria 3008
38 Ga0070665_101164519 3300005548 Bacteria 782
39 Ga0070704_100157998 3300005549 Bacteria 1790
40 Ga0068854_100000115 3300005578 Bacteria 55089
41 Ga0068856_100000057 3300005614 Bacteria 102045
42 Ga0070702_100071820 3300005615 Bacteria 2047
43 Ga0068852_100000058 3300005616 Bacteria 75312
44 Ga0068851_10000580 3300005834 Bacteria 15927
45 Ga0068851_10007843 3300005834 Bacteria 4917
46 Ga0081540_1003244 3300005983 Bacteria 12942
47 Ga0081540_1091287 3300005983 Bacteria 1339
48 Ga0081539_10000872 3300005985 Bacteria 57857
49 Ga0070712_100026728 3300006175 Bacteria 3848
50 Ga0097621_100739232 3300006237 Bacteria 908
51 Ga0075430_100009221 3300006846 Bacteria 8341
52 Ga0068865_100000020 3300006881 Bacteria 104487
53 Ga0105245_10000159 3300009098 Bacteria 63630
54 Ga0105245_10093658 3300009098 Bacteria 2768
55 Ga0105247_10129902 3300009101 Bacteria 1641
56 Ga0105243_10012796 3300009148 Bacteria 6338
57 Ga0105241_10049074 3300009174 Bacteria 3214
58 Ga0105248_10000022 3300009177 Bacteria 275935
59 Ga0105239_10216660 3300010375 Bacteria 2147
60 Ga0157371_10035029 3300013102 Bacteria 3599
61 Ga0157370_10044157 3300013104 Bacteria 4286
62 Ga0157370_10246042 3300013104 Bacteria 1654
63 Ga0157369_10000118 3300013105 Bacteria 111618
64 Ga0157378_10002688 3300013297 Bacteria 15824
65 Ga0157372_10082536 3300013307 Bacteria 3639
66 Ga0157375_10715361 3300013308 Bacteria 1154
67 Ga0157380_10000024 3300014326 Bacteria 110947
68 Ga0157380_11099548 3300014326 Bacteria 834
69 Ga0157379_10080216 3300014968 Bacteria 2923
70 Ga0157376_11512085 3300014969 Bacteria 704
71 Ga0206356_10857105 3300020070 Bacteria 2380
72 Ga0206353_10641775 3300020082 Bacteria 753
73 Ga0207656_10000299 3300025321 Bacteria 17123
74 Ga0207656_10008492 3300025321 Bacteria 3783
75 Ga0207710_10131939 3300025900 Bacteria 1200
76 Ga0207680_10055757 3300025903 Bacteria 2383
77 Ga0207685_10042691 3300025905 Bacteria 1704
78 Ga0207654_10057673 3300025911 Bacteria 2257
79 Ga0207693_10119837 3300025915 Bacteria 2066
80 Ga0207662_10959353 3300025918 Bacteria 606
81 Ga0207657_10178558 3300025919 Bacteria 1717
82 Ga0207649_10000024 3300025920 Bacteria 183104
83 Ga0207650_10064421 3300025925 Bacteria 2744
84 Ga0207659_10000043 3300025926 Bacteria 90795
85 Ga0207687_10000011 3300025927 Bacteria 388349
86 Ga0207687_10014582 3300025927 Bacteria 5144
87 Ga0207700_10000009 3300025928 Bacteria 314953
88 Ga0207700_10051227 3300025928 Bacteria 3080
89 Ga0207664_10862723 3300025929 Bacteria 814
90 Ga0207690_10005498 3300025932 Bacteria 7474
91 Ga0207709_10016508 3300025935 Bacteria 4105
92 Ga0207670_10152264 3300025936 Bacteria 1717
93 Ga0207704_10000004 3300025938 Bacteria 239295
94 Ga0207691_10000374 3300025940 Bacteria 45009
95 Ga0207711_10000019 3300025941 Bacteria 412779
96 Ga0207661_10000142 3300025944 Bacteria 45456
97 Ga0207661_10000212 3300025944 Bacteria 37559
98 Ga0207661_10494420 3300025944 Bacteria 1117
99 Ga0207679_10069092 3300025945 Bacteria 2657
100 Ga0207668_10178777 3300025972 Bacteria 1671
101 Ga0207640_10000059 3300025981 Bacteria 90901
102 Ga0207658_10284746 3300025986 Bacteria 1418
103 Ga0207677_10002718 3300026023 Bacteria 9326
104 Ga0207639_10172511 3300026041 Bacteria 1833
105 Ga0207639_10574835 3300026041 Bacteria 1037
106 Ga0207708_11063324 3300026075 Bacteria 705
107 Ga0207702_10000027 3300026078 Bacteria 183792
108 Ga0207702_10019923 3300026078 Bacteria 5558
109 Ga0207648_10000230 3300026089 Bacteria 59713
110 Ga0207683_10057651 3300026121 Bacteria 3409
111 Ga0207698_10000002 3300026142 Bacteria 404991
112 Ga0268266_10000809 3300028379 Bacteria 41366
113 Ga0268266_10104765 3300028379 Bacteria 2498
114 Ga0268266_10187488 3300028379 Bacteria 1887
115 Ga0307415_100028959 3300032126 Bacteria 3532
116 Ga0373937_0773991 3300036401 Bacteria 907
117 Ga0451839_0614650 3300041496 Bacteria 724
118 Ga0451853_2508159 3300041512 Bacteria 877
119 Ga0466963_0014584 3300044694 Bacteria 4850
120 Ga0466957_0000145 3300044842 Bacteria 30469
121 Ga0466957_0128477 3300044842 Unclassified 1621
122 Ga0466958_0027248 3300045836 Bacteria 3382
123 Ga0466967_0000008 3300045976 Bacteria 127135
124 Ga0495582_0000012 3300046473 Bacteria 112893
125 Ga0495662_0001149 3300046476 Bacteria 13032
126 Ga0495585_0317147 3300046492 Unclassified 763
127 Ga0495608_0000001 3300046511 Bacteria 411278
128 Ga0495610_0053349 3300046512 Bacteria 1959
129 Ga0495637_0251252 3300046520 Bacteria 636
130 Ga0495652_0000086 3300046529 Bacteria 99373
131 Ga0495587_0058496 3300046536 Bacteria 2264
132 Ga0495588_0000240 3300046674 Bacteria 46975
133 Ga0495657_0000002 3300046675 Bacteria 411958
134 Ga0495599_0073047 3300046678 Bacteria 2141
135 Ga0495658_0000008 3300046683 Bacteria 115426
136 Ga0495658_0005991 3300046683 Bacteria 5969
137 Ga0495613_0000298 3300046689 Bacteria 44864
138 Ga0495613_0434528 3300046689 Bacteria 891
139 Ga0495600_0026058 3300046809 Bacteria 3771
140 Ga0495604_0000850 3300047317 Bacteria 25489
141 Ga0495604_0168338 3300047317 Bacteria 1543
142 Ga0495674_0000007 3300047319 Bacteria 336257
143 Ga0495676_0028748 3300047321 Bacteria 4743
144 Ga0495675_0000046 3300047444 Bacteria 82596
145 Ga0495673_0178675 3300047469 Bacteria 805
146 Ga0495684_0370585 3300047471 Bacteria 1012
147 Ga0495593_0092050 3300047673 Bacteria 1561
148 Ga0495602_0000010 3300048088 Bacteria 212121
149 Ga0496100_0000008 3300048903 Bacteria 231974
150 Ga0496101_0000016 3300048904 Bacteria 240753
151 Ga0496104_0229066 3300048907 Bacteria 1770
152 Ga0496106_0000086 3300048909 Bacteria 73933
153 Ga0496107_0000009 3300048910 Bacteria 231682
154 Ga0496108_0000024 3300048911 Bacteria 183389
155 Ga0496109_0000035 3300048912 Bacteria 159744
156 Ga0496109_0001038 3300048912 Bacteria 22983
157 Ga0496109_0848617 3300048912 Unclassified 851
158 Ga0496110_0000128 3300048913 Bacteria 43226
159 Ga0496110_0536559 3300048913 Bacteria 1064
160 Ga0496111_0000022 3300048914 Bacteria 66777
161 Ga0496111_1075423 3300048914 Bacteria 574
162 Ga0496112_0004601 3300048915 Bacteria 11737
163 Ga0496113_0000093 3300048916 Bacteria 38914
164 Ga0496113_0237829 3300048916 Bacteria 1453
165 Ga0496113_0978594 3300048916 Bacteria 667
166 Ga0496114_0000010 3300048917 Bacteria 363396
167 Ga0496115_0000363 3300048918 Bacteria 37766
168 Ga0501070_0440482 3300049586 Bacteria 1051
169 nmdc:mga0qj67_381264_c1 3300050509 Bacteria 1139
170 Ga0495601_0000012 3300053077 Bacteria 227853
171 Ga0495601_0162373 3300053077 Bacteria 1460
172 Ga0495655_0000003 3300053083 Bacteria 303053
173 Ga0495655_0001036 3300053083 Bacteria 4291
174 Ga0495595_0000001 3300053084 Bacteria 495226
175 Ga0495595_0006411 3300053084 Bacteria 4798
176 Ga0495619_0000018 3300053085 Bacteria 209943
177 Ga0495619_0000120 3300053085 Bacteria 58265
178 Ga0495619_0000428 3300053085 Bacteria 28554
179 Ga0500628_000002 3300053129 Bacteria 357687

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047469 Ga0495673_0178675 Ga0495673_0178675_298_777 135
2 3300005614 Ga0068856_100000057 Ga0068856_10000005735 136
3 3300026078 Ga0207702_10000027 Ga0207702_10000027112 136
4 3300046473 Ga0495582_0000012 Ga0495582_0000012_3349_3831 136
5 3300046683 Ga0495658_0000008 Ga0495658_0000008_87118_87600 136
6 3300014968 Ga0157379_10080216 Ga0157379_100802163 138
7 3300005365 Ga0070688_100009361 Ga0070688_1000093612 143
8 3300005459 Ga0068867_100000247 Ga0068867_10000024728 143
9 3300005466 Ga0070685_10000203 Ga0070685_1000020339 143
10 3300026089 Ga0207648_10000230 Ga0207648_1000023034 143
11 3300009098 Ga0105245_10000159 Ga0105245_1000015926 145
12 3300025927 Ga0207687_10000011 Ga0207687_10000011367 145
13 3300013105 Ga0157369_10000118 Ga0157369_1000011811 147
14 3300048911 Ga0496108_0000024 Ga0496108_0000024_3549_4028 148
15 3300048912 Ga0496109_0001038 Ga0496109_0001038_3512_3991 148
16 3300013104 Ga0157370_10246042 Ga0157370_102460422 149
17 3300046678 Ga0495599_0073047 Ga0495599_0073047_983_1462 149
18 3300020070 Ga0206356_10857105 Ga0206356_108571053 152
19 3300048912 Ga0496109_0848617 Ga0496109_0848617_137_616 152
20 3300006881 Ga0068865_100000020 Ga0068865_10000002038 153
21 3300025938 Ga0207704_10000004 Ga0207704_10000004154 153
22 3300045976 Ga0466967_0000008 Ga0466967_0000008_86583_87062 153
23 3300046476 Ga0495662_0001149 Ga0495662_0001149_113_592 153
24 3300046536 Ga0495587_0058496 Ga0495587_0058496_1371_1850 153
25 3300053085 Ga0495619_0000428 Ga0495619_0000428_18998_19480 153
26 3300026075 Ga0207708_11063324 Ga0207708_110633242 154
27 3300005615 Ga0070702_100071820 Ga0070702_1000718202 158
28 3300041496 Ga0451839_0614650 Ga0451839_0614650_34_510 158
29 3300049586 Ga0501070_0440482 Ga0501070_0440482_179_655 158
30 3300003659 JGI25404J52841_10001539 JGI25404J52841_100015392 159
31 3300005327 Ga0070658_11080561 Ga0070658_110805612 159
32 3300005329 Ga0070683_100002810 Ga0070683_10000281015 159
33 3300005329 Ga0070683_100018205 Ga0070683_1000182055 159
34 3300005329 Ga0070683_100545486 Ga0070683_1005454862 159
35 3300005331 Ga0070670_100044871 Ga0070670_1000448713 159
36 3300005335 Ga0070666_10007866 Ga0070666_100078662 159
37 3300005337 Ga0070682_100000216 Ga0070682_1000002169 159
38 3300005338 Ga0068868_100004377 Ga0068868_1000043779 159
39 3300005339 Ga0070660_100196663 Ga0070660_1001966631 159
40 3300005340 Ga0070689_100111216 Ga0070689_1001112163 159
41 3300005341 Ga0070691_10000024 Ga0070691_1000002432 159
42 3300005344 Ga0070661_100000161 Ga0070661_10000016125 159
43 3300005345 Ga0070692_10043241 Ga0070692_100432412 159
44 3300005347 Ga0070668_100192332 Ga0070668_1001923322 159
45 3300005354 Ga0070675_100000153 Ga0070675_10000015338 159
46 3300005365 Ga0070688_100000853 Ga0070688_10000085315 159
47 3300005365 Ga0070688_100178329 Ga0070688_1001783292 159
48 3300005366 Ga0070659_100091253 Ga0070659_1000912533 159
49 3300005367 Ga0070667_100274065 Ga0070667_1002740652 159
50 3300005435 Ga0070714_100595866 Ga0070714_1005958662 159
51 3300005436 Ga0070713_100000076 Ga0070713_10000007620 159
52 3300005436 Ga0070713_100032741 Ga0070713_1000327414 159
53 3300005439 Ga0070711_100480974 Ga0070711_1004809742 159
54 3300005466 Ga0070685_10001711 Ga0070685_1000171112 159
55 3300005466 Ga0070685_10129068 Ga0070685_101290681 159
56 3300005535 Ga0070684_100005535 Ga0070684_10000553510 159
57 3300005535 Ga0070684_100010577 Ga0070684_1000105775 159
58 3300005535 Ga0070684_100142899 Ga0070684_1001428992 159
59 3300005539 Ga0068853_100204049 Ga0068853_1002040492 159
60 3300005539 Ga0068853_100336001 Ga0068853_1003360012 159
61 3300005543 Ga0070672_100000262 Ga0070672_10000026212 159
62 3300005545 Ga0070695_100161958 Ga0070695_1001619582 159
63 3300005548 Ga0070665_100093706 Ga0070665_1000937062 159
64 3300005548 Ga0070665_101164519 Ga0070665_1011645191 159
65 3300005549 Ga0070704_100157998 Ga0070704_1001579981 159
66 3300005578 Ga0068854_100000115 Ga0068854_10000011531 159
67 3300005616 Ga0068852_100000058 Ga0068852_10000005848 159
68 3300005834 Ga0068851_10000580 Ga0068851_1000058018 159
69 3300005834 Ga0068851_10007843 Ga0068851_100078435 159
70 3300005983 Ga0081540_1003244 Ga0081540_100324412 159
71 3300005983 Ga0081540_1091287 Ga0081540_10912872 159
72 3300005985 Ga0081539_10000872 Ga0081539_1000087249 159
73 3300006175 Ga0070712_100026728 Ga0070712_1000267283 159
74 3300006237 Ga0097621_100739232 Ga0097621_1007392322 159
75 3300006846 Ga0075430_100009221 Ga0075430_1000092213 159
76 3300009098 Ga0105245_10093658 Ga0105245_100936583 159
77 3300009101 Ga0105247_10129902 Ga0105247_101299023 159
78 3300009148 Ga0105243_10012796 Ga0105243_100127963 159
79 3300009174 Ga0105241_10049074 Ga0105241_100490743 159
80 3300009177 Ga0105248_10000022 Ga0105248_10000022267 159
81 3300010375 Ga0105239_10216660 Ga0105239_102166602 159
82 3300013102 Ga0157371_10035029 Ga0157371_100350292 159
83 3300013104 Ga0157370_10044157 Ga0157370_100441573 159
84 3300013297 Ga0157378_10002688 Ga0157378_100026883 159
85 3300013307 Ga0157372_10082536 Ga0157372_100825363 159
86 3300013308 Ga0157375_10715361 Ga0157375_107153612 159
87 3300014326 Ga0157380_10000024 Ga0157380_1000002444 159
88 3300014326 Ga0157380_11099548 Ga0157380_110995482 159
89 3300014969 Ga0157376_11512085 Ga0157376_115120852 159
90 3300020082 Ga0206353_10641775 Ga0206353_106417751 159
91 3300025321 Ga0207656_10000299 Ga0207656_1000029918 159
92 3300025321 Ga0207656_10008492 Ga0207656_100084922 159
93 3300025900 Ga0207710_10131939 Ga0207710_101319392 159
94 3300025903 Ga0207680_10055757 Ga0207680_100557571 159
95 3300025905 Ga0207685_10042691 Ga0207685_100426912 159
96 3300025911 Ga0207654_10057673 Ga0207654_100576733 159
97 3300025915 Ga0207693_10119837 Ga0207693_101198372 159
98 3300025918 Ga0207662_10959353 Ga0207662_109593531 159
99 3300025919 Ga0207657_10178558 Ga0207657_101785582 159
100 3300025920 Ga0207649_10000024 Ga0207649_1000002439 159
101 3300025925 Ga0207650_10064421 Ga0207650_100644214 159
102 3300025926 Ga0207659_10000043 Ga0207659_1000004341 159
103 3300025927 Ga0207687_10014582 Ga0207687_100145822 159
104 3300025928 Ga0207700_10000009 Ga0207700_10000009203 159
105 3300025928 Ga0207700_10051227 Ga0207700_100512272 159
106 3300025929 Ga0207664_10862723 Ga0207664_108627232 159
107 3300025932 Ga0207690_10005498 Ga0207690_100054983 159
108 3300025935 Ga0207709_10016508 Ga0207709_100165083 159
109 3300025936 Ga0207670_10152264 Ga0207670_101522642 159
110 3300025940 Ga0207691_10000374 Ga0207691_1000037422 159
111 3300025941 Ga0207711_10000019 Ga0207711_1000001971 159
112 3300025944 Ga0207661_10000142 Ga0207661_1000014222 159
113 3300025944 Ga0207661_10000212 Ga0207661_1000021223 159
114 3300025944 Ga0207661_10494420 Ga0207661_104944202 159
115 3300025945 Ga0207679_10069092 Ga0207679_100690921 159
116 3300025972 Ga0207668_10178777 Ga0207668_101787772 159
117 3300025981 Ga0207640_10000059 Ga0207640_1000005959 159
118 3300025986 Ga0207658_10284746 Ga0207658_102847462 159
119 3300026023 Ga0207677_10002718 Ga0207677_100027184 159
120 3300026041 Ga0207639_10172511 Ga0207639_101725112 159
121 3300026041 Ga0207639_10574835 Ga0207639_105748352 159
122 3300026078 Ga0207702_10019923 Ga0207702_100199232 159
123 3300026121 Ga0207683_10057651 Ga0207683_100576512 159
124 3300026142 Ga0207698_10000002 Ga0207698_10000002188 159
125 3300028379 Ga0268266_10000809 Ga0268266_1000080913 159
126 3300028379 Ga0268266_10104765 Ga0268266_101047653 159
127 3300028379 Ga0268266_10187488 Ga0268266_101874882 159
128 3300032126 Ga0307415_100028959 Ga0307415_1000289593 159
129 3300036401 Ga0373937_0773991 Ga0373937_0773991_228_707 159
130 3300041512 Ga0451853_2508159 Ga0451853_2508159_291_770 159
131 3300044694 Ga0466963_0014584 Ga0466963_0014584_3368_3847 159
132 3300044842 Ga0466957_0000145 Ga0466957_0000145_17108_17587 159
133 3300044842 Ga0466957_0128477 Ga0466957_0128477_160_639 159
134 3300045836 Ga0466958_0027248 Ga0466958_0027248_519_998 159
135 3300046492 Ga0495585_0317147 Ga0495585_0317147_195_674 159
136 3300046511 Ga0495608_0000001 Ga0495608_0000001_221620_222099 159
137 3300046512 Ga0495610_0053349 Ga0495610_0053349_907_1386 159
138 3300046520 Ga0495637_0251252 Ga0495637_0251252_104_583 159
139 3300046529 Ga0495652_0000086 Ga0495652_0000086_49358_49837 159
140 3300046674 Ga0495588_0000240 Ga0495588_0000240_33335_33814 159
141 3300046675 Ga0495657_0000002 Ga0495657_0000002_222300_222779 159
142 3300046683 Ga0495658_0005991 Ga0495658_0005991_1248_1727 159
143 3300046689 Ga0495613_0000298 Ga0495613_0000298_28788_29267 159
144 3300046689 Ga0495613_0434528 Ga0495613_0434528_34_513 159
145 3300046809 Ga0495600_0026058 Ga0495600_0026058_988_1467 159
146 3300047317 Ga0495604_0000850 Ga0495604_0000850_3591_4070 159
147 3300047317 Ga0495604_0168338 Ga0495604_0168338_719_1198 159
148 3300047319 Ga0495674_0000007 Ga0495674_0000007_126421_126900 159
149 3300047321 Ga0495676_0028748 Ga0495676_0028748_3603_4082 159
150 3300047444 Ga0495675_0000046 Ga0495675_0000046_20549_21028 159
151 3300047471 Ga0495684_0370585 Ga0495684_0370585_508_987 159
152 3300047673 Ga0495593_0092050 Ga0495593_0092050_353_832 159
153 3300048088 Ga0495602_0000010 Ga0495602_0000010_171839_172318 159
154 3300048903 Ga0496100_0000008 Ga0496100_0000008_3859_4338 159
155 3300048904 Ga0496101_0000016 Ga0496101_0000016_12641_13120 159
156 3300048907 Ga0496104_0229066 Ga0496104_0229066_1146_1625 159
157 3300048909 Ga0496106_0000086 Ga0496106_0000086_69824_70303 159
158 3300048910 Ga0496107_0000009 Ga0496107_0000009_3573_4052 159
159 3300048912 Ga0496109_0000035 Ga0496109_0000035_140666_141145 159
160 3300048913 Ga0496110_0000128 Ga0496110_0000128_39276_39755 159
161 3300048913 Ga0496110_0536559 Ga0496110_0536559_416_895 159
162 3300048914 Ga0496111_0000022 Ga0496111_0000022_25697_26176 159
163 3300048914 Ga0496111_1075423 Ga0496111_1075423_61_540 159
164 3300048915 Ga0496112_0004601 Ga0496112_0004601_10796_11275 159
165 3300048916 Ga0496113_0000093 Ga0496113_0000093_37274_37753 159
166 3300048916 Ga0496113_0237829 Ga0496113_0237829_253_732 159
167 3300048916 Ga0496113_0978594 Ga0496113_0978594_115_594 159
168 3300048917 Ga0496114_0000010 Ga0496114_0000010_257397_257876 159
169 3300048918 Ga0496115_0000363 Ga0496115_0000363_12712_13191 159
170 3300050509 nmdc:mga0qj67_381264_c1 nmdc:mga0qj67_381264_c1_179_661 159
171 3300053077 Ga0495601_0000012 Ga0495601_0000012_169977_170456 159
172 3300053077 Ga0495601_0162373 Ga0495601_0162373_240_719 159
173 3300053083 Ga0495655_0000003 Ga0495655_0000003_180096_180575 159
174 3300053083 Ga0495655_0001036 Ga0495655_0001036_3166_3645 159
175 3300053084 Ga0495595_0000001 Ga0495595_0000001_189180_189659 159
176 3300053084 Ga0495595_0006411 Ga0495595_0006411_724_1203 159
177 3300053085 Ga0495619_0000018 Ga0495619_0000018_165770_166249 159
178 3300053085 Ga0495619_0000120 Ga0495619_0000120_37250_37729 159
179 3300053129 Ga0500628_000002 Ga0500628_000002_180096_180575 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

50

141

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.9341 85 147
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.9127 87 147
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8927 85 147
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.8723 87 147
7ytj-assembly1.cif.gz_A cryo-em structure of vtc complex 0.8541 28 82
ID Description Score Start End Superfamily
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9464 91 147 2.40.50.140
af_Q4DA65_43_292_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.938 24 69 1.25.40.10
3wwvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9341 85 147 2.40.50.140
af_Q2FXZ8_166_227_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9301 86 147 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8963 87 147 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3D4NEX6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9717 91 147
AF-U1FFM5-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9668 94 148
AF-A0A3D4NEX6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9555 91 147
AF-A0A845X4Q4-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9296 90 150
AF-A0A7G1IET6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9214 87 147

Feature Viewer

pLDDT pTM Quality
88.18 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map