F274614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 139 | 179 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_0000428|Ga0495619_0000428_18998_19480 |
| Length | 154 |
| Sequence | MEAALLVALIAIALLAGELLLSTGGVLAAIGAIGLMLSSDSGAADVVGPALIALGLLSIVGFWFVTRKVIEAHRAEPVRTGTEELLGSIAEVRSTLDPEGQVWAGGTVWGARLGAGGDGPVRLGDRVRIEAIDGLTLVVRPEPHPADGAEEGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 91 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 93 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 94 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 124 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 128 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 131 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 10.61 |
| Rhizosphere | 87.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10001539 | 3300003659 | Bacteria | 4090 |
| 2 | Ga0070658_11080561 | 3300005327 | Bacteria | 698 |
| 3 | Ga0070683_100002810 | 3300005329 | Bacteria | 13924 |
| 4 | Ga0070683_100018205 | 3300005329 | Bacteria | 6218 |
| 5 | Ga0070683_100545486 | 3300005329 | Bacteria | 1109 |
| 6 | Ga0070670_100044871 | 3300005331 | Bacteria | 3800 |
| 7 | Ga0070666_10007866 | 3300005335 | Bacteria | 6584 |
| 8 | Ga0070682_100000216 | 3300005337 | Bacteria | 42444 |
| 9 | Ga0068868_100004377 | 3300005338 | Bacteria | 9901 |
| 10 | Ga0070660_100196663 | 3300005339 | Bacteria | 1635 |
| 11 | Ga0070689_100111216 | 3300005340 | Bacteria | 2179 |
| 12 | Ga0070691_10000024 | 3300005341 | Bacteria | 41375 |
| 13 | Ga0070661_100000161 | 3300005344 | Bacteria | 55183 |
| 14 | Ga0070692_10043241 | 3300005345 | Bacteria | 2316 |
| 15 | Ga0070668_100192332 | 3300005347 | Bacteria | 1671 |
| 16 | Ga0070675_100000153 | 3300005354 | Bacteria | 41558 |
| 17 | Ga0070688_100000853 | 3300005365 | Bacteria | 15130 |
| 18 | Ga0070688_100009361 | 3300005365 | Bacteria | 5354 |
| 19 | Ga0070688_100178329 | 3300005365 | Bacteria | 1472 |
| 20 | Ga0070659_100091253 | 3300005366 | Bacteria | 2442 |
| 21 | Ga0070667_100274065 | 3300005367 | Bacteria | 1513 |
| 22 | Ga0070714_100595866 | 3300005435 | Bacteria | 1061 |
| 23 | Ga0070713_100000076 | 3300005436 | Bacteria | 61668 |
| 24 | Ga0070713_100032741 | 3300005436 | Bacteria | 4156 |
| 25 | Ga0070711_100480974 | 3300005439 | Bacteria | 1021 |
| 26 | Ga0068867_100000247 | 3300005459 | Bacteria | 35692 |
| 27 | Ga0070685_10000203 | 3300005466 | Bacteria | 39835 |
| 28 | Ga0070685_10001711 | 3300005466 | Bacteria | 11510 |
| 29 | Ga0070685_10129068 | 3300005466 | Bacteria | 1579 |
| 30 | Ga0070684_100005535 | 3300005535 | Bacteria | 9692 |
| 31 | Ga0070684_100010577 | 3300005535 | Bacteria | 7315 |
| 32 | Ga0070684_100142899 | 3300005535 | Bacteria | 2165 |
| 33 | Ga0068853_100204049 | 3300005539 | Bacteria | 1800 |
| 34 | Ga0068853_100336001 | 3300005539 | Bacteria | 1403 |
| 35 | Ga0070672_100000262 | 3300005543 | Bacteria | 29769 |
| 36 | Ga0070695_100161958 | 3300005545 | Bacteria | 1571 |
| 37 | Ga0070665_100093706 | 3300005548 | Bacteria | 3008 |
| 38 | Ga0070665_101164519 | 3300005548 | Bacteria | 782 |
| 39 | Ga0070704_100157998 | 3300005549 | Bacteria | 1790 |
| 40 | Ga0068854_100000115 | 3300005578 | Bacteria | 55089 |
| 41 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 42 | Ga0070702_100071820 | 3300005615 | Bacteria | 2047 |
| 43 | Ga0068852_100000058 | 3300005616 | Bacteria | 75312 |
| 44 | Ga0068851_10000580 | 3300005834 | Bacteria | 15927 |
| 45 | Ga0068851_10007843 | 3300005834 | Bacteria | 4917 |
| 46 | Ga0081540_1003244 | 3300005983 | Bacteria | 12942 |
| 47 | Ga0081540_1091287 | 3300005983 | Bacteria | 1339 |
| 48 | Ga0081539_10000872 | 3300005985 | Bacteria | 57857 |
| 49 | Ga0070712_100026728 | 3300006175 | Bacteria | 3848 |
| 50 | Ga0097621_100739232 | 3300006237 | Bacteria | 908 |
| 51 | Ga0075430_100009221 | 3300006846 | Bacteria | 8341 |
| 52 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 53 | Ga0105245_10000159 | 3300009098 | Bacteria | 63630 |
| 54 | Ga0105245_10093658 | 3300009098 | Bacteria | 2768 |
| 55 | Ga0105247_10129902 | 3300009101 | Bacteria | 1641 |
| 56 | Ga0105243_10012796 | 3300009148 | Bacteria | 6338 |
| 57 | Ga0105241_10049074 | 3300009174 | Bacteria | 3214 |
| 58 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 59 | Ga0105239_10216660 | 3300010375 | Bacteria | 2147 |
| 60 | Ga0157371_10035029 | 3300013102 | Bacteria | 3599 |
| 61 | Ga0157370_10044157 | 3300013104 | Bacteria | 4286 |
| 62 | Ga0157370_10246042 | 3300013104 | Bacteria | 1654 |
| 63 | Ga0157369_10000118 | 3300013105 | Bacteria | 111618 |
| 64 | Ga0157378_10002688 | 3300013297 | Bacteria | 15824 |
| 65 | Ga0157372_10082536 | 3300013307 | Bacteria | 3639 |
| 66 | Ga0157375_10715361 | 3300013308 | Bacteria | 1154 |
| 67 | Ga0157380_10000024 | 3300014326 | Bacteria | 110947 |
| 68 | Ga0157380_11099548 | 3300014326 | Bacteria | 834 |
| 69 | Ga0157379_10080216 | 3300014968 | Bacteria | 2923 |
| 70 | Ga0157376_11512085 | 3300014969 | Bacteria | 704 |
| 71 | Ga0206356_10857105 | 3300020070 | Bacteria | 2380 |
| 72 | Ga0206353_10641775 | 3300020082 | Bacteria | 753 |
| 73 | Ga0207656_10000299 | 3300025321 | Bacteria | 17123 |
| 74 | Ga0207656_10008492 | 3300025321 | Bacteria | 3783 |
| 75 | Ga0207710_10131939 | 3300025900 | Bacteria | 1200 |
| 76 | Ga0207680_10055757 | 3300025903 | Bacteria | 2383 |
| 77 | Ga0207685_10042691 | 3300025905 | Bacteria | 1704 |
| 78 | Ga0207654_10057673 | 3300025911 | Bacteria | 2257 |
| 79 | Ga0207693_10119837 | 3300025915 | Bacteria | 2066 |
| 80 | Ga0207662_10959353 | 3300025918 | Bacteria | 606 |
| 81 | Ga0207657_10178558 | 3300025919 | Bacteria | 1717 |
| 82 | Ga0207649_10000024 | 3300025920 | Bacteria | 183104 |
| 83 | Ga0207650_10064421 | 3300025925 | Bacteria | 2744 |
| 84 | Ga0207659_10000043 | 3300025926 | Bacteria | 90795 |
| 85 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 86 | Ga0207687_10014582 | 3300025927 | Bacteria | 5144 |
| 87 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 88 | Ga0207700_10051227 | 3300025928 | Bacteria | 3080 |
| 89 | Ga0207664_10862723 | 3300025929 | Bacteria | 814 |
| 90 | Ga0207690_10005498 | 3300025932 | Bacteria | 7474 |
| 91 | Ga0207709_10016508 | 3300025935 | Bacteria | 4105 |
| 92 | Ga0207670_10152264 | 3300025936 | Bacteria | 1717 |
| 93 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 94 | Ga0207691_10000374 | 3300025940 | Bacteria | 45009 |
| 95 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 96 | Ga0207661_10000142 | 3300025944 | Bacteria | 45456 |
| 97 | Ga0207661_10000212 | 3300025944 | Bacteria | 37559 |
| 98 | Ga0207661_10494420 | 3300025944 | Bacteria | 1117 |
| 99 | Ga0207679_10069092 | 3300025945 | Bacteria | 2657 |
| 100 | Ga0207668_10178777 | 3300025972 | Bacteria | 1671 |
| 101 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 102 | Ga0207658_10284746 | 3300025986 | Bacteria | 1418 |
| 103 | Ga0207677_10002718 | 3300026023 | Bacteria | 9326 |
| 104 | Ga0207639_10172511 | 3300026041 | Bacteria | 1833 |
| 105 | Ga0207639_10574835 | 3300026041 | Bacteria | 1037 |
| 106 | Ga0207708_11063324 | 3300026075 | Bacteria | 705 |
| 107 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 108 | Ga0207702_10019923 | 3300026078 | Bacteria | 5558 |
| 109 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 110 | Ga0207683_10057651 | 3300026121 | Bacteria | 3409 |
| 111 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 112 | Ga0268266_10000809 | 3300028379 | Bacteria | 41366 |
| 113 | Ga0268266_10104765 | 3300028379 | Bacteria | 2498 |
| 114 | Ga0268266_10187488 | 3300028379 | Bacteria | 1887 |
| 115 | Ga0307415_100028959 | 3300032126 | Bacteria | 3532 |
| 116 | Ga0373937_0773991 | 3300036401 | Bacteria | 907 |
| 117 | Ga0451839_0614650 | 3300041496 | Bacteria | 724 |
| 118 | Ga0451853_2508159 | 3300041512 | Bacteria | 877 |
| 119 | Ga0466963_0014584 | 3300044694 | Bacteria | 4850 |
| 120 | Ga0466957_0000145 | 3300044842 | Bacteria | 30469 |
| 121 | Ga0466957_0128477 | 3300044842 | Unclassified | 1621 |
| 122 | Ga0466958_0027248 | 3300045836 | Bacteria | 3382 |
| 123 | Ga0466967_0000008 | 3300045976 | Bacteria | 127135 |
| 124 | Ga0495582_0000012 | 3300046473 | Bacteria | 112893 |
| 125 | Ga0495662_0001149 | 3300046476 | Bacteria | 13032 |
| 126 | Ga0495585_0317147 | 3300046492 | Unclassified | 763 |
| 127 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 128 | Ga0495610_0053349 | 3300046512 | Bacteria | 1959 |
| 129 | Ga0495637_0251252 | 3300046520 | Bacteria | 636 |
| 130 | Ga0495652_0000086 | 3300046529 | Bacteria | 99373 |
| 131 | Ga0495587_0058496 | 3300046536 | Bacteria | 2264 |
| 132 | Ga0495588_0000240 | 3300046674 | Bacteria | 46975 |
| 133 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 134 | Ga0495599_0073047 | 3300046678 | Bacteria | 2141 |
| 135 | Ga0495658_0000008 | 3300046683 | Bacteria | 115426 |
| 136 | Ga0495658_0005991 | 3300046683 | Bacteria | 5969 |
| 137 | Ga0495613_0000298 | 3300046689 | Bacteria | 44864 |
| 138 | Ga0495613_0434528 | 3300046689 | Bacteria | 891 |
| 139 | Ga0495600_0026058 | 3300046809 | Bacteria | 3771 |
| 140 | Ga0495604_0000850 | 3300047317 | Bacteria | 25489 |
| 141 | Ga0495604_0168338 | 3300047317 | Bacteria | 1543 |
| 142 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 143 | Ga0495676_0028748 | 3300047321 | Bacteria | 4743 |
| 144 | Ga0495675_0000046 | 3300047444 | Bacteria | 82596 |
| 145 | Ga0495673_0178675 | 3300047469 | Bacteria | 805 |
| 146 | Ga0495684_0370585 | 3300047471 | Bacteria | 1012 |
| 147 | Ga0495593_0092050 | 3300047673 | Bacteria | 1561 |
| 148 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 149 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 150 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 151 | Ga0496104_0229066 | 3300048907 | Bacteria | 1770 |
| 152 | Ga0496106_0000086 | 3300048909 | Bacteria | 73933 |
| 153 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 154 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 155 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 156 | Ga0496109_0001038 | 3300048912 | Bacteria | 22983 |
| 157 | Ga0496109_0848617 | 3300048912 | Unclassified | 851 |
| 158 | Ga0496110_0000128 | 3300048913 | Bacteria | 43226 |
| 159 | Ga0496110_0536559 | 3300048913 | Bacteria | 1064 |
| 160 | Ga0496111_0000022 | 3300048914 | Bacteria | 66777 |
| 161 | Ga0496111_1075423 | 3300048914 | Bacteria | 574 |
| 162 | Ga0496112_0004601 | 3300048915 | Bacteria | 11737 |
| 163 | Ga0496113_0000093 | 3300048916 | Bacteria | 38914 |
| 164 | Ga0496113_0237829 | 3300048916 | Bacteria | 1453 |
| 165 | Ga0496113_0978594 | 3300048916 | Bacteria | 667 |
| 166 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 167 | Ga0496115_0000363 | 3300048918 | Bacteria | 37766 |
| 168 | Ga0501070_0440482 | 3300049586 | Bacteria | 1051 |
| 169 | nmdc:mga0qj67_381264_c1 | 3300050509 | Bacteria | 1139 |
| 170 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 171 | Ga0495601_0162373 | 3300053077 | Bacteria | 1460 |
| 172 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 173 | Ga0495655_0001036 | 3300053083 | Bacteria | 4291 |
| 174 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 175 | Ga0495595_0006411 | 3300053084 | Bacteria | 4798 |
| 176 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 177 | Ga0495619_0000120 | 3300053085 | Bacteria | 58265 |
| 178 | Ga0495619_0000428 | 3300053085 | Bacteria | 28554 |
| 179 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047469 | Ga0495673_0178675 | Ga0495673_0178675_298_777 | 135 |
| 2 | 3300005614 | Ga0068856_100000057 | Ga0068856_10000005735 | 136 |
| 3 | 3300026078 | Ga0207702_10000027 | Ga0207702_10000027112 | 136 |
| 4 | 3300046473 | Ga0495582_0000012 | Ga0495582_0000012_3349_3831 | 136 |
| 5 | 3300046683 | Ga0495658_0000008 | Ga0495658_0000008_87118_87600 | 136 |
| 6 | 3300014968 | Ga0157379_10080216 | Ga0157379_100802163 | 138 |
| 7 | 3300005365 | Ga0070688_100009361 | Ga0070688_1000093612 | 143 |
| 8 | 3300005459 | Ga0068867_100000247 | Ga0068867_10000024728 | 143 |
| 9 | 3300005466 | Ga0070685_10000203 | Ga0070685_1000020339 | 143 |
| 10 | 3300026089 | Ga0207648_10000230 | Ga0207648_1000023034 | 143 |
| 11 | 3300009098 | Ga0105245_10000159 | Ga0105245_1000015926 | 145 |
| 12 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011367 | 145 |
| 13 | 3300013105 | Ga0157369_10000118 | Ga0157369_1000011811 | 147 |
| 14 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_3549_4028 | 148 |
| 15 | 3300048912 | Ga0496109_0001038 | Ga0496109_0001038_3512_3991 | 148 |
| 16 | 3300013104 | Ga0157370_10246042 | Ga0157370_102460422 | 149 |
| 17 | 3300046678 | Ga0495599_0073047 | Ga0495599_0073047_983_1462 | 149 |
| 18 | 3300020070 | Ga0206356_10857105 | Ga0206356_108571053 | 152 |
| 19 | 3300048912 | Ga0496109_0848617 | Ga0496109_0848617_137_616 | 152 |
| 20 | 3300006881 | Ga0068865_100000020 | Ga0068865_10000002038 | 153 |
| 21 | 3300025938 | Ga0207704_10000004 | Ga0207704_10000004154 | 153 |
| 22 | 3300045976 | Ga0466967_0000008 | Ga0466967_0000008_86583_87062 | 153 |
| 23 | 3300046476 | Ga0495662_0001149 | Ga0495662_0001149_113_592 | 153 |
| 24 | 3300046536 | Ga0495587_0058496 | Ga0495587_0058496_1371_1850 | 153 |
| 25 | 3300053085 | Ga0495619_0000428 | Ga0495619_0000428_18998_19480 | 153 |
| 26 | 3300026075 | Ga0207708_11063324 | Ga0207708_110633242 | 154 |
| 27 | 3300005615 | Ga0070702_100071820 | Ga0070702_1000718202 | 158 |
| 28 | 3300041496 | Ga0451839_0614650 | Ga0451839_0614650_34_510 | 158 |
| 29 | 3300049586 | Ga0501070_0440482 | Ga0501070_0440482_179_655 | 158 |
| 30 | 3300003659 | JGI25404J52841_10001539 | JGI25404J52841_100015392 | 159 |
| 31 | 3300005327 | Ga0070658_11080561 | Ga0070658_110805612 | 159 |
| 32 | 3300005329 | Ga0070683_100002810 | Ga0070683_10000281015 | 159 |
| 33 | 3300005329 | Ga0070683_100018205 | Ga0070683_1000182055 | 159 |
| 34 | 3300005329 | Ga0070683_100545486 | Ga0070683_1005454862 | 159 |
| 35 | 3300005331 | Ga0070670_100044871 | Ga0070670_1000448713 | 159 |
| 36 | 3300005335 | Ga0070666_10007866 | Ga0070666_100078662 | 159 |
| 37 | 3300005337 | Ga0070682_100000216 | Ga0070682_1000002169 | 159 |
| 38 | 3300005338 | Ga0068868_100004377 | Ga0068868_1000043779 | 159 |
| 39 | 3300005339 | Ga0070660_100196663 | Ga0070660_1001966631 | 159 |
| 40 | 3300005340 | Ga0070689_100111216 | Ga0070689_1001112163 | 159 |
| 41 | 3300005341 | Ga0070691_10000024 | Ga0070691_1000002432 | 159 |
| 42 | 3300005344 | Ga0070661_100000161 | Ga0070661_10000016125 | 159 |
| 43 | 3300005345 | Ga0070692_10043241 | Ga0070692_100432412 | 159 |
| 44 | 3300005347 | Ga0070668_100192332 | Ga0070668_1001923322 | 159 |
| 45 | 3300005354 | Ga0070675_100000153 | Ga0070675_10000015338 | 159 |
| 46 | 3300005365 | Ga0070688_100000853 | Ga0070688_10000085315 | 159 |
| 47 | 3300005365 | Ga0070688_100178329 | Ga0070688_1001783292 | 159 |
| 48 | 3300005366 | Ga0070659_100091253 | Ga0070659_1000912533 | 159 |
| 49 | 3300005367 | Ga0070667_100274065 | Ga0070667_1002740652 | 159 |
| 50 | 3300005435 | Ga0070714_100595866 | Ga0070714_1005958662 | 159 |
| 51 | 3300005436 | Ga0070713_100000076 | Ga0070713_10000007620 | 159 |
| 52 | 3300005436 | Ga0070713_100032741 | Ga0070713_1000327414 | 159 |
| 53 | 3300005439 | Ga0070711_100480974 | Ga0070711_1004809742 | 159 |
| 54 | 3300005466 | Ga0070685_10001711 | Ga0070685_1000171112 | 159 |
| 55 | 3300005466 | Ga0070685_10129068 | Ga0070685_101290681 | 159 |
| 56 | 3300005535 | Ga0070684_100005535 | Ga0070684_10000553510 | 159 |
| 57 | 3300005535 | Ga0070684_100010577 | Ga0070684_1000105775 | 159 |
| 58 | 3300005535 | Ga0070684_100142899 | Ga0070684_1001428992 | 159 |
| 59 | 3300005539 | Ga0068853_100204049 | Ga0068853_1002040492 | 159 |
| 60 | 3300005539 | Ga0068853_100336001 | Ga0068853_1003360012 | 159 |
| 61 | 3300005543 | Ga0070672_100000262 | Ga0070672_10000026212 | 159 |
| 62 | 3300005545 | Ga0070695_100161958 | Ga0070695_1001619582 | 159 |
| 63 | 3300005548 | Ga0070665_100093706 | Ga0070665_1000937062 | 159 |
| 64 | 3300005548 | Ga0070665_101164519 | Ga0070665_1011645191 | 159 |
| 65 | 3300005549 | Ga0070704_100157998 | Ga0070704_1001579981 | 159 |
| 66 | 3300005578 | Ga0068854_100000115 | Ga0068854_10000011531 | 159 |
| 67 | 3300005616 | Ga0068852_100000058 | Ga0068852_10000005848 | 159 |
| 68 | 3300005834 | Ga0068851_10000580 | Ga0068851_1000058018 | 159 |
| 69 | 3300005834 | Ga0068851_10007843 | Ga0068851_100078435 | 159 |
| 70 | 3300005983 | Ga0081540_1003244 | Ga0081540_100324412 | 159 |
| 71 | 3300005983 | Ga0081540_1091287 | Ga0081540_10912872 | 159 |
| 72 | 3300005985 | Ga0081539_10000872 | Ga0081539_1000087249 | 159 |
| 73 | 3300006175 | Ga0070712_100026728 | Ga0070712_1000267283 | 159 |
| 74 | 3300006237 | Ga0097621_100739232 | Ga0097621_1007392322 | 159 |
| 75 | 3300006846 | Ga0075430_100009221 | Ga0075430_1000092213 | 159 |
| 76 | 3300009098 | Ga0105245_10093658 | Ga0105245_100936583 | 159 |
| 77 | 3300009101 | Ga0105247_10129902 | Ga0105247_101299023 | 159 |
| 78 | 3300009148 | Ga0105243_10012796 | Ga0105243_100127963 | 159 |
| 79 | 3300009174 | Ga0105241_10049074 | Ga0105241_100490743 | 159 |
| 80 | 3300009177 | Ga0105248_10000022 | Ga0105248_10000022267 | 159 |
| 81 | 3300010375 | Ga0105239_10216660 | Ga0105239_102166602 | 159 |
| 82 | 3300013102 | Ga0157371_10035029 | Ga0157371_100350292 | 159 |
| 83 | 3300013104 | Ga0157370_10044157 | Ga0157370_100441573 | 159 |
| 84 | 3300013297 | Ga0157378_10002688 | Ga0157378_100026883 | 159 |
| 85 | 3300013307 | Ga0157372_10082536 | Ga0157372_100825363 | 159 |
| 86 | 3300013308 | Ga0157375_10715361 | Ga0157375_107153612 | 159 |
| 87 | 3300014326 | Ga0157380_10000024 | Ga0157380_1000002444 | 159 |
| 88 | 3300014326 | Ga0157380_11099548 | Ga0157380_110995482 | 159 |
| 89 | 3300014969 | Ga0157376_11512085 | Ga0157376_115120852 | 159 |
| 90 | 3300020082 | Ga0206353_10641775 | Ga0206353_106417751 | 159 |
| 91 | 3300025321 | Ga0207656_10000299 | Ga0207656_1000029918 | 159 |
| 92 | 3300025321 | Ga0207656_10008492 | Ga0207656_100084922 | 159 |
| 93 | 3300025900 | Ga0207710_10131939 | Ga0207710_101319392 | 159 |
| 94 | 3300025903 | Ga0207680_10055757 | Ga0207680_100557571 | 159 |
| 95 | 3300025905 | Ga0207685_10042691 | Ga0207685_100426912 | 159 |
| 96 | 3300025911 | Ga0207654_10057673 | Ga0207654_100576733 | 159 |
| 97 | 3300025915 | Ga0207693_10119837 | Ga0207693_101198372 | 159 |
| 98 | 3300025918 | Ga0207662_10959353 | Ga0207662_109593531 | 159 |
| 99 | 3300025919 | Ga0207657_10178558 | Ga0207657_101785582 | 159 |
| 100 | 3300025920 | Ga0207649_10000024 | Ga0207649_1000002439 | 159 |
| 101 | 3300025925 | Ga0207650_10064421 | Ga0207650_100644214 | 159 |
| 102 | 3300025926 | Ga0207659_10000043 | Ga0207659_1000004341 | 159 |
| 103 | 3300025927 | Ga0207687_10014582 | Ga0207687_100145822 | 159 |
| 104 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009203 | 159 |
| 105 | 3300025928 | Ga0207700_10051227 | Ga0207700_100512272 | 159 |
| 106 | 3300025929 | Ga0207664_10862723 | Ga0207664_108627232 | 159 |
| 107 | 3300025932 | Ga0207690_10005498 | Ga0207690_100054983 | 159 |
| 108 | 3300025935 | Ga0207709_10016508 | Ga0207709_100165083 | 159 |
| 109 | 3300025936 | Ga0207670_10152264 | Ga0207670_101522642 | 159 |
| 110 | 3300025940 | Ga0207691_10000374 | Ga0207691_1000037422 | 159 |
| 111 | 3300025941 | Ga0207711_10000019 | Ga0207711_1000001971 | 159 |
| 112 | 3300025944 | Ga0207661_10000142 | Ga0207661_1000014222 | 159 |
| 113 | 3300025944 | Ga0207661_10000212 | Ga0207661_1000021223 | 159 |
| 114 | 3300025944 | Ga0207661_10494420 | Ga0207661_104944202 | 159 |
| 115 | 3300025945 | Ga0207679_10069092 | Ga0207679_100690921 | 159 |
| 116 | 3300025972 | Ga0207668_10178777 | Ga0207668_101787772 | 159 |
| 117 | 3300025981 | Ga0207640_10000059 | Ga0207640_1000005959 | 159 |
| 118 | 3300025986 | Ga0207658_10284746 | Ga0207658_102847462 | 159 |
| 119 | 3300026023 | Ga0207677_10002718 | Ga0207677_100027184 | 159 |
| 120 | 3300026041 | Ga0207639_10172511 | Ga0207639_101725112 | 159 |
| 121 | 3300026041 | Ga0207639_10574835 | Ga0207639_105748352 | 159 |
| 122 | 3300026078 | Ga0207702_10019923 | Ga0207702_100199232 | 159 |
| 123 | 3300026121 | Ga0207683_10057651 | Ga0207683_100576512 | 159 |
| 124 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002188 | 159 |
| 125 | 3300028379 | Ga0268266_10000809 | Ga0268266_1000080913 | 159 |
| 126 | 3300028379 | Ga0268266_10104765 | Ga0268266_101047653 | 159 |
| 127 | 3300028379 | Ga0268266_10187488 | Ga0268266_101874882 | 159 |
| 128 | 3300032126 | Ga0307415_100028959 | Ga0307415_1000289593 | 159 |
| 129 | 3300036401 | Ga0373937_0773991 | Ga0373937_0773991_228_707 | 159 |
| 130 | 3300041512 | Ga0451853_2508159 | Ga0451853_2508159_291_770 | 159 |
| 131 | 3300044694 | Ga0466963_0014584 | Ga0466963_0014584_3368_3847 | 159 |
| 132 | 3300044842 | Ga0466957_0000145 | Ga0466957_0000145_17108_17587 | 159 |
| 133 | 3300044842 | Ga0466957_0128477 | Ga0466957_0128477_160_639 | 159 |
| 134 | 3300045836 | Ga0466958_0027248 | Ga0466958_0027248_519_998 | 159 |
| 135 | 3300046492 | Ga0495585_0317147 | Ga0495585_0317147_195_674 | 159 |
| 136 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_221620_222099 | 159 |
| 137 | 3300046512 | Ga0495610_0053349 | Ga0495610_0053349_907_1386 | 159 |
| 138 | 3300046520 | Ga0495637_0251252 | Ga0495637_0251252_104_583 | 159 |
| 139 | 3300046529 | Ga0495652_0000086 | Ga0495652_0000086_49358_49837 | 159 |
| 140 | 3300046674 | Ga0495588_0000240 | Ga0495588_0000240_33335_33814 | 159 |
| 141 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_222300_222779 | 159 |
| 142 | 3300046683 | Ga0495658_0005991 | Ga0495658_0005991_1248_1727 | 159 |
| 143 | 3300046689 | Ga0495613_0000298 | Ga0495613_0000298_28788_29267 | 159 |
| 144 | 3300046689 | Ga0495613_0434528 | Ga0495613_0434528_34_513 | 159 |
| 145 | 3300046809 | Ga0495600_0026058 | Ga0495600_0026058_988_1467 | 159 |
| 146 | 3300047317 | Ga0495604_0000850 | Ga0495604_0000850_3591_4070 | 159 |
| 147 | 3300047317 | Ga0495604_0168338 | Ga0495604_0168338_719_1198 | 159 |
| 148 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_126421_126900 | 159 |
| 149 | 3300047321 | Ga0495676_0028748 | Ga0495676_0028748_3603_4082 | 159 |
| 150 | 3300047444 | Ga0495675_0000046 | Ga0495675_0000046_20549_21028 | 159 |
| 151 | 3300047471 | Ga0495684_0370585 | Ga0495684_0370585_508_987 | 159 |
| 152 | 3300047673 | Ga0495593_0092050 | Ga0495593_0092050_353_832 | 159 |
| 153 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_171839_172318 | 159 |
| 154 | 3300048903 | Ga0496100_0000008 | Ga0496100_0000008_3859_4338 | 159 |
| 155 | 3300048904 | Ga0496101_0000016 | Ga0496101_0000016_12641_13120 | 159 |
| 156 | 3300048907 | Ga0496104_0229066 | Ga0496104_0229066_1146_1625 | 159 |
| 157 | 3300048909 | Ga0496106_0000086 | Ga0496106_0000086_69824_70303 | 159 |
| 158 | 3300048910 | Ga0496107_0000009 | Ga0496107_0000009_3573_4052 | 159 |
| 159 | 3300048912 | Ga0496109_0000035 | Ga0496109_0000035_140666_141145 | 159 |
| 160 | 3300048913 | Ga0496110_0000128 | Ga0496110_0000128_39276_39755 | 159 |
| 161 | 3300048913 | Ga0496110_0536559 | Ga0496110_0536559_416_895 | 159 |
| 162 | 3300048914 | Ga0496111_0000022 | Ga0496111_0000022_25697_26176 | 159 |
| 163 | 3300048914 | Ga0496111_1075423 | Ga0496111_1075423_61_540 | 159 |
| 164 | 3300048915 | Ga0496112_0004601 | Ga0496112_0004601_10796_11275 | 159 |
| 165 | 3300048916 | Ga0496113_0000093 | Ga0496113_0000093_37274_37753 | 159 |
| 166 | 3300048916 | Ga0496113_0237829 | Ga0496113_0237829_253_732 | 159 |
| 167 | 3300048916 | Ga0496113_0978594 | Ga0496113_0978594_115_594 | 159 |
| 168 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_257397_257876 | 159 |
| 169 | 3300048918 | Ga0496115_0000363 | Ga0496115_0000363_12712_13191 | 159 |
| 170 | 3300050509 | nmdc:mga0qj67_381264_c1 | nmdc:mga0qj67_381264_c1_179_661 | 159 |
| 171 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_169977_170456 | 159 |
| 172 | 3300053077 | Ga0495601_0162373 | Ga0495601_0162373_240_719 | 159 |
| 173 | 3300053083 | Ga0495655_0000003 | Ga0495655_0000003_180096_180575 | 159 |
| 174 | 3300053083 | Ga0495655_0001036 | Ga0495655_0001036_3166_3645 | 159 |
| 175 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_189180_189659 | 159 |
| 176 | 3300053084 | Ga0495595_0006411 | Ga0495595_0006411_724_1203 | 159 |
| 177 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_165770_166249 | 159 |
| 178 | 3300053085 | Ga0495619_0000120 | Ga0495619_0000120_37250_37729 | 159 |
| 179 | 3300053129 | Ga0500628_000002 | Ga0500628_000002_180096_180575 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wwv-assembly1.cif.gz_A-2 | c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii | 0.9341 | 85 | 147 |
| 3cp0-assembly1.cif.gz_A | crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum | 0.9127 | 87 | 147 |
| 3wwv-assembly1.cif.gz_A-2 | c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii | 0.8927 | 85 | 147 |
| 3cp0-assembly1.cif.gz_A | crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum | 0.8723 | 87 | 147 |
| 7ytj-assembly1.cif.gz_A | cryo-em structure of vtc complex | 0.8541 | 28 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71767_83_144_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9464 | 91 | 147 | 2.40.50.140 |
| af_Q4DA65_43_292_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.938 | 24 | 69 | 1.25.40.10 |
| 3wwvA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9341 | 85 | 147 | 2.40.50.140 |
| af_Q2FXZ8_166_227_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9301 | 86 | 147 | 2.40.50.140 |
| 3cp0A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8963 | 87 | 147 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4NEX6-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9717 | 91 | 147 |
|
| AF-U1FFM5-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9668 | 94 | 148 |
|
| AF-A0A3D4NEX6-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9555 | 91 | 147 |
|
| AF-A0A845X4Q4-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9296 | 90 | 150 |
|
| AF-A0A7G1IET6-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9214 | 87 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar