F273235

General Info

Members Datasets Scaffolds Average Seq Length
179 131 179 133

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100190864|Ga0068869_1001908641
Length 158
Sequence VLVRLREEVQEVPWGLRPLSVETGRLVVHDPIREFIRAFNERDLDAFVAVLDPEVELHSMKGLRKGREAARLWATRAPGGVQQSIELEELYEDGMESGGGSAVALIRRTWHWDEDGSHASTEEMAWLFELHEHRVRSWRPFEDRAAALHAGGFDHGIG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 7.82
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1011737 3300001977 Bacteria 1286
2 JGI24748J21848_1000508 3300002074 Bacteria 4288
3 JGI24034J26672_10000280 3300002239 Bacteria 6737
4 JGI24742J22300_10001675 3300002244 Bacteria 3528
5 JGI24751J29686_10025848 3300002459 Bacteria 1218
6 rootL2_10086692 3300003322 Bacteria 1155
7 JGI25404J52841_10019272 3300003659 Bacteria 1478
8 Ga0070683_100008554 3300005329 Bacteria 8698
9 Ga0070683_100030210 3300005329 Bacteria 4914
10 Ga0070683_101785381 3300005329 Unclassified 591
11 Ga0068869_100190864 3300005334 Bacteria 1611
12 Ga0068868_100001379 3300005338 Bacteria 16746
13 Ga0070691_10011299 3300005341 Bacteria 4075
14 Ga0070674_100000008 3300005356 Bacteria 143844
15 Ga0070688_100000300 3300005365 Bacteria 25290
16 Ga0070659_101110289 3300005366 Unclassified 697
17 Ga0070667_101591308 3300005367 Bacteria 614
18 Ga0070700_101184499 3300005441 Bacteria 637
19 Ga0070694_101143439 3300005444 Bacteria 651
20 Ga0070663_101489639 3300005455 Bacteria 601
21 Ga0070662_100000016 3300005457 Bacteria 105820
22 Ga0070685_10000320 3300005466 Bacteria 29816
23 Ga0070685_10800223 3300005466 Bacteria 695
24 Ga0070684_100019468 3300005535 Bacteria 5614
25 Ga0070684_100025949 3300005535 Bacteria 4930
26 Ga0070684_100068333 3300005535 Bacteria 3123
27 Ga0068853_100049950 3300005539 Bacteria 3597
28 Ga0070664_100195298 3300005564 Bacteria 1804
29 Ga0070702_100375594 3300005615 Bacteria 1009
30 Ga0068864_100000045 3300005618 Bacteria 154739
31 Ga0068866_10000597 3300005718 Bacteria 16444
32 Ga0081540_1000006 3300005983 Bacteria 208724
33 Ga0081539_10001929 3300005985 Bacteria 31957
34 Ga0075365_10612339 3300006038 Bacteria 770
35 Ga0070715_10000001 3300006163 Bacteria 693690
36 Ga0070712_100627122 3300006175 Bacteria 912
37 Ga0097621_100147775 3300006237 Bacteria 2014
38 Ga0097621_100973270 3300006237 Bacteria 793
39 Ga0068871_101081652 3300006358 Bacteria 749
40 Ga0075430_101607463 3300006846 Bacteria 534
41 Ga0075433_10000339 3300006852 Bacteria 29053
42 Ga0075433_10001485 3300006852 Bacteria 17324
43 Ga0114129_12403345 3300009147 Bacteria 631
44 Ga0105243_10042621 3300009148 Bacteria 3554
45 Ga0105242_10000819 3300009176 Bacteria 24165
46 Ga0105242_10058196 3300009176 Bacteria 3167
47 Ga0105248_13476123 3300009177 Unclassified 500
48 Ga0157370_11053292 3300013104 Unclassified 735
49 Ga0157374_10001108 3300013296 Bacteria 23187
50 Ga0157375_10000112 3300013308 Bacteria 79146
51 Ga0157375_10049839 3300013308 Bacteria 4105
52 Ga0157375_12056169 3300013308 Bacteria 679
53 Ga0163163_10101250 3300014325 Bacteria 2903
54 Ga0163163_10183251 3300014325 Bacteria 2141
55 Ga0163163_12065669 3300014325 Bacteria 629
56 Ga0157380_10000059 3300014326 Bacteria 62280
57 Ga0157380_10002264 3300014326 Bacteria 12942
58 Ga0157377_10040718 3300014745 Bacteria 2574
59 Ga0157379_11707391 3300014968 Unclassified 617
60 Ga0206356_10601656 3300020070 Bacteria 5581
61 Ga0207642_10000660 3300025899 Bacteria 10606
62 Ga0207685_10000011 3300025905 Bacteria 213430
63 Ga0207664_10111141 3300025929 Bacteria 2280
64 Ga0207706_10000068 3300025933 Bacteria 105795
65 Ga0207686_10000428 3300025934 Bacteria 28669
66 Ga0207686_10318623 3300025934 Bacteria 1161
67 Ga0207709_10048334 3300025935 Bacteria 2591
68 Ga0207669_10000004 3300025937 Bacteria 196828
69 Ga0207689_11098639 3300025942 Bacteria 670
70 Ga0207661_10000492 3300025944 Bacteria 25390
71 Ga0207661_10009503 3300025944 Bacteria 6977
72 Ga0207677_10000372 3300026023 Bacteria 31162
73 Ga0207703_10000040 3300026035 Bacteria 168191
74 Ga0207639_10031276 3300026041 Bacteria 3911
75 Ga0207676_10000016 3300026095 Bacteria 311561
76 Ga0207683_11318437 3300026121 Bacteria 668
77 Ga0265319_1000025 3300028563 Bacteria 142639
78 Ga0265338_10000486 3300028800 Bacteria 70900
79 Ga0307511_10093813 3300030521 Bacteria 2015
80 Ga0265332_10248831 3300031238 Bacteria 735
81 Ga0265325_10031538 3300031241 Bacteria 2835
82 Ga0265331_10059333 3300031250 Bacteria 1810
83 Ga0373927_0758353 3300035695 Unclassified 641
84 Ga0373937_0011597 3300036401 Bacteria 7740
85 Ga0316582_0950074 3300036647 Bacteria 587
86 Ga0451833_0016179 3300041491 Bacteria 1621
87 Ga0466963_0021074 3300044694 Bacteria 4107
88 Ga0466967_0179717 3300045976 Bacteria 1995
89 Ga0466967_0232333 3300045976 Bacteria 1756
90 Ga0495592_0186945 3300046454 Bacteria 1406
91 Ga0495603_0000097 3300046455 Bacteria 40321
92 Ga0495603_0007864 3300046455 Bacteria 6429
93 Ga0495641_0418500 3300046461 Unclassified 608
94 Ga0495651_0028465 3300046462 Bacteria 4354
95 Ga0495653_0209167 3300046463 Unclassified 1319
96 Ga0495662_0000650 3300046476 Bacteria 16301
97 Ga0495662_0061981 3300046476 Bacteria 1807
98 Ga0495662_0438166 3300046476 Bacteria 641
99 Ga0495608_0000305 3300046511 Bacteria 34510
100 Ga0495608_0260662 3300046511 Bacteria 1079
101 Ga0495608_0674144 3300046511 Archaea 617
102 Ga0495618_0464676 3300046514 Unclassified 767
103 Ga0495620_0000210 3300046515 Bacteria 44013
104 Ga0495628_0000144 3300046516 Bacteria 61254
105 Ga0495628_0256981 3300046516 Bacteria 1303
106 Ga0495628_0471699 3300046516 Unclassified 909
107 Ga0495630_0001833 3300046517 Bacteria 14832
108 Ga0495630_0412203 3300046517 Bacteria 1035
109 Ga0495644_0007172 3300046523 Bacteria 4306
110 Ga0495652_0285913 3300046529 Bacteria 1205
111 Ga0495640_0365702 3300046533 Bacteria 889
112 Ga0495586_0007791 3300046535 Bacteria 5710
113 Ga0495587_0115514 3300046536 Bacteria 1540
114 Ga0495621_0001991 3300046539 Bacteria 5376
115 Ga0495667_0555893 3300046559 Bacteria 717
116 Ga0495656_0000241 3300046615 Bacteria 19365
117 Ga0495634_0000401 3300046642 Bacteria 42619
118 Ga0495635_0121411 3300046663 Bacteria 1782
119 Ga0495635_0174326 3300046663 Bacteria 1462
120 Ga0495657_0013065 3300046675 Bacteria 6138
121 Ga0495657_0266075 3300046675 Bacteria 1029
122 Ga0495599_0124673 3300046678 Bacteria 1601
123 Ga0495599_0138380 3300046678 Bacteria 1511
124 Ga0495647_0000025 3300046681 Bacteria 65184
125 Ga0495647_0029227 3300046681 Bacteria 2037
126 Ga0495613_0098832 3300046689 Bacteria 2109
127 Ga0495624_0203123 3300046690 Bacteria 1203
128 Ga0495600_0139778 3300046809 Bacteria 1572
129 Ga0495604_0091550 3300047317 Bacteria 2255
130 Ga0495674_0000731 3300047319 Bacteria 31001
131 Ga0495674_0038417 3300047319 Bacteria 4297
132 Ga0495674_0578387 3300047319 Bacteria 892
133 Ga0495593_0476808 3300047673 Bacteria 625
134 Ga0495602_0001790 3300048088 Bacteria 21477
135 Ga0495602_0211225 3300048088 Unclassified 1473
136 Ga0496104_0808016 3300048907 Bacteria 844
137 Ga0496105_0000511 3300048908 Bacteria 25595
138 Ga0496105_1016079 3300048908 Bacteria 619
139 Ga0496108_0029149 3300048911 Bacteria 4569
140 Ga0496109_0038110 3300048912 Bacteria 4345
141 Ga0496109_0360336 3300048912 Bacteria 1374
142 Ga0496109_1195737 3300048912 Bacteria 697
143 Ga0496110_0066779 3300048913 Bacteria 3181
144 Ga0496111_0092862 3300048914 Bacteria 2212
145 Ga0496112_0000003 3300048915 Bacteria 660147
146 Ga0496112_0266415 3300048915 Bacteria 1662
147 Ga0496113_0041214 3300048916 Bacteria 3406
148 Ga0496113_0062444 3300048916 Bacteria 2813
149 Ga0496115_0002312 3300048918 Bacteria 13653
150 Ga0501036_0198901 3300049572 Bacteria 1686
151 Ga0501039_0060586 3300049575 Bacteria 2932
152 Ga0501040_0856524 3300049576 Bacteria 658
153 Ga0501042_0470905 3300049578 Bacteria 911
154 Ga0501043_0889345 3300049579 Bacteria 639
155 Ga0501043_1076138 3300049579 Bacteria 569
156 Ga0501048_0338166 3300049582 Bacteria 1073
157 Ga0501070_0091710 3300049586 Bacteria 2514
158 Ga0501070_0158987 3300049586 Bacteria 1863
159 Ga0501072_0010027 3300049588 Bacteria 7207
160 Ga0501075_0000392 3300049591 Bacteria 25374
161 Ga0501079_1449767 3300049741 Bacteria 540
162 Ga0501081_0965292 3300049743 Bacteria 643
163 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
164 nmdc:mga0a205_1916_c1 3300050515 Bacteria 18075
165 Ga0495601_0026531 3300053077 Bacteria 3577
166 Ga0495601_0034544 3300053077 Bacteria 3155
167 Ga0495601_0081689 3300053077 Bacteria 2074
168 Ga0495601_0210764 3300053077 Bacteria 1269
169 Ga0495601_0451083 3300053077 Bacteria 832
170 Ga0495612_0000068 3300053078 Bacteria 47169
171 Ga0495612_0069043 3300053078 Bacteria 1471
172 Ga0495612_0622124 3300053078 Unclassified 500
173 Ga0495595_0000658 3300053084 Bacteria 13138
174 Ga0495619_0000534 3300053085 Bacteria 25127
175 Ga0495619_0000693 3300053085 Bacteria 22004
176 Ga0495619_0003046 3300053085 Bacteria 10884
177 Ga0495619_0003898 3300053085 Bacteria 9590
178 Ga0500566_0465135 3300053094 Bacteria 551
179 Ga0501082_1344489 3300060353 Bacteria 624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_0016179 Ga0451833_0016179_19_429 121
2 3300046681 Ga0495647_0029227 Ga0495647_0029227_1603_2022 121
3 3300002459 JGI24751J29686_10025848 JGI24751J29686_100258482 123
4 3300005457 Ga0070662_100000016 Ga0070662_10000001662 123
5 3300006852 Ga0075433_10000339 Ga0075433_1000033919 123
6 3300009176 Ga0105242_10000819 Ga0105242_1000081911 123
7 3300025933 Ga0207706_10000068 Ga0207706_1000006862 123
8 3300025934 Ga0207686_10000428 Ga0207686_1000042822 123
9 3300046455 Ga0495603_0000097 Ga0495603_0000097_3632_4021 123
10 3300048918 Ga0496115_0002312 Ga0496115_0002312_1277_1666 123
11 3300050515 nmdc:mga0a205_11_c1 nmdc:mga0a205_11_c1_38838_39227 123
12 3300053077 Ga0495601_0451083 Ga0495601_0451083_154_540 123
13 3300005985 Ga0081539_10001929 Ga0081539_100019292 124
14 3300005329 Ga0070683_101785381 Ga0070683_1017853811 125
15 3300009147 Ga0114129_12403345 Ga0114129_124033452 125
16 3300005329 Ga0070683_100008554 Ga0070683_1000085546 126
17 3300005466 Ga0070685_10800223 Ga0070685_108002232 126
18 3300005535 Ga0070684_100019468 Ga0070684_1000194685 126
19 3300005535 Ga0070684_100068333 Ga0070684_1000683333 126
20 3300005539 Ga0068853_100049950 Ga0068853_1000499503 126
21 3300005564 Ga0070664_100195298 Ga0070664_1001952982 126
22 3300013308 Ga0157375_10049839 Ga0157375_100498392 126
23 3300014968 Ga0157379_11707391 Ga0157379_117073911 126
24 3300025942 Ga0207689_11098639 Ga0207689_110986392 126
25 3300025944 Ga0207661_10000492 Ga0207661_1000049212 126
26 3300046461 Ga0495641_0418500 Ga0495641_0418500_48_434 126
27 3300046476 Ga0495662_0061981 Ga0495662_0061981_137_553 126
28 3300046476 Ga0495662_0438166 Ga0495662_0438166_151_543 126
29 3300047673 Ga0495593_0476808 Ga0495593_0476808_184_600 126
30 3300048912 Ga0496109_1195737 Ga0496109_1195737_177_572 126
31 3300053078 Ga0495612_0622124 Ga0495612_0622124_33_419 126
32 3300005338 Ga0068868_100001379 Ga0068868_1000013792 127
33 3300005356 Ga0070674_100000008 Ga0070674_100000008106 127
34 3300005365 Ga0070688_100000300 Ga0070688_10000030012 127
35 3300005366 Ga0070659_101110289 Ga0070659_1011102891 127
36 3300005444 Ga0070694_101143439 Ga0070694_1011434391 127
37 3300005455 Ga0070663_101489639 Ga0070663_1014896391 127
38 3300005466 Ga0070685_10000320 Ga0070685_1000032012 127
39 3300005718 Ga0068866_10000597 Ga0068866_100005976 127
40 3300006846 Ga0075430_101607463 Ga0075430_1016074631 127
41 3300006852 Ga0075433_10001485 Ga0075433_1000148517 127
42 3300009148 Ga0105243_10042621 Ga0105243_100426212 127
43 3300009176 Ga0105242_10058196 Ga0105242_100581962 127
44 3300014325 Ga0163163_10101250 Ga0163163_101012501 127
45 3300014326 Ga0157380_10000059 Ga0157380_1000005910 127
46 3300014745 Ga0157377_10040718 Ga0157377_100407182 127
47 3300020070 Ga0206356_10601656 Ga0206356_106016562 127
48 3300025899 Ga0207642_10000660 Ga0207642_100006609 127
49 3300025929 Ga0207664_10111141 Ga0207664_101111412 127
50 3300025934 Ga0207686_10318623 Ga0207686_103186232 127
51 3300025935 Ga0207709_10048334 Ga0207709_100483342 127
52 3300025937 Ga0207669_10000004 Ga0207669_10000004100 127
53 3300026023 Ga0207677_10000372 Ga0207677_1000037217 127
54 3300026041 Ga0207639_10031276 Ga0207639_100312764 127
55 3300046511 Ga0495608_0260662 Ga0495608_0260662_588_980 127
56 3300046516 Ga0495628_0000144 Ga0495628_0000144_1856_2248 127
57 3300046516 Ga0495628_0471699 Ga0495628_0471699_167_586 127
58 3300046536 Ga0495587_0115514 Ga0495587_0115514_529_921 127
59 3300048088 Ga0495602_0001790 Ga0495602_0001790_15238_15630 127
60 3300048907 Ga0496104_0808016 Ga0496104_0808016_330_713 127
61 3300048908 Ga0496105_1016079 Ga0496105_1016079_179_562 127
62 3300049579 Ga0501043_0889345 Ga0501043_0889345_147_539 127
63 3300049586 Ga0501070_0091710 Ga0501070_0091710_1097_1489 127
64 3300049586 Ga0501070_0158987 Ga0501070_0158987_1440_1835 127
65 3300050515 nmdc:mga0a205_1916_c1 nmdc:mga0a205_1916_c1_15263_15667 127
66 3300003322 rootL2_10086692 rootL2_100866921 128
67 3300005329 Ga0070683_100030210 Ga0070683_1000302102 128
68 3300005341 Ga0070691_10011299 Ga0070691_100112992 128
69 3300005441 Ga0070700_101184499 Ga0070700_1011844991 128
70 3300005535 Ga0070684_100025949 Ga0070684_1000259492 128
71 3300005615 Ga0070702_100375594 Ga0070702_1003755942 128
72 3300005618 Ga0068864_100000045 Ga0068864_10000004540 128
73 3300006163 Ga0070715_10000001 Ga0070715_10000001198 128
74 3300006237 Ga0097621_100147775 Ga0097621_1001477752 128
75 3300006237 Ga0097621_100973270 Ga0097621_1009732702 128
76 3300006358 Ga0068871_101081652 Ga0068871_1010816522 128
77 3300009177 Ga0105248_13476123 Ga0105248_134761231 128
78 3300013308 Ga0157375_10000112 Ga0157375_1000011284 128
79 3300013308 Ga0157375_12056169 Ga0157375_120561692 128
80 3300014325 Ga0163163_10183251 Ga0163163_101832512 128
81 3300014326 Ga0157380_10002264 Ga0157380_100022643 128
82 3300025905 Ga0207685_10000011 Ga0207685_10000011198 128
83 3300025944 Ga0207661_10009503 Ga0207661_100095039 128
84 3300026035 Ga0207703_10000040 Ga0207703_10000040106 128
85 3300026095 Ga0207676_10000016 Ga0207676_10000016123 128
86 3300026121 Ga0207683_11318437 Ga0207683_113184372 128
87 3300030521 Ga0307511_10093813 Ga0307511_100938132 128
88 3300035695 Ga0373927_0758353 Ga0373927_0758353_213_617 128
89 3300036647 Ga0316582_0950074 Ga0316582_0950074_100_504 128
90 3300044694 Ga0466963_0021074 Ga0466963_0021074_739_1143 128
91 3300045976 Ga0466967_0179717 Ga0466967_0179717_1147_1551 128
92 3300046455 Ga0495603_0007864 Ga0495603_0007864_4575_4964 128
93 3300046462 Ga0495651_0028465 Ga0495651_0028465_1288_1692 128
94 3300046476 Ga0495662_0000650 Ga0495662_0000650_9259_9672 128
95 3300046511 Ga0495608_0000305 Ga0495608_0000305_27079_27492 128
96 3300046515 Ga0495620_0000210 Ga0495620_0000210_32482_32904 128
97 3300046517 Ga0495630_0412203 Ga0495630_0412203_588_977 128
98 3300046523 Ga0495644_0007172 Ga0495644_0007172_3830_4234 128
99 3300046539 Ga0495621_0001991 Ga0495621_0001991_1730_2122 128
100 3300046559 Ga0495667_0555893 Ga0495667_0555893_106_495 128
101 3300046615 Ga0495656_0000241 Ga0495656_0000241_1693_2097 128
102 3300046642 Ga0495634_0000401 Ga0495634_0000401_23742_24140 128
103 3300046663 Ga0495635_0174326 Ga0495635_0174326_465_863 128
104 3300046689 Ga0495613_0098832 Ga0495613_0098832_47_454 128
105 3300046690 Ga0495624_0203123 Ga0495624_0203123_95_508 128
106 3300048911 Ga0496108_0029149 Ga0496108_0029149_1947_2339 128
107 3300048915 Ga0496112_0000003 Ga0496112_0000003_131864_132268 128
108 3300048916 Ga0496113_0041214 Ga0496113_0041214_295_684 128
109 3300048916 Ga0496113_0062444 Ga0496113_0062444_1972_2364 128
110 3300049578 Ga0501042_0470905 Ga0501042_0470905_417_821 128
111 3300049591 Ga0501075_0000392 Ga0501075_0000392_19114_19518 128
112 3300053084 Ga0495595_0000658 Ga0495595_0000658_5718_6131 128
113 3300053085 Ga0495619_0000534 Ga0495619_0000534_4487_4891 128
114 3300053094 Ga0500566_0465135 Ga0500566_0465135_92_487 128
115 3300001977 JGI24746J21847_1011737 JGI24746J21847_10117373 129
116 3300002074 JGI24748J21848_1000508 JGI24748J21848_10005081 129
117 3300002239 JGI24034J26672_10000280 JGI24034J26672_100002805 129
118 3300002244 JGI24742J22300_10001675 JGI24742J22300_100016756 129
119 3300003659 JGI25404J52841_10019272 JGI25404J52841_100192722 129
120 3300005334 Ga0068869_100190864 Ga0068869_1001908641 129
121 3300005367 Ga0070667_101591308 Ga0070667_1015913081 129
122 3300005983 Ga0081540_1000006 Ga0081540_1000006200 129
123 3300006038 Ga0075365_10612339 Ga0075365_106123391 129
124 3300006175 Ga0070712_100627122 Ga0070712_1006271221 129
125 3300013104 Ga0157370_11053292 Ga0157370_110532922 129
126 3300013296 Ga0157374_10001108 Ga0157374_100011082 129
127 3300014325 Ga0163163_12065669 Ga0163163_120656691 129
128 3300028563 Ga0265319_1000025 Ga0265319_100002590 129
129 3300028800 Ga0265338_10000486 Ga0265338_1000048663 129
130 3300031238 Ga0265332_10248831 Ga0265332_102488311 129
131 3300031241 Ga0265325_10031538 Ga0265325_100315385 129
132 3300031250 Ga0265331_10059333 Ga0265331_100593333 129
133 3300036401 Ga0373937_0011597 Ga0373937_0011597_2119_2529 129
134 3300045976 Ga0466967_0232333 Ga0466967_0232333_116_517 129
135 3300046454 Ga0495592_0186945 Ga0495592_0186945_503_913 129
136 3300046463 Ga0495653_0209167 Ga0495653_0209167_592_1002 129
137 3300046511 Ga0495608_0674144 Ga0495608_0674144_109_549 129
138 3300046514 Ga0495618_0464676 Ga0495618_0464676_226_666 129
139 3300046516 Ga0495628_0256981 Ga0495628_0256981_587_979 129
140 3300046517 Ga0495630_0001833 Ga0495630_0001833_1375_1767 129
141 3300046529 Ga0495652_0285913 Ga0495652_0285913_216_611 129
142 3300046533 Ga0495640_0365702 Ga0495640_0365702_442_834 129
143 3300046535 Ga0495586_0007791 Ga0495586_0007791_606_1019 129
144 3300046663 Ga0495635_0121411 Ga0495635_0121411_1023_1415 129
145 3300046675 Ga0495657_0013065 Ga0495657_0013065_4334_4726 129
146 3300046675 Ga0495657_0266075 Ga0495657_0266075_351_761 129
147 3300046678 Ga0495599_0124673 Ga0495599_0124673_1113_1508 129
148 3300046678 Ga0495599_0138380 Ga0495599_0138380_791_1231 129
149 3300046681 Ga0495647_0000025 Ga0495647_0000025_47030_47437 129
150 3300046809 Ga0495600_0139778 Ga0495600_0139778_411_821 129
151 3300047317 Ga0495604_0091550 Ga0495604_0091550_1365_1775 129
152 3300047319 Ga0495674_0000731 Ga0495674_0000731_6946_7353 129
153 3300047319 Ga0495674_0038417 Ga0495674_0038417_2226_2666 129
154 3300047319 Ga0495674_0578387 Ga0495674_0578387_397_789 129
155 3300048088 Ga0495602_0211225 Ga0495602_0211225_16_426 129
156 3300048908 Ga0496105_0000511 Ga0496105_0000511_2858_3298 129
157 3300048912 Ga0496109_0038110 Ga0496109_0038110_835_1275 129
158 3300048912 Ga0496109_0360336 Ga0496109_0360336_86_493 129
159 3300048913 Ga0496110_0066779 Ga0496110_0066779_1198_1605 129
160 3300048914 Ga0496111_0092862 Ga0496111_0092862_1684_2091 129
161 3300048915 Ga0496112_0266415 Ga0496112_0266415_1194_1601 129
162 3300049572 Ga0501036_0198901 Ga0501036_0198901_147_548 129
163 3300049575 Ga0501039_0060586 Ga0501039_0060586_920_1321 129
164 3300049576 Ga0501040_0856524 Ga0501040_0856524_139_540 129
165 3300049579 Ga0501043_1076138 Ga0501043_1076138_136_531 129
166 3300049582 Ga0501048_0338166 Ga0501048_0338166_523_924 129
167 3300049588 Ga0501072_0010027 Ga0501072_0010027_6730_7131 129
168 3300049741 Ga0501079_1449767 Ga0501079_1449767_48_440 129
169 3300049743 Ga0501081_0965292 Ga0501081_0965292_96_497 129
170 3300053077 Ga0495601_0026531 Ga0495601_0026531_3057_3497 129
171 3300053077 Ga0495601_0034544 Ga0495601_0034544_1712_2104 129
172 3300053077 Ga0495601_0081689 Ga0495601_0081689_1037_1477 129
173 3300053077 Ga0495601_0210764 Ga0495601_0210764_633_1073 129
174 3300053078 Ga0495612_0000068 Ga0495612_0000068_5255_5695 129
175 3300053078 Ga0495612_0069043 Ga0495612_0069043_129_533 129
176 3300053085 Ga0495619_0000693 Ga0495619_0000693_20690_21082 129
177 3300053085 Ga0495619_0003046 Ga0495619_0003046_7159_7569 129
178 3300053085 Ga0495619_0003898 Ga0495619_0003898_422_814 129
179 3300060353 Ga0501082_1344489 Ga0501082_1344489_204_605 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

32

138

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8392 6 115
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8095 4 116
3ov4-assembly1.cif.gz_B crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8079 3 116
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8031 3 116
3ov4-assembly2.cif.gz_D crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8027 4 116
ID Description Score Start End Superfamily
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8572 1 114 3.10.450.50
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8416 1 114 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8391 6 115 3.10.450.50
af_I1LCK9_37_142_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.8336 23 116 1.10.520.10
af_I1LCK9_18_151_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.83 6 116 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1Q3NIL6-F1-model_v4 deleted 0.9556 1 126
AF-A0A1Q3NIL6-F1-model_v4 deleted 0.9329 1 126
AF-A0A7J9YWV3-F1-model_v4 SnoaL-like domain-containing protein 0.9188 3 126 GO:0006284
GO:0008725
GO:0046872
AF-A0A7V9VVH9-F1-model_v4 Nuclear transport factor 2 family protein 0.9108 3 129
AF-A0A640Y9Q1-F1-model_v4 Nuclear transport factor 2 family protein 0.9081 1 125

Feature Viewer

pLDDT pTM Quality
94.13 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map