F272572

General Info

Members Datasets Scaffolds Average Seq Length
178 129 178 229

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0054977|Ga0495610_0054977_481_1224
Length 247
Sequence MPPIILAAMTAADSGTDRYLVVNADDLGLAESVNAGVFAAHEGGIVTSASLMVRQGAAPAAAEEAGGHPELAIGLHVDLGEWIYERGEWVQAYLHCDTDDHDAVAAECRAQLERFRALLGRDPTHLDSHQHVHESEPVAGVAEQLAAELGVPLRNRAVRYEGGFYGQSGKGEPFPEGISPRRLIELIEALPPGWTEIGCHPAAGPVPTSSYDAERQIELATLRDPQVKNLLNVSNVNLCSYAQAPRP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 12.36
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10011715 3300005327 Bacteria 7035
2 Ga0070683_100000456 3300005329 Bacteria 28574
3 Ga0070683_100002844 3300005329 Bacteria 13858
4 Ga0070683_100079357 3300005329 Bacteria 3072
5 Ga0070670_100085254 3300005331 Bacteria 2714
6 Ga0070666_10022173 3300005335 Unclassified 4122
7 Ga0070682_100000013 3300005337 Bacteria 254641
8 Ga0068868_100001306 3300005338 Bacteria 17171
9 Ga0070660_100011228 3300005339 Bacteria 6358
10 Ga0070661_100000004 3300005344 Bacteria 243876
11 Ga0070692_10003141 3300005345 Bacteria 6627
12 Ga0070688_100000126 3300005365 Bacteria 40695
13 Ga0070688_100000220 3300005365 Bacteria 30190
14 Ga0070659_100000018 3300005366 Bacteria 156724
15 Ga0070667_100069783 3300005367 Bacteria 2991
16 Ga0070714_100000151 3300005435 Bacteria 55747
17 Ga0070714_100012545 3300005435 Bacteria 6771
18 Ga0070714_100016932 3300005435 Bacteria 5896
19 Ga0070714_100794609 3300005435 Bacteria 916
20 Ga0070705_100005576 3300005440 Bacteria 6141
21 Ga0070663_100358031 3300005455 Bacteria 1183
22 Ga0070685_10000012 3300005466 Bacteria 128823
23 Ga0070685_10000195 3300005466 Bacteria 40644
24 Ga0070684_100047072 3300005535 Bacteria 3737
25 Ga0068853_100004626 3300005539 Bacteria 10673
26 Ga0068853_100030743 3300005539 Bacteria 4538
27 Ga0070686_100046080 3300005544 Bacteria 2749
28 Ga0070665_100000106 3300005548 Bacteria 157315
29 Ga0070665_100022245 3300005548 Bacteria 6378
30 Ga0070664_100087541 3300005564 Bacteria 2693
31 Ga0068854_100000062 3300005578 Bacteria 78159
32 Ga0068856_100010425 3300005614 Bacteria 9023
33 Ga0068856_100022431 3300005614 Bacteria 6139
34 Ga0068852_100000022 3300005616 Bacteria 125196
35 Ga0068852_100021061 3300005616 Bacteria 5196
36 Ga0068851_10000514 3300005834 Bacteria 16947
37 Ga0068851_10018514 3300005834 Bacteria 3355
38 Ga0068863_100000004 3300005841 Bacteria 272478
39 Ga0068858_100000009 3300005842 Bacteria 237748
40 Ga0070712_100000007 3300006175 Bacteria 157653
41 Ga0070712_100000545 3300006175 Bacteria 21755
42 Ga0075430_100019850 3300006846 Bacteria 5717
43 Ga0075430_100072795 3300006846 Bacteria 2882
44 Ga0068865_100000064 3300006881 Bacteria 55421
45 Ga0105240_10444362 3300009093 Bacteria 1452
46 Ga0105245_10000016 3300009098 Bacteria 204372
47 Ga0105245_10000023 3300009098 Bacteria 180844
48 Ga0105245_10000335 3300009098 Bacteria 44336
49 Ga0105243_10245539 3300009148 Bacteria 1595
50 Ga0105248_10000037 3300009177 Bacteria 180751
51 Ga0105249_10045338 3300009553 Bacteria 3999
52 Ga0105239_10210160 3300010375 Bacteria 2181
53 Ga0105239_10269039 3300010375 Bacteria 1916
54 Ga0105239_10340954 3300010375 Bacteria 1691
55 Ga0105246_10253066 3300011119 Bacteria 1399
56 Ga0157371_10015267 3300013102 Bacteria 5767
57 Ga0157370_10020860 3300013104 Bacteria 6538
58 Ga0157369_10000051 3300013105 Bacteria 165672
59 Ga0157374_10005775 3300013296 Bacteria 10446
60 Ga0157374_10134699 3300013296 Bacteria 2394
61 Ga0157378_10054169 3300013297 Bacteria 3572
62 Ga0157378_10366529 3300013297 Bacteria 1411
63 Ga0157372_10000999 3300013307 Bacteria 30883
64 Ga0163163_10917183 3300014325 Unclassified 939
65 Ga0206354_10372902 3300020081 Bacteria 1431
66 Ga0206354_10715518 3300020081 Bacteria 1767
67 Ga0207656_10000111 3300025321 Bacteria 31159
68 Ga0207656_10010083 3300025321 Bacteria 3526
69 Ga0207680_10079030 3300025903 Unclassified 2062
70 Ga0207705_10031372 3300025909 Bacteria 3793
71 Ga0207695_10137609 3300025913 Bacteria 2394
72 Ga0207693_10000001 3300025915 Bacteria 469535
73 Ga0207693_10044492 3300025915 Bacteria 3489
74 Ga0207657_10016402 3300025919 Bacteria 7145
75 Ga0207649_10000003 3300025920 Bacteria 388908
76 Ga0207681_10001034 3300025923 Bacteria 18068
77 Ga0207650_10067455 3300025925 Bacteria 2685
78 Ga0207687_10000015 3300025927 Bacteria 261701
79 Ga0207687_10000018 3300025927 Bacteria 236159
80 Ga0207687_10000126 3300025927 Bacteria 51183
81 Ga0207664_10000152 3300025929 Bacteria 55754
82 Ga0207664_10004031 3300025929 Bacteria 9904
83 Ga0207664_10081390 3300025929 Bacteria 2635
84 Ga0207690_10000143 3300025932 Bacteria 57131
85 Ga0207690_10034694 3300025932 Bacteria 3252
86 Ga0207709_10004459 3300025935 Bacteria 8086
87 Ga0207704_10000084 3300025938 Bacteria 55496
88 Ga0207711_10000011 3300025941 Bacteria 518817
89 Ga0207661_10000372 3300025944 Bacteria 28801
90 Ga0207661_10000966 3300025944 Bacteria 18937
91 Ga0207661_10007333 3300025944 Bacteria 7846
92 Ga0207679_10256000 3300025945 Unclassified 1491
93 Ga0207712_10050654 3300025961 Bacteria 2900
94 Ga0207640_10000074 3300025981 Bacteria 78164
95 Ga0207658_10053057 3300025986 Bacteria 2994
96 Ga0207658_10287815 3300025986 Unclassified 1411
97 Ga0207677_10021367 3300026023 Bacteria 3953
98 Ga0207703_10000023 3300026035 Bacteria 222018
99 Ga0207639_10023429 3300026041 Bacteria 4459
100 Ga0207678_10408671 3300026067 Bacteria 1176
101 Ga0207702_10008001 3300026078 Bacteria 8956
102 Ga0207641_10000129 3300026088 Bacteria 110871
103 Ga0207675_100237259 3300026118 Unclassified 1761
104 Ga0207683_10014172 3300026121 Bacteria 6792
105 Ga0207698_10000043 3300026142 Bacteria 96553
106 Ga0207698_10015535 3300026142 Bacteria 5101
107 Ga0268266_10000047 3300028379 Bacteria 310996
108 Ga0268266_10015981 3300028379 Bacteria 6419
109 Ga0307415_100004058 3300032126 Bacteria 7554
110 Ga0373957_0105979 3300035120 Unclassified 1129
111 Ga0373937_0056715 3300036401 Bacteria 3598
112 Ga0466961_0088827 3300044693 Bacteria 1952
113 Ga0466963_0009727 3300044694 Bacteria 5800
114 Ga0466963_0022479 3300044694 Bacteria 3994
115 Ga0466971_0007725 3300044719 Bacteria 4686
116 Ga0466957_0012411 3300044842 Bacteria 4931
117 Ga0466959_0120990 3300045049 Bacteria 1861
118 Ga0466958_0020149 3300045836 Unclassified 3888
119 Ga0466967_0000002 3300045976 Bacteria 219994
120 Ga0495592_0083017 3300046454 Bacteria 2314
121 Ga0495629_0000025 3300046459 Bacteria 135624
122 Ga0495629_0109337 3300046459 Bacteria 1928
123 Ga0495641_0000110 3300046461 Bacteria 57683
124 Ga0495651_0123285 3300046462 Bacteria 1901
125 Ga0495606_0000017 3300046507 Bacteria 284549
126 Ga0495608_0171330 3300046511 Bacteria 1377
127 Ga0495610_0054977 3300046512 Unclassified 1921
128 Ga0495628_0032242 3300046516 Bacteria 4231
129 Ga0495628_0054258 3300046516 Bacteria 3160
130 Ga0495630_0000007 3300046517 Bacteria 376915
131 Ga0495630_0085093 3300046517 Bacteria 2387
132 Ga0495630_0219848 3300046517 Unclassified 1450
133 Ga0495652_0007337 3300046529 Bacteria 10166
134 Ga0495645_0023602 3300046543 Bacteria 4456
135 Ga0495645_0698930 3300046543 Bacteria 616
136 Ga0495656_0000138 3300046615 Bacteria 26951
137 Ga0495588_0000073 3300046674 Bacteria 219005
138 Ga0495599_0023810 3300046678 Bacteria 3828
139 Ga0495647_0000008 3300046681 Bacteria 101193
140 Ga0495658_0004896 3300046683 Bacteria 6573
141 Ga0495669_0000033 3300046684 Bacteria 98629
142 Ga0495624_0000127 3300046690 Bacteria 53463
143 Ga0495600_0218027 3300046809 Bacteria 1221
144 Ga0495604_0000058 3300047317 Bacteria 96955
145 Ga0495604_0000152 3300047317 Bacteria 60239
146 Ga0495672_0153206 3300047320 Unclassified 1193
147 Ga0495680_0001229 3300047322 Bacteria 28095
148 Ga0495679_004044 3300047446 Bacteria 6888
149 Ga0495593_0085326 3300047673 Bacteria 1629
150 Ga0495602_0145914 3300048088 Bacteria 1867
151 Ga0496100_0000002 3300048903 Bacteria 489057
152 Ga0496101_0000001 3300048904 Bacteria 489057
153 Ga0496102_0639236 3300048905 Bacteria 987
154 Ga0496103_0073997 3300048906 Bacteria 2135
155 Ga0496106_0000041 3300048909 Bacteria 107155
156 Ga0496106_0000110 3300048909 Bacteria 63946
157 Ga0496107_0000003 3300048910 Bacteria 304038
158 Ga0496108_0000001 3300048911 Bacteria 919044
159 Ga0496108_0000005 3300048911 Bacteria 535059
160 Ga0496109_0000002 3300048912 Bacteria 443393
161 Ga0496109_0000006 3300048912 Bacteria 325513
162 Ga0496110_0006754 3300048913 Bacteria 9127
163 Ga0496110_0294810 3300048913 Bacteria 1477
164 Ga0496111_0005745 3300048914 Bacteria 8004
165 Ga0496111_0054924 3300048914 Bacteria 2880
166 Ga0496111_0218856 3300048914 Bacteria 1415
167 Ga0496112_0000002 3300048915 Bacteria 782039
168 Ga0496112_0004614 3300048915 Bacteria 11719
169 Ga0496112_0027421 3300048915 Bacteria 5491
170 Ga0496113_0000001 3300048916 Bacteria 224977
171 Ga0496114_0012258 3300048917 Bacteria 6861
172 Ga0496115_0000240 3300048918 Bacteria 49737
173 Ga0496125_0109359 3300048928 Bacteria 2007
174 nmdc:mga0qj67_31690_c1 3300050509 Bacteria 4120
175 nmdc:mga0a205_273_c3 3300050515 Bacteria 16051
176 nmdc:mga0a205_6183_c1 3300050515 Bacteria 9940
177 Ga0495601_0000017 3300053077 Bacteria 204209
178 Ga0500614_000206 3300053123 Bacteria 15543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0698930 Ga0495645_0698930_92_601 169
2 3300005539 Ga0068853_100004626 Ga0068853_1000046268 191
3 3300020081 Ga0206354_10372902 Ga0206354_103729021 199
4 3300032126 Ga0307415_100004058 Ga0307415_1000040584 201
5 3300047322 Ga0495680_0001229 Ga0495680_0001229_9681_10379 203
6 3300005329 Ga0070683_100002844 Ga0070683_1000028445 207
7 3300005367 Ga0070667_100069783 Ga0070667_1000697834 207
8 3300005435 Ga0070714_100794609 Ga0070714_1007946091 207
9 3300025944 Ga0207661_10007333 Ga0207661_100073336 207
10 3300025986 Ga0207658_10053057 Ga0207658_100530572 207
11 3300047317 Ga0495604_0000058 Ga0495604_0000058_19079_19702 207
12 3300025932 Ga0207690_10034694 Ga0207690_100346944 208
13 3300048905 Ga0496102_0639236 Ga0496102_0639236_151_849 208
14 3300053077 Ga0495601_0000017 Ga0495601_0000017_116382_117008 208
15 3300013296 Ga0157374_10134699 Ga0157374_101346994 209
16 3300048909 Ga0496106_0000041 Ga0496106_0000041_34552_35262 209
17 3300013296 Ga0157374_10005775 Ga0157374_100057758 210
18 3300048915 Ga0496112_0000002 Ga0496112_0000002_360576_361274 210
19 3300046517 Ga0495630_0085093 Ga0495630_0085093_1118_1816 211
20 3300046681 Ga0495647_0000008 Ga0495647_0000008_42622_43332 211
21 3300005455 Ga0070663_100358031 Ga0070663_1003580311 212
22 3300026067 Ga0207678_10408671 Ga0207678_104086712 212
23 3300009098 Ga0105245_10000016 Ga0105245_1000001640 215
24 3300025927 Ga0207687_10000018 Ga0207687_10000018184 215
25 3300045976 Ga0466967_0000002 Ga0466967_0000002_190117_190767 215
26 3300046678 Ga0495599_0023810 Ga0495599_0023810_360_1058 215
27 3300044693 Ga0466961_0088827 Ga0466961_0088827_235_903 216
28 3300044694 Ga0466963_0009727 Ga0466963_0009727_1135_1803 216
29 3300044719 Ga0466971_0007725 Ga0466971_0007725_1609_2277 216
30 3300045049 Ga0466959_0120990 Ga0466959_0120990_235_903 216
31 3300045836 Ga0466958_0020149 Ga0466958_0020149_22_690 216
32 3300046529 Ga0495652_0007337 Ga0495652_0007337_3003_3701 216
33 3300048088 Ga0495602_0145914 Ga0495602_0145914_916_1614 216
34 3300006846 Ga0075430_100072795 Ga0075430_1000727952 218
35 3300046454 Ga0495592_0083017 Ga0495592_0083017_1491_2189 220
36 3300005548 Ga0070665_100000106 Ga0070665_10000010638 221
37 3300005842 Ga0068858_100000009 Ga0068858_100000009193 221
38 3300026035 Ga0207703_10000023 Ga0207703_10000023100 221
39 3300028379 Ga0268266_10000047 Ga0268266_10000047190 221
40 3300046517 Ga0495630_0000007 Ga0495630_0000007_236224_236925 221
41 3300048913 Ga0496110_0006754 Ga0496110_0006754_4404_5108 221
42 3300048914 Ga0496111_0005745 Ga0496111_0005745_177_881 221
43 3300005564 Ga0070664_100087541 Ga0070664_1000875412 222
44 3300025945 Ga0207679_10256000 Ga0207679_102560002 222
45 3300048906 Ga0496103_0073997 Ga0496103_0073997_275_985 222
46 3300005435 Ga0070714_100012545 Ga0070714_1000125459 223
47 3300005616 Ga0068852_100000022 Ga0068852_10000002246 223
48 3300025929 Ga0207664_10004031 Ga0207664_1000403113 223
49 3300026142 Ga0207698_10000043 Ga0207698_1000004377 223
50 3300046516 Ga0495628_0054258 Ga0495628_0054258_1837_2535 223
51 3300044842 Ga0466957_0012411 Ga0466957_0012411_1852_2556 224
52 3300005616 Ga0068852_100021061 Ga0068852_1000210612 225
53 3300026142 Ga0207698_10015535 Ga0207698_100155352 225
54 3300035120 Ga0373957_0105979 Ga0373957_0105979_283_981 225
55 3300036401 Ga0373937_0056715 Ga0373937_0056715_293_991 225
56 3300005365 Ga0070688_100000126 Ga0070688_1000001263 227
57 3300005466 Ga0070685_10000195 Ga0070685_100001953 227
58 3300048917 Ga0496114_0012258 Ga0496114_0012258_2721_3404 227
59 3300005337 Ga0070682_100000013 Ga0070682_1000000138 228
60 3300005544 Ga0070686_100046080 Ga0070686_1000460801 228
61 3300005614 Ga0068856_100010425 Ga0068856_1000104257 229
62 3300046809 Ga0495600_0218027 Ga0495600_0218027_247_939 230
63 3300005435 Ga0070714_100000151 Ga0070714_10000015158 231
64 3300005435 Ga0070714_100016932 Ga0070714_1000169322 231
65 3300006175 Ga0070712_100000007 Ga0070712_100000007103 231
66 3300006846 Ga0075430_100019850 Ga0075430_1000198503 231
67 3300025915 Ga0207693_10000001 Ga0207693_10000001333 231
68 3300025929 Ga0207664_10000152 Ga0207664_1000015211 231
69 3300025929 Ga0207664_10081390 Ga0207664_100813904 231
70 3300046459 Ga0495629_0109337 Ga0495629_0109337_990_1688 231
71 3300048913 Ga0496110_0294810 Ga0496110_0294810_579_1283 231
72 3300048914 Ga0496111_0054924 Ga0496111_0054924_1208_1912 231
73 3300048915 Ga0496112_0027421 Ga0496112_0027421_553_1263 231
74 3300048918 Ga0496115_0000240 Ga0496115_0000240_27336_28031 231
75 3300050509 nmdc:mga0qj67_31690_c1 nmdc:mga0qj67_31690_c1_1325_2044 231
76 3300005335 Ga0070666_10022173 Ga0070666_100221734 232
77 3300009553 Ga0105249_10045338 Ga0105249_100453382 232
78 3300014325 Ga0163163_10917183 Ga0163163_109171831 232
79 3300025903 Ga0207680_10079030 Ga0207680_100790303 232
80 3300025961 Ga0207712_10050654 Ga0207712_100506543 232
81 3300025986 Ga0207658_10287815 Ga0207658_102878152 232
82 3300026118 Ga0207675_100237259 Ga0207675_1002372592 232
83 3300046461 Ga0495641_0000110 Ga0495641_0000110_46862_47560 232
84 3300046462 Ga0495651_0123285 Ga0495651_0123285_1118_1816 232
85 3300046511 Ga0495608_0171330 Ga0495608_0171330_218_916 232
86 3300046516 Ga0495628_0032242 Ga0495628_0032242_1379_2077 232
87 3300046517 Ga0495630_0219848 Ga0495630_0219848_477_1199 232
88 3300046615 Ga0495656_0000138 Ga0495656_0000138_23523_24224 232
89 3300046684 Ga0495669_0000033 Ga0495669_0000033_73949_74647 232
90 3300047446 Ga0495679_004044 Ga0495679_004044_406_1104 232
91 3300048903 Ga0496100_0000002 Ga0496100_0000002_410689_411387 232
92 3300048904 Ga0496101_0000001 Ga0496101_0000001_410689_411387 232
93 3300048909 Ga0496106_0000110 Ga0496106_0000110_59459_60157 232
94 3300048910 Ga0496107_0000003 Ga0496107_0000003_59432_60130 232
95 3300048914 Ga0496111_0218856 Ga0496111_0218856_300_998 232
96 3300050515 nmdc:mga0a205_6183_c1 nmdc:mga0a205_6183_c1_271_969 232
97 3300053123 Ga0500614_000206 Ga0500614_000206_8292_8990 232
98 3300005339 Ga0070660_100011228 Ga0070660_1000112284 233
99 3300005345 Ga0070692_10003141 Ga0070692_100031413 233
100 3300005366 Ga0070659_100000018 Ga0070659_100000018141 233
101 3300005440 Ga0070705_100005576 Ga0070705_1000055765 233
102 3300009093 Ga0105240_10444362 Ga0105240_104443622 233
103 3300011119 Ga0105246_10253066 Ga0105246_102530662 233
104 3300020081 Ga0206354_10715518 Ga0206354_107155182 233
105 3300025913 Ga0207695_10137609 Ga0207695_101376092 233
106 3300025919 Ga0207657_10016402 Ga0207657_100164024 233
107 3300025923 Ga0207681_10001034 Ga0207681_100010343 233
108 3300025932 Ga0207690_10000143 Ga0207690_1000014346 233
109 3300046690 Ga0495624_0000127 Ga0495624_0000127_49537_50241 233
110 3300047317 Ga0495604_0000152 Ga0495604_0000152_31333_32034 233
111 3300005327 Ga0070658_10011715 Ga0070658_100117151 234
112 3300005329 Ga0070683_100000456 Ga0070683_1000004562 234
113 3300005329 Ga0070683_100079357 Ga0070683_1000793573 234
114 3300005331 Ga0070670_100085254 Ga0070670_1000852542 234
115 3300005338 Ga0068868_100001306 Ga0068868_1000013067 234
116 3300005344 Ga0070661_100000004 Ga0070661_100000004115 234
117 3300005365 Ga0070688_100000220 Ga0070688_1000002207 234
118 3300005466 Ga0070685_10000012 Ga0070685_10000012126 234
119 3300005535 Ga0070684_100047072 Ga0070684_1000470724 234
120 3300005539 Ga0068853_100030743 Ga0068853_1000307433 234
121 3300005548 Ga0070665_100022245 Ga0070665_1000222455 234
122 3300005578 Ga0068854_100000062 Ga0068854_10000006280 234
123 3300005614 Ga0068856_100022431 Ga0068856_1000224314 234
124 3300005834 Ga0068851_10000514 Ga0068851_1000051413 234
125 3300005834 Ga0068851_10018514 Ga0068851_100185143 234
126 3300005841 Ga0068863_100000004 Ga0068863_10000000498 234
127 3300006175 Ga0070712_100000545 Ga0070712_10000054516 234
128 3300006881 Ga0068865_100000064 Ga0068865_10000006411 234
129 3300009098 Ga0105245_10000023 Ga0105245_1000002392 234
130 3300009098 Ga0105245_10000335 Ga0105245_1000033537 234
131 3300009148 Ga0105243_10245539 Ga0105243_102455393 234
132 3300009177 Ga0105248_10000037 Ga0105248_100000376 234
133 3300010375 Ga0105239_10210160 Ga0105239_102101603 234
134 3300010375 Ga0105239_10269039 Ga0105239_102690392 234
135 3300010375 Ga0105239_10340954 Ga0105239_103409542 234
136 3300013102 Ga0157371_10015267 Ga0157371_100152676 234
137 3300013104 Ga0157370_10020860 Ga0157370_100208604 234
138 3300013105 Ga0157369_10000051 Ga0157369_1000005112 234
139 3300013297 Ga0157378_10054169 Ga0157378_100541695 234
140 3300013297 Ga0157378_10366529 Ga0157378_103665293 234
141 3300013307 Ga0157372_10000999 Ga0157372_100009995 234
142 3300025321 Ga0207656_10000111 Ga0207656_1000011114 234
143 3300025321 Ga0207656_10010083 Ga0207656_100100832 234
144 3300025909 Ga0207705_10031372 Ga0207705_100313723 234
145 3300025915 Ga0207693_10044492 Ga0207693_100444925 234
146 3300025920 Ga0207649_10000003 Ga0207649_10000003144 234
147 3300025925 Ga0207650_10067455 Ga0207650_100674555 234
148 3300025927 Ga0207687_10000015 Ga0207687_1000001590 234
149 3300025927 Ga0207687_10000126 Ga0207687_1000012644 234
150 3300025935 Ga0207709_10004459 Ga0207709_100044596 234
151 3300025938 Ga0207704_10000084 Ga0207704_1000008437 234
152 3300025941 Ga0207711_10000011 Ga0207711_10000011537 234
153 3300025944 Ga0207661_10000372 Ga0207661_1000037221 234
154 3300025944 Ga0207661_10000966 Ga0207661_1000096616 234
155 3300025981 Ga0207640_10000074 Ga0207640_1000007479 234
156 3300026023 Ga0207677_10021367 Ga0207677_100213674 234
157 3300026041 Ga0207639_10023429 Ga0207639_100234294 234
158 3300026078 Ga0207702_10008001 Ga0207702_100080014 234
159 3300026088 Ga0207641_10000129 Ga0207641_1000012995 234
160 3300026121 Ga0207683_10014172 Ga0207683_100141722 234
161 3300028379 Ga0268266_10015981 Ga0268266_100159814 234
162 3300044694 Ga0466963_0022479 Ga0466963_0022479_410_1114 234
163 3300046459 Ga0495629_0000025 Ga0495629_0000025_70401_71105 234
164 3300046507 Ga0495606_0000017 Ga0495606_0000017_187700_188404 234
165 3300046512 Ga0495610_0054977 Ga0495610_0054977_481_1224 234
166 3300046543 Ga0495645_0023602 Ga0495645_0023602_1827_2561 234
167 3300046674 Ga0495588_0000073 Ga0495588_0000073_63522_64226 234
168 3300046683 Ga0495658_0004896 Ga0495658_0004896_2973_3677 234
169 3300047320 Ga0495672_0153206 Ga0495672_0153206_172_915 234
170 3300047673 Ga0495593_0085326 Ga0495593_0085326_515_1234 234
171 3300048911 Ga0496108_0000001 Ga0496108_0000001_253422_254129 234
172 3300048911 Ga0496108_0000005 Ga0496108_0000005_259416_260120 234
173 3300048912 Ga0496109_0000002 Ga0496109_0000002_274972_275676 234
174 3300048912 Ga0496109_0000006 Ga0496109_0000006_253422_254129 234
175 3300048915 Ga0496112_0004614 Ga0496112_0004614_650_1354 234
176 3300048916 Ga0496113_0000001 Ga0496113_0000001_105793_106497 234
177 3300048928 Ga0496125_0109359 Ga0496125_0109359_891_1598 234
178 3300050515 nmdc:mga0a205_273_c3 nmdc:mga0a205_273_c3_151_867 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04794

YdjC

YdjC-like protein

19

233

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8387 4 228
2i5i-assembly1.cif.gz_A crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution 0.8134 4 228
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8048 4 228
2i5i-assembly1.cif.gz_A crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution 0.78 4 228
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.7251 5 227
ID Description Score Start End Superfamily
af_P37794_1_249_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8303 4 228 3.20.20.370
af_P37794_1_249_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.796 4 228 3.20.20.370
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.793 4 228 3.20.20.370
af_A2BIR6_5_313_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7609 5 228 3.20.20.370
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7606 4 228 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1Q7YRS2-F1-model_v4 ChbG/HpnK family deacetylase 0.9837 28 228 GO:0005975
GO:0019213
GO:0046872
AF-A0A6J4IXB5-F1-model_v4 Cellobiose phosphotransferase system YdjC-like protein 0.9809 4 232 GO:0005975
GO:0016740
GO:0019213
GO:0046872
AF-A0A2V9J9D3-F1-model_v4 ChbG/HpnK family deacetylase 0.9789 1 219 GO:0005975
GO:0019213
GO:0046872
AF-A0A2V9BM23-F1-model_v4 ChbG/HpnK family deacetylase 0.9754 92 228 GO:0005975
GO:0019213
GO:0046872
AF-A0A535CZI5-F1-model_v4 ChbG/HpnK family deacetylase 0.975 4 198 GO:0005975
GO:0019213
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map