F272572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 178 | 129 | 178 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0054977|Ga0495610_0054977_481_1224 |
| Length | 247 |
| Sequence | MPPIILAAMTAADSGTDRYLVVNADDLGLAESVNAGVFAAHEGGIVTSASLMVRQGAAPAAAEEAGGHPELAIGLHVDLGEWIYERGEWVQAYLHCDTDDHDAVAAECRAQLERFRALLGRDPTHLDSHQHVHESEPVAGVAEQLAAELGVPLRNRAVRYEGGFYGQSGKGEPFPEGISPRRLIELIEALPPGWTEIGCHPAAGPVPTSSYDAERQIELATLRDPQVKNLLNVSNVNLCSYAQAPRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 77 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 78 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 80 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 81 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 82 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 83 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 84 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 85 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 86 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 114 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 115 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 116 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 117 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 120 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 124 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 126 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 12.36 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10011715 | 3300005327 | Bacteria | 7035 |
| 2 | Ga0070683_100000456 | 3300005329 | Bacteria | 28574 |
| 3 | Ga0070683_100002844 | 3300005329 | Bacteria | 13858 |
| 4 | Ga0070683_100079357 | 3300005329 | Bacteria | 3072 |
| 5 | Ga0070670_100085254 | 3300005331 | Bacteria | 2714 |
| 6 | Ga0070666_10022173 | 3300005335 | Unclassified | 4122 |
| 7 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 8 | Ga0068868_100001306 | 3300005338 | Bacteria | 17171 |
| 9 | Ga0070660_100011228 | 3300005339 | Bacteria | 6358 |
| 10 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 11 | Ga0070692_10003141 | 3300005345 | Bacteria | 6627 |
| 12 | Ga0070688_100000126 | 3300005365 | Bacteria | 40695 |
| 13 | Ga0070688_100000220 | 3300005365 | Bacteria | 30190 |
| 14 | Ga0070659_100000018 | 3300005366 | Bacteria | 156724 |
| 15 | Ga0070667_100069783 | 3300005367 | Bacteria | 2991 |
| 16 | Ga0070714_100000151 | 3300005435 | Bacteria | 55747 |
| 17 | Ga0070714_100012545 | 3300005435 | Bacteria | 6771 |
| 18 | Ga0070714_100016932 | 3300005435 | Bacteria | 5896 |
| 19 | Ga0070714_100794609 | 3300005435 | Bacteria | 916 |
| 20 | Ga0070705_100005576 | 3300005440 | Bacteria | 6141 |
| 21 | Ga0070663_100358031 | 3300005455 | Bacteria | 1183 |
| 22 | Ga0070685_10000012 | 3300005466 | Bacteria | 128823 |
| 23 | Ga0070685_10000195 | 3300005466 | Bacteria | 40644 |
| 24 | Ga0070684_100047072 | 3300005535 | Bacteria | 3737 |
| 25 | Ga0068853_100004626 | 3300005539 | Bacteria | 10673 |
| 26 | Ga0068853_100030743 | 3300005539 | Bacteria | 4538 |
| 27 | Ga0070686_100046080 | 3300005544 | Bacteria | 2749 |
| 28 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 29 | Ga0070665_100022245 | 3300005548 | Bacteria | 6378 |
| 30 | Ga0070664_100087541 | 3300005564 | Bacteria | 2693 |
| 31 | Ga0068854_100000062 | 3300005578 | Bacteria | 78159 |
| 32 | Ga0068856_100010425 | 3300005614 | Bacteria | 9023 |
| 33 | Ga0068856_100022431 | 3300005614 | Bacteria | 6139 |
| 34 | Ga0068852_100000022 | 3300005616 | Bacteria | 125196 |
| 35 | Ga0068852_100021061 | 3300005616 | Bacteria | 5196 |
| 36 | Ga0068851_10000514 | 3300005834 | Bacteria | 16947 |
| 37 | Ga0068851_10018514 | 3300005834 | Bacteria | 3355 |
| 38 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 39 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 40 | Ga0070712_100000007 | 3300006175 | Bacteria | 157653 |
| 41 | Ga0070712_100000545 | 3300006175 | Bacteria | 21755 |
| 42 | Ga0075430_100019850 | 3300006846 | Bacteria | 5717 |
| 43 | Ga0075430_100072795 | 3300006846 | Bacteria | 2882 |
| 44 | Ga0068865_100000064 | 3300006881 | Bacteria | 55421 |
| 45 | Ga0105240_10444362 | 3300009093 | Bacteria | 1452 |
| 46 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 47 | Ga0105245_10000023 | 3300009098 | Bacteria | 180844 |
| 48 | Ga0105245_10000335 | 3300009098 | Bacteria | 44336 |
| 49 | Ga0105243_10245539 | 3300009148 | Bacteria | 1595 |
| 50 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 51 | Ga0105249_10045338 | 3300009553 | Bacteria | 3999 |
| 52 | Ga0105239_10210160 | 3300010375 | Bacteria | 2181 |
| 53 | Ga0105239_10269039 | 3300010375 | Bacteria | 1916 |
| 54 | Ga0105239_10340954 | 3300010375 | Bacteria | 1691 |
| 55 | Ga0105246_10253066 | 3300011119 | Bacteria | 1399 |
| 56 | Ga0157371_10015267 | 3300013102 | Bacteria | 5767 |
| 57 | Ga0157370_10020860 | 3300013104 | Bacteria | 6538 |
| 58 | Ga0157369_10000051 | 3300013105 | Bacteria | 165672 |
| 59 | Ga0157374_10005775 | 3300013296 | Bacteria | 10446 |
| 60 | Ga0157374_10134699 | 3300013296 | Bacteria | 2394 |
| 61 | Ga0157378_10054169 | 3300013297 | Bacteria | 3572 |
| 62 | Ga0157378_10366529 | 3300013297 | Bacteria | 1411 |
| 63 | Ga0157372_10000999 | 3300013307 | Bacteria | 30883 |
| 64 | Ga0163163_10917183 | 3300014325 | Unclassified | 939 |
| 65 | Ga0206354_10372902 | 3300020081 | Bacteria | 1431 |
| 66 | Ga0206354_10715518 | 3300020081 | Bacteria | 1767 |
| 67 | Ga0207656_10000111 | 3300025321 | Bacteria | 31159 |
| 68 | Ga0207656_10010083 | 3300025321 | Bacteria | 3526 |
| 69 | Ga0207680_10079030 | 3300025903 | Unclassified | 2062 |
| 70 | Ga0207705_10031372 | 3300025909 | Bacteria | 3793 |
| 71 | Ga0207695_10137609 | 3300025913 | Bacteria | 2394 |
| 72 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 73 | Ga0207693_10044492 | 3300025915 | Bacteria | 3489 |
| 74 | Ga0207657_10016402 | 3300025919 | Bacteria | 7145 |
| 75 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 76 | Ga0207681_10001034 | 3300025923 | Bacteria | 18068 |
| 77 | Ga0207650_10067455 | 3300025925 | Bacteria | 2685 |
| 78 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 79 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 80 | Ga0207687_10000126 | 3300025927 | Bacteria | 51183 |
| 81 | Ga0207664_10000152 | 3300025929 | Bacteria | 55754 |
| 82 | Ga0207664_10004031 | 3300025929 | Bacteria | 9904 |
| 83 | Ga0207664_10081390 | 3300025929 | Bacteria | 2635 |
| 84 | Ga0207690_10000143 | 3300025932 | Bacteria | 57131 |
| 85 | Ga0207690_10034694 | 3300025932 | Bacteria | 3252 |
| 86 | Ga0207709_10004459 | 3300025935 | Bacteria | 8086 |
| 87 | Ga0207704_10000084 | 3300025938 | Bacteria | 55496 |
| 88 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 89 | Ga0207661_10000372 | 3300025944 | Bacteria | 28801 |
| 90 | Ga0207661_10000966 | 3300025944 | Bacteria | 18937 |
| 91 | Ga0207661_10007333 | 3300025944 | Bacteria | 7846 |
| 92 | Ga0207679_10256000 | 3300025945 | Unclassified | 1491 |
| 93 | Ga0207712_10050654 | 3300025961 | Bacteria | 2900 |
| 94 | Ga0207640_10000074 | 3300025981 | Bacteria | 78164 |
| 95 | Ga0207658_10053057 | 3300025986 | Bacteria | 2994 |
| 96 | Ga0207658_10287815 | 3300025986 | Unclassified | 1411 |
| 97 | Ga0207677_10021367 | 3300026023 | Bacteria | 3953 |
| 98 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 99 | Ga0207639_10023429 | 3300026041 | Bacteria | 4459 |
| 100 | Ga0207678_10408671 | 3300026067 | Bacteria | 1176 |
| 101 | Ga0207702_10008001 | 3300026078 | Bacteria | 8956 |
| 102 | Ga0207641_10000129 | 3300026088 | Bacteria | 110871 |
| 103 | Ga0207675_100237259 | 3300026118 | Unclassified | 1761 |
| 104 | Ga0207683_10014172 | 3300026121 | Bacteria | 6792 |
| 105 | Ga0207698_10000043 | 3300026142 | Bacteria | 96553 |
| 106 | Ga0207698_10015535 | 3300026142 | Bacteria | 5101 |
| 107 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 108 | Ga0268266_10015981 | 3300028379 | Bacteria | 6419 |
| 109 | Ga0307415_100004058 | 3300032126 | Bacteria | 7554 |
| 110 | Ga0373957_0105979 | 3300035120 | Unclassified | 1129 |
| 111 | Ga0373937_0056715 | 3300036401 | Bacteria | 3598 |
| 112 | Ga0466961_0088827 | 3300044693 | Bacteria | 1952 |
| 113 | Ga0466963_0009727 | 3300044694 | Bacteria | 5800 |
| 114 | Ga0466963_0022479 | 3300044694 | Bacteria | 3994 |
| 115 | Ga0466971_0007725 | 3300044719 | Bacteria | 4686 |
| 116 | Ga0466957_0012411 | 3300044842 | Bacteria | 4931 |
| 117 | Ga0466959_0120990 | 3300045049 | Bacteria | 1861 |
| 118 | Ga0466958_0020149 | 3300045836 | Unclassified | 3888 |
| 119 | Ga0466967_0000002 | 3300045976 | Bacteria | 219994 |
| 120 | Ga0495592_0083017 | 3300046454 | Bacteria | 2314 |
| 121 | Ga0495629_0000025 | 3300046459 | Bacteria | 135624 |
| 122 | Ga0495629_0109337 | 3300046459 | Bacteria | 1928 |
| 123 | Ga0495641_0000110 | 3300046461 | Bacteria | 57683 |
| 124 | Ga0495651_0123285 | 3300046462 | Bacteria | 1901 |
| 125 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 126 | Ga0495608_0171330 | 3300046511 | Bacteria | 1377 |
| 127 | Ga0495610_0054977 | 3300046512 | Unclassified | 1921 |
| 128 | Ga0495628_0032242 | 3300046516 | Bacteria | 4231 |
| 129 | Ga0495628_0054258 | 3300046516 | Bacteria | 3160 |
| 130 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 131 | Ga0495630_0085093 | 3300046517 | Bacteria | 2387 |
| 132 | Ga0495630_0219848 | 3300046517 | Unclassified | 1450 |
| 133 | Ga0495652_0007337 | 3300046529 | Bacteria | 10166 |
| 134 | Ga0495645_0023602 | 3300046543 | Bacteria | 4456 |
| 135 | Ga0495645_0698930 | 3300046543 | Bacteria | 616 |
| 136 | Ga0495656_0000138 | 3300046615 | Bacteria | 26951 |
| 137 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 138 | Ga0495599_0023810 | 3300046678 | Bacteria | 3828 |
| 139 | Ga0495647_0000008 | 3300046681 | Bacteria | 101193 |
| 140 | Ga0495658_0004896 | 3300046683 | Bacteria | 6573 |
| 141 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 142 | Ga0495624_0000127 | 3300046690 | Bacteria | 53463 |
| 143 | Ga0495600_0218027 | 3300046809 | Bacteria | 1221 |
| 144 | Ga0495604_0000058 | 3300047317 | Bacteria | 96955 |
| 145 | Ga0495604_0000152 | 3300047317 | Bacteria | 60239 |
| 146 | Ga0495672_0153206 | 3300047320 | Unclassified | 1193 |
| 147 | Ga0495680_0001229 | 3300047322 | Bacteria | 28095 |
| 148 | Ga0495679_004044 | 3300047446 | Bacteria | 6888 |
| 149 | Ga0495593_0085326 | 3300047673 | Bacteria | 1629 |
| 150 | Ga0495602_0145914 | 3300048088 | Bacteria | 1867 |
| 151 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 152 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 153 | Ga0496102_0639236 | 3300048905 | Bacteria | 987 |
| 154 | Ga0496103_0073997 | 3300048906 | Bacteria | 2135 |
| 155 | Ga0496106_0000041 | 3300048909 | Bacteria | 107155 |
| 156 | Ga0496106_0000110 | 3300048909 | Bacteria | 63946 |
| 157 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 158 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 159 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 160 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 161 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 162 | Ga0496110_0006754 | 3300048913 | Bacteria | 9127 |
| 163 | Ga0496110_0294810 | 3300048913 | Bacteria | 1477 |
| 164 | Ga0496111_0005745 | 3300048914 | Bacteria | 8004 |
| 165 | Ga0496111_0054924 | 3300048914 | Bacteria | 2880 |
| 166 | Ga0496111_0218856 | 3300048914 | Bacteria | 1415 |
| 167 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 168 | Ga0496112_0004614 | 3300048915 | Bacteria | 11719 |
| 169 | Ga0496112_0027421 | 3300048915 | Bacteria | 5491 |
| 170 | Ga0496113_0000001 | 3300048916 | Bacteria | 224977 |
| 171 | Ga0496114_0012258 | 3300048917 | Bacteria | 6861 |
| 172 | Ga0496115_0000240 | 3300048918 | Bacteria | 49737 |
| 173 | Ga0496125_0109359 | 3300048928 | Bacteria | 2007 |
| 174 | nmdc:mga0qj67_31690_c1 | 3300050509 | Bacteria | 4120 |
| 175 | nmdc:mga0a205_273_c3 | 3300050515 | Bacteria | 16051 |
| 176 | nmdc:mga0a205_6183_c1 | 3300050515 | Bacteria | 9940 |
| 177 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 178 | Ga0500614_000206 | 3300053123 | Bacteria | 15543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0698930 | Ga0495645_0698930_92_601 | 169 |
| 2 | 3300005539 | Ga0068853_100004626 | Ga0068853_1000046268 | 191 |
| 3 | 3300020081 | Ga0206354_10372902 | Ga0206354_103729021 | 199 |
| 4 | 3300032126 | Ga0307415_100004058 | Ga0307415_1000040584 | 201 |
| 5 | 3300047322 | Ga0495680_0001229 | Ga0495680_0001229_9681_10379 | 203 |
| 6 | 3300005329 | Ga0070683_100002844 | Ga0070683_1000028445 | 207 |
| 7 | 3300005367 | Ga0070667_100069783 | Ga0070667_1000697834 | 207 |
| 8 | 3300005435 | Ga0070714_100794609 | Ga0070714_1007946091 | 207 |
| 9 | 3300025944 | Ga0207661_10007333 | Ga0207661_100073336 | 207 |
| 10 | 3300025986 | Ga0207658_10053057 | Ga0207658_100530572 | 207 |
| 11 | 3300047317 | Ga0495604_0000058 | Ga0495604_0000058_19079_19702 | 207 |
| 12 | 3300025932 | Ga0207690_10034694 | Ga0207690_100346944 | 208 |
| 13 | 3300048905 | Ga0496102_0639236 | Ga0496102_0639236_151_849 | 208 |
| 14 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_116382_117008 | 208 |
| 15 | 3300013296 | Ga0157374_10134699 | Ga0157374_101346994 | 209 |
| 16 | 3300048909 | Ga0496106_0000041 | Ga0496106_0000041_34552_35262 | 209 |
| 17 | 3300013296 | Ga0157374_10005775 | Ga0157374_100057758 | 210 |
| 18 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_360576_361274 | 210 |
| 19 | 3300046517 | Ga0495630_0085093 | Ga0495630_0085093_1118_1816 | 211 |
| 20 | 3300046681 | Ga0495647_0000008 | Ga0495647_0000008_42622_43332 | 211 |
| 21 | 3300005455 | Ga0070663_100358031 | Ga0070663_1003580311 | 212 |
| 22 | 3300026067 | Ga0207678_10408671 | Ga0207678_104086712 | 212 |
| 23 | 3300009098 | Ga0105245_10000016 | Ga0105245_1000001640 | 215 |
| 24 | 3300025927 | Ga0207687_10000018 | Ga0207687_10000018184 | 215 |
| 25 | 3300045976 | Ga0466967_0000002 | Ga0466967_0000002_190117_190767 | 215 |
| 26 | 3300046678 | Ga0495599_0023810 | Ga0495599_0023810_360_1058 | 215 |
| 27 | 3300044693 | Ga0466961_0088827 | Ga0466961_0088827_235_903 | 216 |
| 28 | 3300044694 | Ga0466963_0009727 | Ga0466963_0009727_1135_1803 | 216 |
| 29 | 3300044719 | Ga0466971_0007725 | Ga0466971_0007725_1609_2277 | 216 |
| 30 | 3300045049 | Ga0466959_0120990 | Ga0466959_0120990_235_903 | 216 |
| 31 | 3300045836 | Ga0466958_0020149 | Ga0466958_0020149_22_690 | 216 |
| 32 | 3300046529 | Ga0495652_0007337 | Ga0495652_0007337_3003_3701 | 216 |
| 33 | 3300048088 | Ga0495602_0145914 | Ga0495602_0145914_916_1614 | 216 |
| 34 | 3300006846 | Ga0075430_100072795 | Ga0075430_1000727952 | 218 |
| 35 | 3300046454 | Ga0495592_0083017 | Ga0495592_0083017_1491_2189 | 220 |
| 36 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010638 | 221 |
| 37 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009193 | 221 |
| 38 | 3300026035 | Ga0207703_10000023 | Ga0207703_10000023100 | 221 |
| 39 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047190 | 221 |
| 40 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_236224_236925 | 221 |
| 41 | 3300048913 | Ga0496110_0006754 | Ga0496110_0006754_4404_5108 | 221 |
| 42 | 3300048914 | Ga0496111_0005745 | Ga0496111_0005745_177_881 | 221 |
| 43 | 3300005564 | Ga0070664_100087541 | Ga0070664_1000875412 | 222 |
| 44 | 3300025945 | Ga0207679_10256000 | Ga0207679_102560002 | 222 |
| 45 | 3300048906 | Ga0496103_0073997 | Ga0496103_0073997_275_985 | 222 |
| 46 | 3300005435 | Ga0070714_100012545 | Ga0070714_1000125459 | 223 |
| 47 | 3300005616 | Ga0068852_100000022 | Ga0068852_10000002246 | 223 |
| 48 | 3300025929 | Ga0207664_10004031 | Ga0207664_1000403113 | 223 |
| 49 | 3300026142 | Ga0207698_10000043 | Ga0207698_1000004377 | 223 |
| 50 | 3300046516 | Ga0495628_0054258 | Ga0495628_0054258_1837_2535 | 223 |
| 51 | 3300044842 | Ga0466957_0012411 | Ga0466957_0012411_1852_2556 | 224 |
| 52 | 3300005616 | Ga0068852_100021061 | Ga0068852_1000210612 | 225 |
| 53 | 3300026142 | Ga0207698_10015535 | Ga0207698_100155352 | 225 |
| 54 | 3300035120 | Ga0373957_0105979 | Ga0373957_0105979_283_981 | 225 |
| 55 | 3300036401 | Ga0373937_0056715 | Ga0373937_0056715_293_991 | 225 |
| 56 | 3300005365 | Ga0070688_100000126 | Ga0070688_1000001263 | 227 |
| 57 | 3300005466 | Ga0070685_10000195 | Ga0070685_100001953 | 227 |
| 58 | 3300048917 | Ga0496114_0012258 | Ga0496114_0012258_2721_3404 | 227 |
| 59 | 3300005337 | Ga0070682_100000013 | Ga0070682_1000000138 | 228 |
| 60 | 3300005544 | Ga0070686_100046080 | Ga0070686_1000460801 | 228 |
| 61 | 3300005614 | Ga0068856_100010425 | Ga0068856_1000104257 | 229 |
| 62 | 3300046809 | Ga0495600_0218027 | Ga0495600_0218027_247_939 | 230 |
| 63 | 3300005435 | Ga0070714_100000151 | Ga0070714_10000015158 | 231 |
| 64 | 3300005435 | Ga0070714_100016932 | Ga0070714_1000169322 | 231 |
| 65 | 3300006175 | Ga0070712_100000007 | Ga0070712_100000007103 | 231 |
| 66 | 3300006846 | Ga0075430_100019850 | Ga0075430_1000198503 | 231 |
| 67 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001333 | 231 |
| 68 | 3300025929 | Ga0207664_10000152 | Ga0207664_1000015211 | 231 |
| 69 | 3300025929 | Ga0207664_10081390 | Ga0207664_100813904 | 231 |
| 70 | 3300046459 | Ga0495629_0109337 | Ga0495629_0109337_990_1688 | 231 |
| 71 | 3300048913 | Ga0496110_0294810 | Ga0496110_0294810_579_1283 | 231 |
| 72 | 3300048914 | Ga0496111_0054924 | Ga0496111_0054924_1208_1912 | 231 |
| 73 | 3300048915 | Ga0496112_0027421 | Ga0496112_0027421_553_1263 | 231 |
| 74 | 3300048918 | Ga0496115_0000240 | Ga0496115_0000240_27336_28031 | 231 |
| 75 | 3300050509 | nmdc:mga0qj67_31690_c1 | nmdc:mga0qj67_31690_c1_1325_2044 | 231 |
| 76 | 3300005335 | Ga0070666_10022173 | Ga0070666_100221734 | 232 |
| 77 | 3300009553 | Ga0105249_10045338 | Ga0105249_100453382 | 232 |
| 78 | 3300014325 | Ga0163163_10917183 | Ga0163163_109171831 | 232 |
| 79 | 3300025903 | Ga0207680_10079030 | Ga0207680_100790303 | 232 |
| 80 | 3300025961 | Ga0207712_10050654 | Ga0207712_100506543 | 232 |
| 81 | 3300025986 | Ga0207658_10287815 | Ga0207658_102878152 | 232 |
| 82 | 3300026118 | Ga0207675_100237259 | Ga0207675_1002372592 | 232 |
| 83 | 3300046461 | Ga0495641_0000110 | Ga0495641_0000110_46862_47560 | 232 |
| 84 | 3300046462 | Ga0495651_0123285 | Ga0495651_0123285_1118_1816 | 232 |
| 85 | 3300046511 | Ga0495608_0171330 | Ga0495608_0171330_218_916 | 232 |
| 86 | 3300046516 | Ga0495628_0032242 | Ga0495628_0032242_1379_2077 | 232 |
| 87 | 3300046517 | Ga0495630_0219848 | Ga0495630_0219848_477_1199 | 232 |
| 88 | 3300046615 | Ga0495656_0000138 | Ga0495656_0000138_23523_24224 | 232 |
| 89 | 3300046684 | Ga0495669_0000033 | Ga0495669_0000033_73949_74647 | 232 |
| 90 | 3300047446 | Ga0495679_004044 | Ga0495679_004044_406_1104 | 232 |
| 91 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_410689_411387 | 232 |
| 92 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_410689_411387 | 232 |
| 93 | 3300048909 | Ga0496106_0000110 | Ga0496106_0000110_59459_60157 | 232 |
| 94 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_59432_60130 | 232 |
| 95 | 3300048914 | Ga0496111_0218856 | Ga0496111_0218856_300_998 | 232 |
| 96 | 3300050515 | nmdc:mga0a205_6183_c1 | nmdc:mga0a205_6183_c1_271_969 | 232 |
| 97 | 3300053123 | Ga0500614_000206 | Ga0500614_000206_8292_8990 | 232 |
| 98 | 3300005339 | Ga0070660_100011228 | Ga0070660_1000112284 | 233 |
| 99 | 3300005345 | Ga0070692_10003141 | Ga0070692_100031413 | 233 |
| 100 | 3300005366 | Ga0070659_100000018 | Ga0070659_100000018141 | 233 |
| 101 | 3300005440 | Ga0070705_100005576 | Ga0070705_1000055765 | 233 |
| 102 | 3300009093 | Ga0105240_10444362 | Ga0105240_104443622 | 233 |
| 103 | 3300011119 | Ga0105246_10253066 | Ga0105246_102530662 | 233 |
| 104 | 3300020081 | Ga0206354_10715518 | Ga0206354_107155182 | 233 |
| 105 | 3300025913 | Ga0207695_10137609 | Ga0207695_101376092 | 233 |
| 106 | 3300025919 | Ga0207657_10016402 | Ga0207657_100164024 | 233 |
| 107 | 3300025923 | Ga0207681_10001034 | Ga0207681_100010343 | 233 |
| 108 | 3300025932 | Ga0207690_10000143 | Ga0207690_1000014346 | 233 |
| 109 | 3300046690 | Ga0495624_0000127 | Ga0495624_0000127_49537_50241 | 233 |
| 110 | 3300047317 | Ga0495604_0000152 | Ga0495604_0000152_31333_32034 | 233 |
| 111 | 3300005327 | Ga0070658_10011715 | Ga0070658_100117151 | 234 |
| 112 | 3300005329 | Ga0070683_100000456 | Ga0070683_1000004562 | 234 |
| 113 | 3300005329 | Ga0070683_100079357 | Ga0070683_1000793573 | 234 |
| 114 | 3300005331 | Ga0070670_100085254 | Ga0070670_1000852542 | 234 |
| 115 | 3300005338 | Ga0068868_100001306 | Ga0068868_1000013067 | 234 |
| 116 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004115 | 234 |
| 117 | 3300005365 | Ga0070688_100000220 | Ga0070688_1000002207 | 234 |
| 118 | 3300005466 | Ga0070685_10000012 | Ga0070685_10000012126 | 234 |
| 119 | 3300005535 | Ga0070684_100047072 | Ga0070684_1000470724 | 234 |
| 120 | 3300005539 | Ga0068853_100030743 | Ga0068853_1000307433 | 234 |
| 121 | 3300005548 | Ga0070665_100022245 | Ga0070665_1000222455 | 234 |
| 122 | 3300005578 | Ga0068854_100000062 | Ga0068854_10000006280 | 234 |
| 123 | 3300005614 | Ga0068856_100022431 | Ga0068856_1000224314 | 234 |
| 124 | 3300005834 | Ga0068851_10000514 | Ga0068851_1000051413 | 234 |
| 125 | 3300005834 | Ga0068851_10018514 | Ga0068851_100185143 | 234 |
| 126 | 3300005841 | Ga0068863_100000004 | Ga0068863_10000000498 | 234 |
| 127 | 3300006175 | Ga0070712_100000545 | Ga0070712_10000054516 | 234 |
| 128 | 3300006881 | Ga0068865_100000064 | Ga0068865_10000006411 | 234 |
| 129 | 3300009098 | Ga0105245_10000023 | Ga0105245_1000002392 | 234 |
| 130 | 3300009098 | Ga0105245_10000335 | Ga0105245_1000033537 | 234 |
| 131 | 3300009148 | Ga0105243_10245539 | Ga0105243_102455393 | 234 |
| 132 | 3300009177 | Ga0105248_10000037 | Ga0105248_100000376 | 234 |
| 133 | 3300010375 | Ga0105239_10210160 | Ga0105239_102101603 | 234 |
| 134 | 3300010375 | Ga0105239_10269039 | Ga0105239_102690392 | 234 |
| 135 | 3300010375 | Ga0105239_10340954 | Ga0105239_103409542 | 234 |
| 136 | 3300013102 | Ga0157371_10015267 | Ga0157371_100152676 | 234 |
| 137 | 3300013104 | Ga0157370_10020860 | Ga0157370_100208604 | 234 |
| 138 | 3300013105 | Ga0157369_10000051 | Ga0157369_1000005112 | 234 |
| 139 | 3300013297 | Ga0157378_10054169 | Ga0157378_100541695 | 234 |
| 140 | 3300013297 | Ga0157378_10366529 | Ga0157378_103665293 | 234 |
| 141 | 3300013307 | Ga0157372_10000999 | Ga0157372_100009995 | 234 |
| 142 | 3300025321 | Ga0207656_10000111 | Ga0207656_1000011114 | 234 |
| 143 | 3300025321 | Ga0207656_10010083 | Ga0207656_100100832 | 234 |
| 144 | 3300025909 | Ga0207705_10031372 | Ga0207705_100313723 | 234 |
| 145 | 3300025915 | Ga0207693_10044492 | Ga0207693_100444925 | 234 |
| 146 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003144 | 234 |
| 147 | 3300025925 | Ga0207650_10067455 | Ga0207650_100674555 | 234 |
| 148 | 3300025927 | Ga0207687_10000015 | Ga0207687_1000001590 | 234 |
| 149 | 3300025927 | Ga0207687_10000126 | Ga0207687_1000012644 | 234 |
| 150 | 3300025935 | Ga0207709_10004459 | Ga0207709_100044596 | 234 |
| 151 | 3300025938 | Ga0207704_10000084 | Ga0207704_1000008437 | 234 |
| 152 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011537 | 234 |
| 153 | 3300025944 | Ga0207661_10000372 | Ga0207661_1000037221 | 234 |
| 154 | 3300025944 | Ga0207661_10000966 | Ga0207661_1000096616 | 234 |
| 155 | 3300025981 | Ga0207640_10000074 | Ga0207640_1000007479 | 234 |
| 156 | 3300026023 | Ga0207677_10021367 | Ga0207677_100213674 | 234 |
| 157 | 3300026041 | Ga0207639_10023429 | Ga0207639_100234294 | 234 |
| 158 | 3300026078 | Ga0207702_10008001 | Ga0207702_100080014 | 234 |
| 159 | 3300026088 | Ga0207641_10000129 | Ga0207641_1000012995 | 234 |
| 160 | 3300026121 | Ga0207683_10014172 | Ga0207683_100141722 | 234 |
| 161 | 3300028379 | Ga0268266_10015981 | Ga0268266_100159814 | 234 |
| 162 | 3300044694 | Ga0466963_0022479 | Ga0466963_0022479_410_1114 | 234 |
| 163 | 3300046459 | Ga0495629_0000025 | Ga0495629_0000025_70401_71105 | 234 |
| 164 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_187700_188404 | 234 |
| 165 | 3300046512 | Ga0495610_0054977 | Ga0495610_0054977_481_1224 | 234 |
| 166 | 3300046543 | Ga0495645_0023602 | Ga0495645_0023602_1827_2561 | 234 |
| 167 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_63522_64226 | 234 |
| 168 | 3300046683 | Ga0495658_0004896 | Ga0495658_0004896_2973_3677 | 234 |
| 169 | 3300047320 | Ga0495672_0153206 | Ga0495672_0153206_172_915 | 234 |
| 170 | 3300047673 | Ga0495593_0085326 | Ga0495593_0085326_515_1234 | 234 |
| 171 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_253422_254129 | 234 |
| 172 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_259416_260120 | 234 |
| 173 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_274972_275676 | 234 |
| 174 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_253422_254129 | 234 |
| 175 | 3300048915 | Ga0496112_0004614 | Ga0496112_0004614_650_1354 | 234 |
| 176 | 3300048916 | Ga0496113_0000001 | Ga0496113_0000001_105793_106497 | 234 |
| 177 | 3300048928 | Ga0496125_0109359 | Ga0496125_0109359_891_1598 | 234 |
| 178 | 3300050515 | nmdc:mga0a205_273_c3 | nmdc:mga0a205_273_c3_151_867 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vi8-assembly1.cif.gz_A | crystal structure of chbg | 0.8387 | 4 | 228 |
| 2i5i-assembly1.cif.gz_A | crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution | 0.8134 | 4 | 228 |
| 7vi8-assembly1.cif.gz_A | crystal structure of chbg | 0.8048 | 4 | 228 |
| 2i5i-assembly1.cif.gz_A | crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution | 0.78 | 4 | 228 |
| 2cc0-assembly1.cif.gz_B | family 4 carbohydrate esterase from streptomyces lividans in complex with acetate | 0.7251 | 5 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37794_1_249_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8303 | 4 | 228 | 3.20.20.370 |
| af_P37794_1_249_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.796 | 4 | 228 | 3.20.20.370 |
| 2i5iB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.793 | 4 | 228 | 3.20.20.370 |
| af_A2BIR6_5_313_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7609 | 5 | 228 | 3.20.20.370 |
| 2i5iB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7606 | 4 | 228 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7YRS2-F1-model_v4 | ChbG/HpnK family deacetylase | 0.9837 | 28 | 228 |
GO:0005975
GO:0019213 GO:0046872 |
| AF-A0A6J4IXB5-F1-model_v4 | Cellobiose phosphotransferase system YdjC-like protein | 0.9809 | 4 | 232 |
GO:0005975
GO:0016740 GO:0019213 GO:0046872 |
| AF-A0A2V9J9D3-F1-model_v4 | ChbG/HpnK family deacetylase | 0.9789 | 1 | 219 |
GO:0005975
GO:0019213 GO:0046872 |
| AF-A0A2V9BM23-F1-model_v4 | ChbG/HpnK family deacetylase | 0.9754 | 92 | 228 |
GO:0005975
GO:0019213 GO:0046872 |
| AF-A0A535CZI5-F1-model_v4 | ChbG/HpnK family deacetylase | 0.975 | 4 | 198 |
GO:0005975
GO:0019213 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar