F270231

General Info

Members Datasets Scaffolds Average Seq Length
177 109 176 149

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10671737|Ga0163162_106717372
Length 155
Sequence LTIESILRFLEMMVNKPIIRFFYETTGFHFSKRNQLKLFLAKLFKNESTPLQSLNYIFCSDEYLLDINKTNLEHDYYTDIITFNLSDNSAVAGEIYISIDRVRDNALNEDEPFIRELHRVIFHGALHLCGFGDKTPKEQSEMRKQEDHYLNAYFK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
76 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
90 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
91 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
96 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
97 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
98 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
99 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
100 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
101 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
102 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
105 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
108 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0
Rhizoplane 0.56
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10172246 3300003322 Bacteria 3100
2 rootL2_10188740 3300003322 Bacteria 3635
3 rootH1_10242423 3300003323 Bacteria 2207
4 Ga0065704_10165962 3300005289 Bacteria 1322
5 Ga0070658_10859773 3300005327 Bacteria 788
6 Ga0070658_11484773 3300005327 Bacteria 588
7 Ga0070670_100297597 3300005331 Bacteria 1411
8 Ga0070666_10544032 3300005335 Bacteria 844
9 Ga0068868_100553712 3300005338 Bacteria 1014
10 Ga0070667_100398134 3300005367 Bacteria 1253
11 Ga0070667_100453243 3300005367 Bacteria 1172
12 Ga0070700_101217667 3300005441 Bacteria 629
13 Ga0070681_10142238 3300005458 Bacteria 2328
14 Ga0070706_100274819 3300005467 Unclassified 1572
15 Ga0070699_100302778 3300005518 Bacteria 1434
16 Ga0068853_100028678 3300005539 Unclassified 4684
17 Ga0068853_100090048 3300005539 Bacteria 2696
18 Ga0068853_100207887 3300005539 Bacteria 1783
19 Ga0070665_100000047 3300005548 Bacteria 269702
20 Ga0068855_100089113 3300005563 Bacteria 3563
21 Ga0068855_100745481 3300005563 Bacteria 1045
22 Ga0068855_101234273 3300005563 Bacteria 776
23 Ga0068857_100193062 3300005577 Unclassified 1855
24 Ga0068857_100636377 3300005577 Bacteria 1010
25 Ga0068854_100713454 3300005578 Bacteria 867
26 Ga0068856_100011654 3300005614 Bacteria 8528
27 Ga0068856_100100926 3300005614 Bacteria 2879
28 Ga0068856_100900012 3300005614 Bacteria 904
29 Ga0068852_100000290 3300005616 Bacteria 33743
30 Ga0068852_101829408 3300005616 Bacteria 629
31 Ga0068859_101042551 3300005617 Unclassified 899
32 Ga0068864_100491726 3300005618 Bacteria 1179
33 Ga0068864_100939378 3300005618 Bacteria 855
34 Ga0068861_102021137 3300005719 Unclassified 575
35 Ga0068851_10276661 3300005834 Bacteria 959
36 Ga0068863_101013992 3300005841 Bacteria 833
37 Ga0068858_100363784 3300005842 Bacteria 1387
38 Ga0068860_100000024 3300005843 Bacteria 271902
39 Ga0068860_100169213 3300005843 Bacteria 2110
40 Ga0075366_10012831 3300006195 Bacteria 4763
41 Ga0075366_10030233 3300006195 Bacteria 3183
42 Ga0075366_10038169 3300006195 Bacteria 2837
43 Ga0075366_10464820 3300006195 Bacteria 781
44 Ga0097621_100776288 3300006237 Unclassified 886
45 Ga0068871_100859687 3300006358 Unclassified 839
46 Ga0068871_100886473 3300006358 Unclassified 826
47 Ga0097620_101042556 3300006931 Unclassified 899
48 Ga0105240_10000445 3300009093 Bacteria 76036
49 Ga0105240_10028329 3300009093 Bacteria 7318
50 Ga0105240_10031748 3300009093 Bacteria 6844
51 Ga0105240_10054258 3300009093 Bacteria 5023
52 Ga0114129_10005958 3300009147 Bacteria 17260
53 Ga0105241_10000180 3300009174 Bacteria 47089
54 Ga0105241_10390024 3300009174 Unclassified 1219
55 Ga0105241_10478208 3300009174 Bacteria 1107
56 Ga0105237_10000294 3300009545 Bacteria 69126
57 Ga0105237_10009180 3300009545 Bacteria 10619
58 Ga0105237_10014556 3300009545 Bacteria 8220
59 Ga0105237_10019366 3300009545 Bacteria 7029
60 Ga0105237_10045593 3300009545 Bacteria 4411
61 Ga0105237_10305260 3300009545 Bacteria 1594
62 Ga0105237_10834852 3300009545 Bacteria 928
63 Ga0105238_10081202 3300009551 Bacteria 3231
64 Ga0105238_10241168 3300009551 Bacteria 1785
65 Ga0105238_10825976 3300009551 Bacteria 943
66 Ga0105249_11121560 3300009553 Bacteria 857
67 Ga0105239_10024263 3300010375 Bacteria 6680
68 Ga0105239_10142451 3300010375 Bacteria 2672
69 Ga0105239_10150581 3300010375 Bacteria 2597
70 Ga0105239_10423759 3300010375 Bacteria 1508
71 Ga0105239_10827655 3300010375 Bacteria 1061
72 Ga0105239_12315099 3300010375 Bacteria 625
73 Ga0157373_10040666 3300013100 Bacteria 3326
74 Ga0157370_10005965 3300013104 Bacteria 13558
75 Ga0157374_10068406 3300013296 Bacteria 3341
76 Ga0157374_10424670 3300013296 Bacteria 1328
77 Ga0157374_11104991 3300013296 Bacteria 813
78 Ga0157378_10194826 3300013297 Bacteria 1914
79 Ga0157378_11128072 3300013297 Bacteria 822
80 Ga0163162_10003261 3300013306 Bacteria 15526
81 Ga0163162_10671737 3300013306 Bacteria 1159
82 Ga0163162_10700891 3300013306 Bacteria 1134
83 Ga0157372_10005167 3300013307 Bacteria 13880
84 Ga0157372_10009054 3300013307 Bacteria 10577
85 Ga0157372_12283379 3300013307 Bacteria 621
86 Ga0157379_10269217 3300014968 Bacteria 1549
87 Ga0157376_11551731 3300014969 Bacteria 696
88 Ga0163161_10132434 3300017792 Bacteria 1882
89 Ga0207647_10001442 3300025904 Bacteria 18234
90 Ga0207647_10069866 3300025904 Bacteria 2123
91 Ga0207705_11180017 3300025909 Bacteria 588
92 Ga0207654_10207758 3300025911 Bacteria 1293
93 Ga0207707_10158032 3300025912 Bacteria 1982
94 Ga0207695_10000676 3300025913 Bacteria 67018
95 Ga0207695_10001116 3300025913 Bacteria 46659
96 Ga0207695_10034208 3300025913 Bacteria 5531
97 Ga0207695_10225628 3300025913 Bacteria 1780
98 Ga0207695_10533780 3300025913 Bacteria 1055
99 Ga0207671_10000533 3300025914 Bacteria 51330
100 Ga0207671_10000961 3300025914 Bacteria 35766
101 Ga0207671_10001227 3300025914 Bacteria 30346
102 Ga0207671_10010807 3300025914 Bacteria 7489
103 Ga0207671_10033169 3300025914 Bacteria 3842
104 Ga0207694_10055829 3300025924 Bacteria 3066
105 Ga0207694_10339106 3300025924 Bacteria 1243
106 Ga0207694_10379814 3300025924 Unclassified 1173
107 Ga0207650_10119327 3300025925 Bacteria 2051
108 Ga0207667_10001182 3300025949 Bacteria 32810
109 Ga0207667_10050710 3300025949 Bacteria 4378
110 Ga0207658_10030350 3300025986 Bacteria 3826
111 Ga0207658_10504551 3300025986 Bacteria 1078
112 Ga0207658_10505440 3300025986 Bacteria 1077
113 Ga0207677_10059278 3300026023 Bacteria 2640
114 Ga0207703_11719301 3300026035 Unclassified 603
115 Ga0207639_10111341 3300026041 Bacteria 2231
116 Ga0207702_10013015 3300026078 Bacteria 6919
117 Ga0207702_10026158 3300026078 Bacteria 4844
118 Ga0207702_10884920 3300026078 Bacteria 885
119 Ga0207676_10815056 3300026095 Bacteria 911
120 Ga0207674_10172135 3300026116 Bacteria 2118
121 Ga0207675_100820028 3300026118 Bacteria 944
122 Ga0207698_10213345 3300026142 Bacteria 1738
123 Ga0207698_10299522 3300026142 Bacteria 1496
124 Ga0268266_10000048 3300028379 Bacteria 310336
125 Ga0268264_10000028 3300028381 Bacteria 426662
126 Ga0268264_10014151 3300028381 Bacteria 6560
127 Ga0307517_10041785 3300028786 Bacteria 4938
128 Ga0307517_10048675 3300028786 Bacteria 4356
129 Ga0307511_10000002 3300030521 Bacteria 199923
130 Ga0307509_10289895 3300031507 Bacteria 1392
131 Ga0307509_10687778 3300031507 Bacteria 690
132 Ga0307508_10176629 3300031616 Bacteria 1739
133 Ga0307516_10087623 3300031730 Bacteria 2947
134 Ga0373935_0220126 3300035692 Bacteria 1318
135 Ga0373927_0077166 3300035695 Bacteria 2158
136 Ga0451798_0205282 3300041458 Bacteria 1476
137 Ga0451849_0921782 3300041505 Bacteria 1544
138 Ga0451853_1220614 3300041512 Bacteria 1725
139 Ga0439464_0208339 3300042439 Bacteria 625
140 Ga0466964_0672013 3300044706 Unclassified 575
141 Ga0466970_0010480 3300044765 Bacteria 4706
142 Ga0466957_0323577 3300044842 Unclassified 1041
143 Ga0466960_0378046 3300044901 Bacteria 812
144 Ga0495638_0305728 3300046460 Unclassified 855
145 Ga0495625_0090196 3300046660 Unclassified 2121
146 Ga0495672_0229108 3300047320 Bacteria 913
147 Ga0495687_000129 3300047443 Bacteria 116030
148 Ga0495686_0000005 3300047472 Bacteria 827143
149 Ga0501047_1097722 3300049581 Unclassified 609
150 Ga0501219_000019 3300049703 Bacteria 25267
151 Ga0501241_004289 3300049758 Bacteria 2679
152 Ga0501284_00007 3300050005 Bacteria 147956
153 nmdc:mga0k408_16267_c1 3300050493 Bacteria 4125
154 nmdc:mga0k408_28846_c1 3300050493 Bacteria 3156
155 nmdc:mga0k408_455819_c1 3300050493 Bacteria 759
156 nmdc:mga0k408_5440_c1 3300050493 Bacteria 6780
157 nmdc:mga07m45_77373_c1 3300050496 Bacteria 1897
158 nmdc:mga05p37_3999_c1 3300050507 Bacteria 11270
159 Ga0500643_016268 3300053087 Bacteria 2523
160 Ga0500646_0005146 3300053090 Bacteria 3310
161 Ga0500583_0003120 3300053092 Bacteria 5135
162 Ga0500557_087502 3300053105 Unclassified 1031
163 Ga0500562_065578 3300053108 Bacteria 978
164 Ga0500594_0012871 3300053118 Bacteria 1980
165 Ga0500642_0001866 3300053130 Bacteria 6087
166 Ga0500655_009637 3300053133 Bacteria 1743
167 Ga0500568_0008557 3300053139 Bacteria 4922
168 Ga0500577_0068556 3300053142 Bacteria 1385
169 Ga0500588_0006837 3300053146 Bacteria 2607
170 Ga0500616_0162539 3300053153 Unclassified 1022
171 Ga0500622_0000904 3300053156 Bacteria 25254
172 Ga0500622_0222927 3300053156 Bacteria 844
173 Ga0500637_0016474 3300053178 Bacteria 3939
174 Ga0500645_001147 3300053730 Bacteria 14353
175 Ga0500645_014893 3300053730 Bacteria 2472
176 Ga0500645_020413 3300053730 Bacteria 2054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100491726 Ga0068864_1004917262 143
2 3300005834 Ga0068851_10276661 Ga0068851_102766613 143
3 3300005331 Ga0070670_100297597 Ga0070670_1002975972 144
4 3300005518 Ga0070699_100302778 Ga0070699_1003027782 144
5 3300006195 Ga0075366_10012831 Ga0075366_100128315 144
6 3300009147 Ga0114129_10005958 Ga0114129_1000595811 144
7 3300013306 Ga0163162_10671737 Ga0163162_106717372 144
8 3300017792 Ga0163161_10132434 Ga0163161_101324342 144
9 3300025925 Ga0207650_10119327 Ga0207650_101193273 144
10 3300050493 nmdc:mga0k408_5440_c1 nmdc:mga0k408_5440_c1_1330_1776 144
11 3300050507 nmdc:mga05p37_3999_c1 nmdc:mga05p37_3999_c1_6344_6790 144
12 3300003322 rootL2_10188740 rootL2_101887403 145
13 3300005367 Ga0070667_100453243 Ga0070667_1004532432 145
14 3300005458 Ga0070681_10142238 Ga0070681_101422382 145
15 3300005467 Ga0070706_100274819 Ga0070706_1002748194 145
16 3300005539 Ga0068853_100028678 Ga0068853_1000286787 145
17 3300005563 Ga0068855_101234273 Ga0068855_1012342733 145
18 3300006195 Ga0075366_10030233 Ga0075366_100302334 145
19 3300006195 Ga0075366_10038169 Ga0075366_100381693 145
20 3300009174 Ga0105241_10478208 Ga0105241_104782083 145
21 3300009545 Ga0105237_10000294 Ga0105237_1000029439 145
22 3300009545 Ga0105237_10009180 Ga0105237_100091807 145
23 3300009545 Ga0105237_10045593 Ga0105237_100455933 145
24 3300009551 Ga0105238_10825976 Ga0105238_108259762 145
25 3300010375 Ga0105239_10142451 Ga0105239_101424512 145
26 3300010375 Ga0105239_10150581 Ga0105239_101505814 145
27 3300013296 Ga0157374_10424670 Ga0157374_104246703 145
28 3300013307 Ga0157372_12283379 Ga0157372_122833791 145
29 3300014969 Ga0157376_11551731 Ga0157376_115517312 145
30 3300025904 Ga0207647_10069866 Ga0207647_100698661 145
31 3300025912 Ga0207707_10158032 Ga0207707_101580322 145
32 3300025913 Ga0207695_10000676 Ga0207695_100006765 145
33 3300025914 Ga0207671_10000533 Ga0207671_1000053330 145
34 3300025914 Ga0207671_10033169 Ga0207671_100331695 145
35 3300025986 Ga0207658_10505440 Ga0207658_105054401 145
36 3300031507 Ga0307509_10687778 Ga0307509_106877782 145
37 3300035695 Ga0373927_0077166 Ga0373927_0077166_1122_1571 145
38 3300041458 Ga0451798_0205282 Ga0451798_0205282_508_957 145
39 3300041512 Ga0451853_1220614 Ga0451853_1220614_489_938 145
40 3300044706 Ga0466964_0672013 Ga0466964_0672013_73_513 145
41 3300044901 Ga0466960_0378046 Ga0466960_0378046_319_759 145
42 3300047320 Ga0495672_0229108 Ga0495672_0229108_124_582 145
43 3300047472 Ga0495686_0000005 Ga0495686_0000005_708893_709333 145
44 3300049703 Ga0501219_000019 Ga0501219_000019_12857_13297 145
45 3300049758 Ga0501241_004289 Ga0501241_004289_922_1362 145
46 3300050005 Ga0501284_00007 Ga0501284_00007_42063_42503 145
47 3300050493 nmdc:mga0k408_16267_c1 nmdc:mga0k408_16267_c1_1867_2316 145
48 3300050493 nmdc:mga0k408_28846_c1 nmdc:mga0k408_28846_c1_1646_2095 145
49 3300050493 nmdc:mga0k408_455819_c1 nmdc:mga0k408_455819_c1_201_650 145
50 3300053730 Ga0500645_014893 Ga0500645_014893_869_1309 145
51 3300003322 rootL2_10172246 rootL2_101722465 146
52 3300003323 rootH1_10242423 rootH1_102424234 146
53 3300005289 Ga0065704_10165962 Ga0065704_101659623 146
54 3300005327 Ga0070658_10859773 Ga0070658_108597731 146
55 3300005327 Ga0070658_11484773 Ga0070658_114847731 146
56 3300005335 Ga0070666_10544032 Ga0070666_105440322 146
57 3300005338 Ga0068868_100553712 Ga0068868_1005537122 146
58 3300005367 Ga0070667_100398134 Ga0070667_1003981342 146
59 3300005441 Ga0070700_101217667 Ga0070700_1012176671 146
60 3300005539 Ga0068853_100090048 Ga0068853_1000900482 146
61 3300005539 Ga0068853_100207887 Ga0068853_1002078874 146
62 3300005548 Ga0070665_100000047 Ga0070665_10000004744 146
63 3300005563 Ga0068855_100089113 Ga0068855_1000891133 146
64 3300005563 Ga0068855_100745481 Ga0068855_1007454812 146
65 3300005577 Ga0068857_100193062 Ga0068857_1001930622 146
66 3300005577 Ga0068857_100636377 Ga0068857_1006363771 146
67 3300005578 Ga0068854_100713454 Ga0068854_1007134541 146
68 3300005614 Ga0068856_100011654 Ga0068856_1000116547 146
69 3300005614 Ga0068856_100100926 Ga0068856_1001009262 146
70 3300005614 Ga0068856_100900012 Ga0068856_1009000121 146
71 3300005616 Ga0068852_100000290 Ga0068852_10000029028 146
72 3300005616 Ga0068852_101829408 Ga0068852_1018294081 146
73 3300005617 Ga0068859_101042551 Ga0068859_1010425512 146
74 3300005618 Ga0068864_100939378 Ga0068864_1009393782 146
75 3300005719 Ga0068861_102021137 Ga0068861_1020211371 146
76 3300005841 Ga0068863_101013992 Ga0068863_1010139922 146
77 3300005842 Ga0068858_100363784 Ga0068858_1003637842 146
78 3300005843 Ga0068860_100000024 Ga0068860_10000002429 146
79 3300005843 Ga0068860_100169213 Ga0068860_1001692132 146
80 3300006195 Ga0075366_10464820 Ga0075366_104648202 146
81 3300006237 Ga0097621_100776288 Ga0097621_1007762882 146
82 3300006358 Ga0068871_100859687 Ga0068871_1008596871 146
83 3300006358 Ga0068871_100886473 Ga0068871_1008864732 146
84 3300006931 Ga0097620_101042556 Ga0097620_1010425561 146
85 3300009093 Ga0105240_10000445 Ga0105240_1000044550 146
86 3300009093 Ga0105240_10028329 Ga0105240_100283291 146
87 3300009093 Ga0105240_10031748 Ga0105240_100317486 146
88 3300009093 Ga0105240_10054258 Ga0105240_100542585 146
89 3300009174 Ga0105241_10000180 Ga0105241_1000018029 146
90 3300009174 Ga0105241_10390024 Ga0105241_103900242 146
91 3300009545 Ga0105237_10014556 Ga0105237_100145566 146
92 3300009545 Ga0105237_10019366 Ga0105237_100193661 146
93 3300009545 Ga0105237_10305260 Ga0105237_103052602 146
94 3300009545 Ga0105237_10834852 Ga0105237_108348522 146
95 3300009551 Ga0105238_10081202 Ga0105238_100812023 146
96 3300009551 Ga0105238_10241168 Ga0105238_102411682 146
97 3300009553 Ga0105249_11121560 Ga0105249_111215601 146
98 3300010375 Ga0105239_10024263 Ga0105239_100242632 146
99 3300010375 Ga0105239_10423759 Ga0105239_104237593 146
100 3300010375 Ga0105239_10827655 Ga0105239_108276552 146
101 3300010375 Ga0105239_12315099 Ga0105239_123150991 146
102 3300013100 Ga0157373_10040666 Ga0157373_100406662 146
103 3300013104 Ga0157370_10005965 Ga0157370_100059652 146
104 3300013296 Ga0157374_10068406 Ga0157374_100684062 146
105 3300013296 Ga0157374_11104991 Ga0157374_111049912 146
106 3300013297 Ga0157378_10194826 Ga0157378_101948263 146
107 3300013297 Ga0157378_11128072 Ga0157378_111280721 146
108 3300013306 Ga0163162_10003261 Ga0163162_100032617 146
109 3300013306 Ga0163162_10700891 Ga0163162_107008911 146
110 3300013307 Ga0157372_10005167 Ga0157372_100051672 146
111 3300013307 Ga0157372_10009054 Ga0157372_100090544 146
112 3300014968 Ga0157379_10269217 Ga0157379_102692172 146
113 3300025904 Ga0207647_10001442 Ga0207647_100014422 146
114 3300025909 Ga0207705_11180017 Ga0207705_111800171 146
115 3300025911 Ga0207654_10207758 Ga0207654_102077583 146
116 3300025913 Ga0207695_10001116 Ga0207695_1000111621 146
117 3300025913 Ga0207695_10034208 Ga0207695_100342083 146
118 3300025913 Ga0207695_10225628 Ga0207695_102256282 146
119 3300025913 Ga0207695_10533780 Ga0207695_105337801 146
120 3300025914 Ga0207671_10000961 Ga0207671_1000096131 146
121 3300025914 Ga0207671_10001227 Ga0207671_1000122720 146
122 3300025914 Ga0207671_10010807 Ga0207671_100108076 146
123 3300025924 Ga0207694_10055829 Ga0207694_100558294 146
124 3300025924 Ga0207694_10339106 Ga0207694_103391062 146
125 3300025924 Ga0207694_10379814 Ga0207694_103798143 146
126 3300025949 Ga0207667_10001182 Ga0207667_100011822 146
127 3300025949 Ga0207667_10050710 Ga0207667_100507102 146
128 3300025986 Ga0207658_10030350 Ga0207658_100303504 146
129 3300025986 Ga0207658_10504551 Ga0207658_105045511 146
130 3300026023 Ga0207677_10059278 Ga0207677_100592782 146
131 3300026035 Ga0207703_11719301 Ga0207703_117193011 146
132 3300026041 Ga0207639_10111341 Ga0207639_101113415 146
133 3300026078 Ga0207702_10013015 Ga0207702_100130154 146
134 3300026078 Ga0207702_10026158 Ga0207702_100261586 146
135 3300026078 Ga0207702_10884920 Ga0207702_108849201 146
136 3300026095 Ga0207676_10815056 Ga0207676_108150561 146
137 3300026116 Ga0207674_10172135 Ga0207674_101721352 146
138 3300026118 Ga0207675_100820028 Ga0207675_1008200281 146
139 3300026142 Ga0207698_10213345 Ga0207698_102133451 146
140 3300026142 Ga0207698_10299522 Ga0207698_102995222 146
141 3300028379 Ga0268266_10000048 Ga0268266_1000004842 146
142 3300028381 Ga0268264_10000028 Ga0268264_10000028209 146
143 3300028381 Ga0268264_10014151 Ga0268264_100141512 146
144 3300028786 Ga0307517_10041785 Ga0307517_100417853 146
145 3300028786 Ga0307517_10048675 Ga0307517_100486751 146
146 3300030521 Ga0307511_10000002 Ga0307511_1000000245 146
147 3300031507 Ga0307509_10289895 Ga0307509_102898951 146
148 3300031616 Ga0307508_10176629 Ga0307508_101766293 146
149 3300031730 Ga0307516_10087623 Ga0307516_100876232 146
150 3300035692 Ga0373935_0220126 Ga0373935_0220126_773_1219 146
151 3300041505 Ga0451849_0921782 Ga0451849_0921782_250_693 146
152 3300042439 Ga0439464_0208339 Ga0439464_0208339_118_561 146
153 3300044765 Ga0466970_0010480 Ga0466970_0010480_2307_2756 146
154 3300044842 Ga0466957_0323577 Ga0466957_0323577_195_644 146
155 3300046460 Ga0495638_0305728 Ga0495638_0305728_218_667 146
156 3300046660 Ga0495625_0090196 Ga0495625_0090196_1471_1914 146
157 3300047443 Ga0495687_000129 Ga0495687_000129_57235_57678 146
158 3300049581 Ga0501047_1097722 Ga0501047_1097722_137_580 146
159 3300050496 nmdc:mga07m45_77373_c1 nmdc:mga07m45_77373_c1_393_845 146
160 3300053087 Ga0500643_016268 Ga0500643_016268_334_804 146
161 3300053090 Ga0500646_0005146 Ga0500646_0005146_945_1415 146
162 3300053092 Ga0500583_0003120 Ga0500583_0003120_3999_4469 146
163 3300053105 Ga0500557_087502 Ga0500557_087502_376_846 146
164 3300053108 Ga0500562_065578 Ga0500562_065578_79_531 146
165 3300053118 Ga0500594_0012871 Ga0500594_0012871_1275_1727 146
166 3300053130 Ga0500642_0001866 Ga0500642_0001866_2804_3274 146
167 3300053133 Ga0500655_009637 Ga0500655_009637_716_1165 146
168 3300053139 Ga0500568_0008557 Ga0500568_0008557_234_677 146
169 3300053142 Ga0500577_0068556 Ga0500577_0068556_725_1195 146
170 3300053146 Ga0500588_0006837 Ga0500588_0006837_571_1014 146
171 3300053153 Ga0500616_0162539 Ga0500616_0162539_42_524 146
172 3300053156 Ga0500622_0000904 Ga0500622_0000904_11612_12082 146
173 3300053156 Ga0500622_0222927 Ga0500622_0222927_115_600 146
174 3300053178 Ga0500637_0016474 Ga0500637_0016474_2938_3384 146
175 3300053730 Ga0500645_001147 Ga0500645_001147_7887_8369 146
176 3300053730 Ga0500645_020413 Ga0500645_020413_1323_1805 146
177 iso_pu_bacteria 2818991444 2819585823 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

27

153

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.8227 9 144
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.799 9 141
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.78 9 145
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.7522 9 144
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7522 9 145
ID Description Score Start End Superfamily
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8953 43 142 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8624 11 144 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8331 9 145 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.7918 11 144 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.7805 9 145 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A1M5CHC9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9923 36 144 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A3B7MRB0-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9902 9 144 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A258UD62-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9901 26 143 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7W1ZUB2-F1-model_v4 rRNA maturation RNase YbeY 0.9878 9 142 GO:0004222
GO:0004519
GO:0006364
GO:0046872
AF-A0A4U3LAK8-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9846 7 144 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Feature Viewer

pLDDT pTM Quality
87.94 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map