F269818

General Info

Members Datasets Scaffolds Average Seq Length
177 113 354 261

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100244798|Ga0068853_1002447982
Length 279
Sequence MLLCTVRGCHLPLTRTEEGSGRRLACPRGHSFDVARSGYINLLQPQDRRSKRPGDTPAAVAARRRSHDLGITAPLLNGIAELAQASPDDIVLDAGCGDGFYLGSLARQSGCAAHGVDISIPAVEAAARRYPPSGVAGGAAYDPGVAGYEWIVANADRFVPYAERSFSIVLSITGRMNATEFRRVLRDDGRLLVALAAPDDMIELRSRAGTAGRDRVPQTLETFAPQFKLMARSRVTTAADLDAATVQDVLLSIYRPLRSQPVEATRVTFSLDLLLFGSA

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.13
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 20.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100244798 3300005539 Bacteria 1644
2 Ga0070683_100000035 3300005329 Bacteria 122362
3 Ga0070683_100004980 3300005329 Bacteria 11026
4 Ga0070683_100491191 3300005329 Unclassified 1172
5 Ga0068869_100079101 3300005334 Bacteria 2450
6 Ga0068869_100086929 3300005334 Bacteria 2345
7 Ga0070660_100011253 3300005339 Bacteria 6350
8 Ga0070671_100092892 3300005355 Bacteria 2529
9 Ga0070671_100107361 3300005355 Unclassified 2344
10 Ga0070671_100153767 3300005355 Bacteria 1943
11 Ga0070667_100403248 3300005367 Unclassified 1245
12 Ga0070713_100090384 3300005436 Bacteria 2632
13 Ga0070708_100019160 3300005445 Bacteria 5743
14 Ga0070681_10052298 3300005458 Bacteria 4073
15 Ga0070681_10071235 3300005458 Bacteria 3441
16 Ga0070681_10074962 3300005458 Bacteria 3344
17 Ga0070681_10321122 3300005458 Unclassified 1458
18 Ga0068867_100058037 3300005459 Bacteria 2868
19 Ga0070706_100088179 3300005467 Unclassified 2877
20 Ga0070707_100045660 3300005468 Unclassified 4192
21 Ga0070698_100162716 3300005471 Bacteria 2175
22 Ga0070679_100249375 3300005530 Bacteria 1732
23 Ga0070684_100000037 3300005535 Bacteria 95058
24 Ga0070684_100005311 3300005535 Bacteria 9861
25 Ga0070684_100068669 3300005535 Unclassified 3115
26 Ga0070684_100083494 3300005535 Bacteria 2831
27 Ga0070696_100036338 3300005546 Unclassified 3396
28 Ga0070693_100045942 3300005547 Bacteria 2478
29 Ga0070665_100187346 3300005548 Bacteria 2070
30 Ga0068855_100109789 3300005563 Bacteria 3167
31 Ga0068855_100260160 3300005563 Unclassified 1933
32 Ga0068855_100390358 3300005563 Unclassified 1527
33 Ga0068857_100002214 3300005577 Bacteria 15829
34 Ga0068857_100002492 3300005577 Bacteria 15058
35 Ga0068857_100010077 3300005577 Bacteria 8212
36 Ga0068857_100405419 3300005577 Bacteria 1269
37 Ga0068854_100088784 3300005578 Bacteria 2296
38 Ga0068856_100001400 3300005614 Bacteria 25271
39 Ga0068856_100130104 3300005614 Bacteria 2522
40 Ga0068856_100451233 3300005614 Bacteria 1307
41 Ga0068852_100736690 3300005616 Bacteria 997
42 Ga0068864_100039652 3300005618 Bacteria 4025
43 Ga0068866_10064337 3300005718 Bacteria 1915
44 Ga0068863_100045963 3300005841 Bacteria 4144
45 Ga0068858_100078138 3300005842 Bacteria 3075
46 Ga0070717_10017920 3300006028 Bacteria 5522
47 Ga0070716_100106990 3300006173 Unclassified 1726
48 Ga0097621_100089974 3300006237 Bacteria 2567
49 Ga0097621_100106071 3300006237 Bacteria 2370
50 Ga0068871_100083039 3300006358 Unclassified 2657
51 Ga0068865_100057191 3300006881 Bacteria 2720
52 Ga0068865_100486549 3300006881 Bacteria 1026
53 Ga0075436_100010720 3300006914 Bacteria 6287
54 Ga0105240_10003077 3300009093 Bacteria 26206
55 Ga0105240_10004417 3300009093 Bacteria 21443
56 Ga0105240_10016815 3300009093 Bacteria 9890
57 Ga0105240_10344242 3300009093 Unclassified 1693
58 Ga0105245_10000304 3300009098 Bacteria 47231
59 Ga0105245_10494671 3300009098 Unclassified 1238
60 Ga0114129_10109718 3300009147 Bacteria 3809
61 Ga0114129_10535007 3300009147 Bacteria 1526
62 Ga0105241_10005090 3300009174 Bacteria 9695
63 Ga0105241_10010583 3300009174 Bacteria 6767
64 Ga0105241_10016459 3300009174 Bacteria 5424
65 Ga0105241_10206400 3300009174 Bacteria 1644
66 Ga0105242_10026533 3300009176 Bacteria 4593
67 Ga0105242_10222199 3300009176 Bacteria 1689
68 Ga0105248_10008375 3300009177 Bacteria 11354
69 Ga0105237_10002167 3300009545 Bacteria 24657
70 Ga0105237_10007630 3300009545 Bacteria 11820
71 Ga0105237_10249430 3300009545 Bacteria 1777
72 Ga0105238_10007700 3300009551 Bacteria 10770
73 Ga0105238_10039570 3300009551 Bacteria 4781
74 Ga0105238_10139809 3300009551 Bacteria 2398
75 Ga0105239_10069947 3300010375 Bacteria 3855
76 Ga0105239_10082576 3300010375 Bacteria 3539
77 Ga0105239_10104498 3300010375 Bacteria 3136
78 Ga0157370_10006064 3300013104 Bacteria 13414
79 Ga0157369_10030341 3300013105 Bacteria 5963
80 Ga0157369_10067887 3300013105 Bacteria 3832
81 Ga0157374_10153804 3300013296 Bacteria 2238
82 Ga0157378_10001632 3300013297 Bacteria 20276
83 Ga0157378_10002442 3300013297 Bacteria 16534
84 Ga0157378_10002808 3300013297 Bacteria 15533
85 Ga0157378_10063335 3300013297 Bacteria 3304
86 Ga0157378_10146740 3300013297 Unclassified 2195
87 Ga0157378_10598734 3300013297 Unclassified 1113
88 Ga0163162_10036984 3300013306 Bacteria 4870
89 Ga0157372_10093587 3300013307 Bacteria 3420
90 Ga0157375_10000046 3300013308 Bacteria 150644
91 Ga0157375_10002414 3300013308 Bacteria 16181
92 Ga0157375_10362543 3300013308 Bacteria 1615
93 Ga0163163_10005489 3300014325 Bacteria 10973
94 Ga0163163_10128296 3300014325 Bacteria 2575
95 Ga0163163_10486827 3300014325 Bacteria 1295
96 Ga0157376_10245428 3300014969 Unclassified 1670
97 Ga0213875_10055679 3300021388 Bacteria 1852
98 Ga0207699_10308475 3300025906 Unclassified 1107
99 Ga0207645_10107294 3300025907 Unclassified 1806
100 Ga0207705_10013653 3300025909 Bacteria 5859
101 Ga0207654_10009458 3300025911 Bacteria 4949
102 Ga0207695_10002397 3300025913 Bacteria 27790
103 Ga0207695_10012856 3300025913 Bacteria 10021
104 Ga0207695_10051645 3300025913 Bacteria 4314
105 Ga0207671_10004131 3300025914 Bacteria 14036
106 Ga0207660_10028051 3300025917 Unclassified 3848
107 Ga0207646_10027024 3300025922 Bacteria 5232
108 Ga0207694_10004054 3300025924 Bacteria 11508
109 Ga0207694_10182663 3300025924 Unclassified 1701
110 Ga0207687_10004749 3300025927 Bacteria 9041
111 Ga0207687_10069745 3300025927 Unclassified 2508
112 Ga0207700_10037758 3300025928 Bacteria 3501
113 Ga0207644_10121964 3300025931 Unclassified 1985
114 Ga0207706_10125964 3300025933 Bacteria 2253
115 Ga0207686_10175743 3300025934 Bacteria 1514
116 Ga0207704_10016175 3300025938 Unclassified 3826
117 Ga0207689_10008547 3300025942 Bacteria 8924
118 Ga0207689_10050909 3300025942 Bacteria 3414
119 Ga0207661_10000008 3300025944 Bacteria 451211
120 Ga0207661_10013347 3300025944 Bacteria 6001
121 Ga0207661_10111412 3300025944 Bacteria 2315
122 Ga0207667_10000667 3300025949 Bacteria 44413
123 Ga0207667_10008996 3300025949 Bacteria 11814
124 Ga0207667_10044416 3300025949 Bacteria 4708
125 Ga0207667_10089861 3300025949 Bacteria 3174
126 Ga0207667_10094597 3300025949 Bacteria 3085
127 Ga0207651_10239889 3300025960 Unclassified 1477
128 Ga0207658_10503613 3300025986 Unclassified 1079
129 Ga0207639_10118718 3300026041 Bacteria 2169
130 Ga0207702_10003025 3300026078 Bacteria 15619
131 Ga0207702_10050182 3300026078 Bacteria 3522
132 Ga0207641_10144975 3300026088 Unclassified 2146
133 Ga0207648_10176885 3300026089 Bacteria 1888
134 Ga0207648_10264461 3300026089 Bacteria 1535
135 Ga0207676_10008394 3300026095 Bacteria 7343
136 Ga0207674_10004777 3300026116 Bacteria 16247
137 Ga0207674_10007167 3300026116 Bacteria 13023
138 Ga0207674_10009754 3300026116 Bacteria 10938
139 Ga0207674_10822462 3300026116 Unclassified 896
140 Ga0207698_10245459 3300026142 Unclassified 1635
141 Ga0268266_10069368 3300028379 Bacteria 3054
142 Ga0307511_10000120 3300030521 Bacteria 71419
143 Ga0265320_10001506 3300031240 Bacteria 16968
144 Ga0265329_10004611 3300031242 Bacteria 5699
145 Ga0265340_10037312 3300031247 Unclassified 2408
146 Ga0265339_10048318 3300031249 Bacteria 2334
147 Ga0265313_10020087 3300031595 Bacteria 3697
148 Ga0265314_10004017 3300031711 Bacteria 13906
149 Ga0265342_10090548 3300031712 Unclassified 1754
150 Ga0373927_0019875 3300035695 Bacteria 4404
151 Ga0373947_0043256 3300035725 Bacteria 2690
152 Ga0373947_0047699 3300035725 Bacteria 2568
153 Ga0373925_0215992 3300037068 Unclassified 1529
154 Ga0373925_0627028 3300037068 Bacteria 886
155 Ga0436364_1518253 3300037853 Bacteria 2591
156 Ga0436365_0850543 3300039437 Bacteria 1937
157 Ga0436360_0277089 3300039438 Bacteria 1646
158 Ga0451576_0084599 3300045051 Bacteria 3300
159 Ga0495592_0056725 3300046454 Bacteria 2893
160 Ga0495580_0040477 3300046472 Bacteria 3328
161 Ga0495652_0139510 3300046529 Unclassified 1908
162 Ga0495640_0016136 3300046533 Bacteria 5594
163 Ga0495587_0036938 3300046536 Bacteria 2936
164 Ga0495667_0034564 3300046559 Bacteria 3380
165 Ga0495599_0084954 3300046678 Bacteria 1977
166 Ga0495623_0111681 3300046679 Bacteria 1656
167 Ga0495604_0117784 3300047317 Unclassified 1926
168 Ga0495674_0020058 3300047319 Bacteria 6195
169 Ga0495674_0035368 3300047319 Unclassified 4508
170 Ga0495679_023280 3300047446 Bacteria 2103
171 Ga0495684_0058858 3300047471 Bacteria 2926
172 Ga0495602_0013371 3300048088 Bacteria 8393
173 Ga0496102_0105661 3300048905 Unclassified 2620
174 Ga0496106_0150436 3300048909 Bacteria 1836
175 nmdc:mga05p37_254581_c1 3300050507 Bacteria 2104
176 nmdc:mga08x19_38572_c1 3300050514 Bacteria 3035
177 Ga0500568_0000704 3300053139 Bacteria 23996
178 Ga0068853_100244798
179 Ga0070683_100000035
180 Ga0070683_100004980
181 Ga0070683_100491191
182 Ga0068869_100079101
183 Ga0068869_100086929
184 Ga0070660_100011253
185 Ga0070671_100092892
186 Ga0070671_100107361
187 Ga0070671_100153767
188 Ga0070667_100403248
189 Ga0070713_100090384
190 Ga0070708_100019160
191 Ga0070681_10052298
192 Ga0070681_10071235
193 Ga0070681_10074962
194 Ga0070681_10321122
195 Ga0068867_100058037
196 Ga0070706_100088179
197 Ga0070707_100045660
198 Ga0070698_100162716
199 Ga0070679_100249375
200 Ga0070684_100000037
201 Ga0070684_100005311
202 Ga0070684_100068669
203 Ga0070684_100083494
204 Ga0070696_100036338
205 Ga0070693_100045942
206 Ga0070665_100187346
207 Ga0068855_100109789
208 Ga0068855_100260160
209 Ga0068855_100390358
210 Ga0068857_100002214
211 Ga0068857_100002492
212 Ga0068857_100010077
213 Ga0068857_100405419
214 Ga0068854_100088784
215 Ga0068856_100001400
216 Ga0068856_100130104
217 Ga0068856_100451233
218 Ga0068852_100736690
219 Ga0068864_100039652
220 Ga0068866_10064337
221 Ga0068863_100045963
222 Ga0068858_100078138
223 Ga0070717_10017920
224 Ga0070716_100106990
225 Ga0097621_100089974
226 Ga0097621_100106071
227 Ga0068871_100083039
228 Ga0068865_100057191
229 Ga0068865_100486549
230 Ga0075436_100010720
231 Ga0105240_10003077
232 Ga0105240_10004417
233 Ga0105240_10016815
234 Ga0105240_10344242
235 Ga0105245_10000304
236 Ga0105245_10494671
237 Ga0114129_10109718
238 Ga0114129_10535007
239 Ga0105241_10005090
240 Ga0105241_10010583
241 Ga0105241_10016459
242 Ga0105241_10206400
243 Ga0105242_10026533
244 Ga0105242_10222199
245 Ga0105248_10008375
246 Ga0105237_10002167
247 Ga0105237_10007630
248 Ga0105237_10249430
249 Ga0105238_10007700
250 Ga0105238_10039570
251 Ga0105238_10139809
252 Ga0105239_10069947
253 Ga0105239_10082576
254 Ga0105239_10104498
255 Ga0157370_10006064
256 Ga0157369_10030341
257 Ga0157369_10067887
258 Ga0157374_10153804
259 Ga0157378_10001632
260 Ga0157378_10002442
261 Ga0157378_10002808
262 Ga0157378_10063335
263 Ga0157378_10146740
264 Ga0157378_10598734
265 Ga0163162_10036984
266 Ga0157372_10093587
267 Ga0157375_10000046
268 Ga0157375_10002414
269 Ga0157375_10362543
270 Ga0163163_10005489
271 Ga0163163_10128296
272 Ga0163163_10486827
273 Ga0157376_10245428
274 Ga0213875_10055679
275 Ga0207699_10308475
276 Ga0207645_10107294
277 Ga0207705_10013653
278 Ga0207654_10009458
279 Ga0207695_10002397
280 Ga0207695_10012856
281 Ga0207695_10051645
282 Ga0207671_10004131
283 Ga0207660_10028051
284 Ga0207646_10027024
285 Ga0207694_10004054
286 Ga0207694_10182663
287 Ga0207687_10004749
288 Ga0207687_10069745
289 Ga0207700_10037758
290 Ga0207644_10121964
291 Ga0207706_10125964
292 Ga0207686_10175743
293 Ga0207704_10016175
294 Ga0207689_10008547
295 Ga0207689_10050909
296 Ga0207661_10000008
297 Ga0207661_10013347
298 Ga0207661_10111412
299 Ga0207667_10000667
300 Ga0207667_10008996
301 Ga0207667_10044416
302 Ga0207667_10089861
303 Ga0207667_10094597
304 Ga0207651_10239889
305 Ga0207658_10503613
306 Ga0207639_10118718
307 Ga0207702_10003025
308 Ga0207702_10050182
309 Ga0207641_10144975
310 Ga0207648_10176885
311 Ga0207648_10264461
312 Ga0207676_10008394
313 Ga0207674_10004777
314 Ga0207674_10007167
315 Ga0207674_10009754
316 Ga0207674_10822462
317 Ga0207698_10245459
318 Ga0268266_10069368
319 Ga0307511_10000120
320 Ga0265320_10001506
321 Ga0265329_10004611
322 Ga0265340_10037312
323 Ga0265339_10048318
324 Ga0265313_10020087
325 Ga0265314_10004017
326 Ga0265342_10090548
327 Ga0373927_0019875
328 Ga0373947_0043256
329 Ga0373947_0047699
330 Ga0373925_0215992
331 Ga0373925_0627028
332 Ga0436364_1518253
333 Ga0436365_0850543
334 Ga0436360_0277089
335 Ga0451576_0084599
336 Ga0495592_0056725
337 Ga0495580_0040477
338 Ga0495652_0139510
339 Ga0495640_0016136
340 Ga0495587_0036938
341 Ga0495667_0034564
342 Ga0495599_0084954
343 Ga0495623_0111681
344 Ga0495604_0117784
345 Ga0495674_0020058
346 Ga0495674_0035368
347 Ga0495679_023280
348 Ga0495684_0058858
349 Ga0495602_0013371
350 Ga0496102_0105661
351 Ga0496106_0150436
352 nmdc:mga05p37_254581_c1
353 nmdc:mga08x19_38572_c1
354 Ga0500568_0000704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

92

193

0.91

PF21302

RlmA_N

RlmA, N-terminal

4

51

0.86

PF13649

Methyltransf_25

Methyltransferase domain

91

193

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p91-assembly1.cif.gz_A crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19) 0.8728 1 256
1p91-assembly1.cif.gz_A crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19) 0.8697 1 256
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.8388 70 177
1p91-assembly1.cif.gz_B crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19) 0.8285 1 256
1p91-assembly1.cif.gz_B crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19) 0.8255 1 256
ID Description Score Start End Superfamily
af_P25087_39_327_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.875 72 174 3.40.50.150
af_Q9TYP1_15_268_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8652 71 174 3.40.50.150
af_O74198_45_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.864 72 174 3.40.50.150
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8622 72 134 3.40.50.150
af_A0A0R0HV62_55_242_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8508 68 180 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V7Y124-F1-model_v4 Methyltransferase domain-containing protein 0.9796 53 256
AF-A0A7X2PKQ9-F1-model_v4 Methyltransferase domain-containing protein 0.9661 1 256 GO:0008168
GO:0032259
GO:0046872
AF-A0A6L4ZN27-F1-model_v4 23S rRNA (Guanine745-N1)-methyltransferase 0.9497 2 182 GO:0008168
GO:0032259
AF-A0A3N5GFT5-F1-model_v4 Methyltransferase domain-containing protein 0.9474 2 225 GO:0008168
GO:0032259
GO:0046872
AF-A0A7X9IVX9-F1-model_v4 Methyltransferase domain-containing protein 0.9462 1 256 GO:0008168
GO:0032259
GO:0046872

Map