F268590

General Info

Members Datasets Scaffolds Average Seq Length
176 99 352 176

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100199407|Ga0307415_1001994073
Length 177
Sequence VVFTHDTELALQAAVTLANSALEPDTLLEVGDLDRVWDDYGYSGRHERTRAELDAVRAVRSRLREVLTAASDEAAVDLVNRMLDEAQAVPQLVRHDQLGWHIHAIDPGQPLDRRIVVETAMAMIDVIRADELSRLSLCADETCEGVVLDLSRNRSRRFCSTTCGNRNAVAAYRARQR

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
45 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
46 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
47 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
48 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
59 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
60 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
61 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
62 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
70 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
76 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
80 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
84 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
85 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
86 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
87 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
89 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
90 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
91 2643221679 Angustibacter sp. Root456 Isolate Unclassified
92 2643221692 Nocardia sp. Root136 Isolate Unclassified
93 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
94 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
95 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
96 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
97 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
98 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
99 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.52
Nodule 0
Rhizoplane 5.11
Rhizosphere 55.68
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100199407 3300032126 Bacteria 1587
2 rootH1_10166736 3300003316 Bacteria 1159
3 Ga0070658_10155139 3300005327 Bacteria 1919
4 Ga0070683_101387886 3300005329 Bacteria 675
5 Ga0070682_100808752 3300005337 Bacteria 762
6 Ga0070667_100055632 3300005367 Bacteria 3341
7 Ga0070684_100060773 3300005535 Bacteria 3306
8 Ga0070686_100054057 3300005544 Bacteria 2567
9 Ga0070664_101030796 3300005564 Bacteria 774
10 Ga0068860_100285744 3300005843 Bacteria 1613
11 Ga0081539_10037464 3300005985 Bacteria 2889
12 Ga0081539_10080870 3300005985 Bacteria 1708
13 Ga0075365_10000889 3300006038 Bacteria 12507
14 Ga0075365_10012167 3300006038 Bacteria 5097
15 Ga0075365_10057592 3300006038 Bacteria 2585
16 Ga0075365_10126415 3300006038 Bacteria 1767
17 Ga0075365_10187268 3300006038 Bacteria 1448
18 Ga0075365_10196011 3300006038 Bacteria 1414
19 Ga0075365_10210114 3300006038 Bacteria 1364
20 Ga0075365_10215144 3300006038 Bacteria 1347
21 Ga0075365_10716868 3300006038 Bacteria 706
22 Ga0075368_10044926 3300006042 Bacteria 1744
23 Ga0075363_100001782 3300006048 Bacteria 8425
24 Ga0075363_100002581 3300006048 Bacteria 7453
25 Ga0075363_100028975 3300006048 Bacteria 2854
26 Ga0075363_100225879 3300006048 Bacteria 1074
27 Ga0075364_10010744 3300006051 Bacteria 5539
28 Ga0075364_10026305 3300006051 Bacteria 3711
29 Ga0075364_10205441 3300006051 Bacteria 1336
30 Ga0075364_10219342 3300006051 Bacteria 1290
31 Ga0075367_10005475 3300006178 Bacteria 6311
32 Ga0075367_10086988 3300006178 Bacteria 1897
33 Ga0075367_10096766 3300006178 Bacteria 1800
34 Ga0075367_10166022 3300006178 Bacteria 1374
35 Ga0075367_10295513 3300006178 Bacteria 1019
36 Ga0075370_10006670 3300006353 Bacteria 5824
37 Ga0075370_10029650 3300006353 Bacteria 3048
38 Ga0075370_10220150 3300006353 Bacteria 1122
39 Ga0068865_100061641 3300006881 Bacteria 2630
40 Ga0105245_10021299 3300009098 Bacteria 5684
41 Ga0105243_10271783 3300009148 Bacteria 1522
42 Ga0105239_10064899 3300010375 Bacteria 4008
43 Ga0105246_10439204 3300011119 Bacteria 1094
44 Ga0105246_11234945 3300011119 Bacteria 689
45 Ga0163163_10389445 3300014325 Bacteria 1451
46 Ga0163163_10623861 3300014325 Bacteria 1141
47 Ga0163163_11180525 3300014325 Bacteria 828
48 Ga0157380_10872796 3300014326 Bacteria 923
49 Ga0207705_10229765 3300025909 Bacteria 1411
50 Ga0207711_10136910 3300025941 Bacteria 2200
51 Ga0207658_10087317 3300025986 Bacteria 2408
52 Ga0207678_10525415 3300026067 Bacteria 1033
53 Ga0207674_11435219 3300026116 Bacteria 659
54 Ga0207683_10313872 3300026121 Bacteria 1435
55 Ga0209813_10055925 3300027866 Bacteria 1248
56 Ga0307408_100127391 3300031548 Bacteria 1982
57 Ga0307405_10858127 3300031731 Bacteria 765
58 Ga0307413_10694266 3300031824 Bacteria 845
59 Ga0307410_10062432 3300031852 Bacteria 2553
60 Ga0307410_10954654 3300031852 Bacteria 737
61 Ga0307406_10020341 3300031901 Bacteria 3908
62 Ga0307407_10096137 3300031903 Bacteria 1828
63 Ga0307407_10177386 3300031903 Bacteria 1409
64 Ga0307407_10404970 3300031903 Bacteria 980
65 Ga0307407_10484761 3300031903 Bacteria 904
66 Ga0307407_10630406 3300031903 Bacteria 801
67 Ga0307412_10038173 3300031911 Bacteria 3091
68 Ga0307412_10077554 3300031911 Bacteria 2286
69 Ga0307412_10149655 3300031911 Bacteria 1721
70 Ga0307412_10192859 3300031911 Bacteria 1542
71 Ga0307412_10681547 3300031911 Bacteria 880
72 Ga0307409_100027894 3300031995 Bacteria 4011
73 Ga0307409_100110605 3300031995 Bacteria 2303
74 Ga0307409_100204955 3300031995 Bacteria 1768
75 Ga0307416_100004640 3300032002 Bacteria 8318
76 Ga0307416_100798092 3300032002 Unclassified 1039
77 Ga0307416_101047587 3300032002 Bacteria 920
78 Ga0307415_100000153 3300032126 Bacteria 30563
79 Ga0307415_100028242 3300032126 Bacteria 3566
80 Ga0307415_100294894 3300032126 Bacteria 1340
81 Ga0307415_101386886 3300032126 Bacteria 669
82 Ga0395900_0954937 3300037418 Bacteria 779
83 Ga0451791_0694525 3300041451 Bacteria 737
84 Ga0451853_2007447 3300041512 Bacteria 1836
85 Ga0439431_0014519 3300041997 Bacteria 1826
86 Ga0439432_058502 3300042006 Bacteria 1192
87 Ga0439457_038950 3300042014 Bacteria 1058
88 Ga0450907_007948 3300042146 Bacteria 1766
89 Ga0439434_0003256 3300042435 Bacteria 4767
90 Ga0466972_0399238 3300044658 Bacteria 644
91 Ga0466965_0198903 3300044683 Bacteria 1062
92 Ga0466965_0224122 3300044683 Bacteria 1003
93 Ga0466971_0211806 3300044719 Bacteria 917
94 Ga0466970_0015799 3300044765 Bacteria 3886
95 Ga0466970_0134167 3300044765 Bacteria 1361
96 Ga0466960_0003029 3300044901 Bacteria 6413
97 Ga0466960_0049301 3300044901 Bacteria 2026
98 Ga0466960_0349509 3300044901 Bacteria 843
99 Ga0466959_0638197 3300045049 Bacteria 715
100 Ga0466959_0703635 3300045049 Bacteria 677
101 Ga0466967_0147863 3300045976 Bacteria 2193
102 Ga0466967_0357722 3300045976 Bacteria 1414
103 Ga0495653_0607174 3300046463 Bacteria 672
104 Ga0496102_0296141 3300048905 Bacteria 1525
105 Ga0496108_0164386 3300048911 Bacteria 1919
106 Ga0496109_0300809 3300048912 Bacteria 1513
107 Ga0496109_0539832 3300048912 Bacteria 1100
108 Ga0496109_1017109 3300048912 Bacteria 766
109 Ga0496110_0659180 3300048913 Bacteria 947
110 Ga0496114_0511331 3300048917 Bacteria 1062
111 Ga0496114_1318450 3300048917 Bacteria 609
112 Ga0496124_0042306 3300048927 Bacteria 3924
113 Ga0496124_0332292 3300048927 Bacteria 1083
114 Ga0501034_0131712 3300049571 Bacteria 2484
115 Ga0501036_0605249 3300049572 Bacteria 909
116 Ga0501038_0045611 3300049574 Bacteria 3805
117 Ga0501039_0031651 3300049575 Bacteria 4079
118 Ga0501040_0075596 3300049576 Bacteria 2328
119 Ga0501040_0538253 3300049576 Bacteria 843
120 Ga0501070_0075194 3300049586 Bacteria 2796
121 Ga0501070_0211335 3300049586 Bacteria 1592
122 Ga0501070_0260474 3300049586 Bacteria 1417
123 Ga0501070_1390826 3300049586 Bacteria 533
124 Ga0501072_0257554 3300049588 Bacteria 1389
125 Ga0501073_0218289 3300049589 Bacteria 1317
126 Ga0501074_0201751 3300049590 Bacteria 1417
127 Ga0501227_159866 3300049665 Bacteria 626
128 Ga0501080_0604653 3300049742 Bacteria 973
129 Ga0501045_0557238 3300049824 Bacteria 850
130 nmdc:mga03683_147199_c1 3300050489 Bacteria 1061
131 nmdc:mga03n38_183545_c1 3300050490 Bacteria 1073
132 nmdc:mga03n38_2273_c1 3300050490 Bacteria 5882
133 nmdc:mga03n38_33306_c1 3300050490 Bacteria 2191
134 nmdc:mga03n38_347223_c1 3300050490 Bacteria 807
135 nmdc:mga03n38_71404_c1 3300050490 Bacteria 1608
136 nmdc:mga00v17_21401_c1 3300050491 Bacteria 3718
137 nmdc:mga00v17_738999_c1 3300050491 Bacteria 629
138 nmdc:mga00v17_9285_c1 3300050491 Bacteria 5318
139 nmdc:mga0yw44_137219_c1 3300050492 Bacteria 1587
140 nmdc:mga0yw44_184059_c1 3300050492 Bacteria 1376
141 nmdc:mga0yw44_19048_c1 3300050492 Bacteria 3776
142 nmdc:mga0yw44_334491_c1 3300050492 Bacteria 1018
143 nmdc:mga0yw44_34470_c1 3300050492 Bacteria 2967
144 nmdc:mga0yw44_64948_c1 3300050492 Bacteria 2247
145 nmdc:mga0yw44_700877_c1 3300050492 Bacteria 688
146 nmdc:mga0yw44_771973_c1 3300050492 Bacteria 653
147 nmdc:mga06z11_116226_c1 3300050494 Bacteria 1487
148 nmdc:mga06z11_119168_c1 3300050494 Bacteria 1471
149 nmdc:mga06z11_178773_c1 3300050494 Bacteria 1222
150 nmdc:mga06z11_58363_c1 3300050494 Bacteria 2002
151 nmdc:mga06z11_93421_c1 3300050494 Bacteria 1638
152 nmdc:mga04h51_114093_c1 3300050495 Bacteria 1000
153 nmdc:mga04h51_256867_c1 3300050495 Bacteria 702
154 nmdc:mga04h51_260193_c1 3300050495 Bacteria 698
155 nmdc:mga07m45_100304_c1 3300050496 Bacteria 1662
156 nmdc:mga07m45_154667_c1 3300050496 Bacteria 1330
157 nmdc:mga07m45_287951_c1 3300050496 Bacteria 955
158 nmdc:mga07m45_3212_c1 3300050496 Bacteria 7841
159 nmdc:mga08y16_869359_c1 3300050511 Bacteria 890
160 Ga0495601_0192995 3300053077 Bacteria 1331
161 Ga0500644_0000523 3300053088 Bacteria 16199
162 Ga0500556_0000573 3300053104 Bacteria 24462
163 Ga0500593_000129 3300053117 Bacteria 29908
164 Ga0501084_0084277 3300054114 Bacteria 2668
165 Ga0501082_0050385 3300060353 Bacteria 3591
166 2552109994 2551306166 Bacteria 9731570
167 2644320405 2643221657 Bacteria 5490246
168 2644447334 2643221679 Bacteria 3839507
169 2644514081 2643221692 Bacteria 7282860
170 2644536218 2643221697 Bacteria 3575694
171 2855389752 2855386786 Bacteria 4752232
172 2904767982 2904765812 Bacteria 5369154
173 2904774246 2904770941 Bacteria 5580202
174 2908815285 2908811453 Bacteria 5478616
175 2919423588 2919420072 Bacteria 5390363
176 2919436196 2919432681 Bacteria 5390474
177 Ga0307415_100199407
178 rootH1_10166736
179 Ga0070658_10155139
180 Ga0070683_101387886
181 Ga0070682_100808752
182 Ga0070667_100055632
183 Ga0070684_100060773
184 Ga0070686_100054057
185 Ga0070664_101030796
186 Ga0068860_100285744
187 Ga0081539_10037464
188 Ga0081539_10080870
189 Ga0075365_10000889
190 Ga0075365_10012167
191 Ga0075365_10057592
192 Ga0075365_10126415
193 Ga0075365_10187268
194 Ga0075365_10196011
195 Ga0075365_10210114
196 Ga0075365_10215144
197 Ga0075365_10716868
198 Ga0075368_10044926
199 Ga0075363_100001782
200 Ga0075363_100002581
201 Ga0075363_100028975
202 Ga0075363_100225879
203 Ga0075364_10010744
204 Ga0075364_10026305
205 Ga0075364_10205441
206 Ga0075364_10219342
207 Ga0075367_10005475
208 Ga0075367_10086988
209 Ga0075367_10096766
210 Ga0075367_10166022
211 Ga0075367_10295513
212 Ga0075370_10006670
213 Ga0075370_10029650
214 Ga0075370_10220150
215 Ga0068865_100061641
216 Ga0105245_10021299
217 Ga0105243_10271783
218 Ga0105239_10064899
219 Ga0105246_10439204
220 Ga0105246_11234945
221 Ga0163163_10389445
222 Ga0163163_10623861
223 Ga0163163_11180525
224 Ga0157380_10872796
225 Ga0207705_10229765
226 Ga0207711_10136910
227 Ga0207658_10087317
228 Ga0207678_10525415
229 Ga0207674_11435219
230 Ga0207683_10313872
231 Ga0209813_10055925
232 Ga0307408_100127391
233 Ga0307405_10858127
234 Ga0307413_10694266
235 Ga0307410_10062432
236 Ga0307410_10954654
237 Ga0307406_10020341
238 Ga0307407_10096137
239 Ga0307407_10177386
240 Ga0307407_10404970
241 Ga0307407_10484761
242 Ga0307407_10630406
243 Ga0307412_10038173
244 Ga0307412_10077554
245 Ga0307412_10149655
246 Ga0307412_10192859
247 Ga0307412_10681547
248 Ga0307409_100027894
249 Ga0307409_100110605
250 Ga0307409_100204955
251 Ga0307416_100004640
252 Ga0307416_100798092
253 Ga0307416_101047587
254 Ga0307415_100000153
255 Ga0307415_100028242
256 Ga0307415_100294894
257 Ga0307415_101386886
258 Ga0395900_0954937
259 Ga0451791_0694525
260 Ga0451853_2007447
261 Ga0439431_0014519
262 Ga0439432_058502
263 Ga0439457_038950
264 Ga0450907_007948
265 Ga0439434_0003256
266 Ga0466972_0399238
267 Ga0466965_0198903
268 Ga0466965_0224122
269 Ga0466971_0211806
270 Ga0466970_0015799
271 Ga0466970_0134167
272 Ga0466960_0003029
273 Ga0466960_0049301
274 Ga0466960_0349509
275 Ga0466959_0638197
276 Ga0466959_0703635
277 Ga0466967_0147863
278 Ga0466967_0357722
279 Ga0495653_0607174
280 Ga0496102_0296141
281 Ga0496108_0164386
282 Ga0496109_0300809
283 Ga0496109_0539832
284 Ga0496109_1017109
285 Ga0496110_0659180
286 Ga0496114_0511331
287 Ga0496114_1318450
288 Ga0496124_0042306
289 Ga0496124_0332292
290 Ga0501034_0131712
291 Ga0501036_0605249
292 Ga0501038_0045611
293 Ga0501039_0031651
294 Ga0501040_0075596
295 Ga0501040_0538253
296 Ga0501070_0075194
297 Ga0501070_0211335
298 Ga0501070_0260474
299 Ga0501070_1390826
300 Ga0501072_0257554
301 Ga0501073_0218289
302 Ga0501074_0201751
303 Ga0501227_159866
304 Ga0501080_0604653
305 Ga0501045_0557238
306 nmdc:mga03683_147199_c1
307 nmdc:mga03n38_183545_c1
308 nmdc:mga03n38_2273_c1
309 nmdc:mga03n38_33306_c1
310 nmdc:mga03n38_347223_c1
311 nmdc:mga03n38_71404_c1
312 nmdc:mga00v17_21401_c1
313 nmdc:mga00v17_738999_c1
314 nmdc:mga00v17_9285_c1
315 nmdc:mga0yw44_137219_c1
316 nmdc:mga0yw44_184059_c1
317 nmdc:mga0yw44_19048_c1
318 nmdc:mga0yw44_334491_c1
319 nmdc:mga0yw44_34470_c1
320 nmdc:mga0yw44_64948_c1
321 nmdc:mga0yw44_700877_c1
322 nmdc:mga0yw44_771973_c1
323 nmdc:mga06z11_116226_c1
324 nmdc:mga06z11_119168_c1
325 nmdc:mga06z11_178773_c1
326 nmdc:mga06z11_58363_c1
327 nmdc:mga06z11_93421_c1
328 nmdc:mga04h51_114093_c1
329 nmdc:mga04h51_256867_c1
330 nmdc:mga04h51_260193_c1
331 nmdc:mga07m45_100304_c1
332 nmdc:mga07m45_154667_c1
333 nmdc:mga07m45_287951_c1
334 nmdc:mga07m45_3212_c1
335 nmdc:mga08y16_869359_c1
336 Ga0495601_0192995
337 Ga0500644_0000523
338 Ga0500556_0000573
339 Ga0500593_000129
340 Ga0501084_0084277
341 Ga0501082_0050385
342 2552109994
343 2644320405
344 2644447334
345 2644514081
346 2644536218
347 2855389752
348 2904767982
349 2904774246
350 2908815285
351 2919423588
352 2919436196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

134

176

0.98

PF07336

ABATE

Putative stress-induced transcription regulator

11

130

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.7646 7 173
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.7219 7 173
2mky-assembly1.cif.gz_A structure of the prgk first periplasmic domain 0.4659 73 128
6ybw-assembly1.cif.gz_p structure of a human 48s translational initiation complex - 40s body 0.4519 75 101
1ztg-assembly1.cif.gz_A human alpha polyc binding protein kh1 0.4207 76 128
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7477 7 173 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7058 7 173 1.10.3300.10
af_F1R9Y8_588_651_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.5516 76 124 3.30.1370.10
1qrrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.482 89 125 3.40.50.720
af_A0A1D6KS04_896_969_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.4738 76 129 3.30.1370.10
ID Description Score Start End GO Terms
AF-A0A660LH71-F1-model_v4 CGNR zinc finger protein 0.9737 16 176
AF-K0ETU0-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9716 3 175
AF-A0A542S7U0-F1-model_v4 Putative stress-induced transcription regulator 0.9702 16 175
AF-A0A7T9I9Y8-F1-model_v4 deleted 0.97 1 176
AF-A0A7T9I9Y8-F1-model_v4 deleted 0.9593 1 176

Map